US20050181446A1 - Protein variants having modified immunogenicity - Google Patents

Protein variants having modified immunogenicity Download PDF

Info

Publication number
US20050181446A1
US20050181446A1 US09/957,806 US95780601A US2005181446A1 US 20050181446 A1 US20050181446 A1 US 20050181446A1 US 95780601 A US95780601 A US 95780601A US 2005181446 A1 US2005181446 A1 US 2005181446A1
Authority
US
United States
Prior art keywords
deletion
allergen
seq
protein
protein variant
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US09/957,806
Inventor
Erwin Roggen
Steffen Ernst
Allan Svendsen
Esben Friis
Claus Osten
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novozymes AS
Original Assignee
Novozymes AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=26068820&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=US20050181446(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Application filed by Novozymes AS filed Critical Novozymes AS
Priority to US09/957,806 priority Critical patent/US20050181446A1/en
Assigned to NOVOZYMES A/S reassignment NOVOZYMES A/S ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: FRIIS, PETER ESBEN, SVENDSEN, ALLAN, VON DER OSTEN, CLAUS, ERNST, STEFFEN, ROGGEN, ERWIN LUDO
Publication of US20050181446A1 publication Critical patent/US20050181446A1/en
Priority to US12/699,979 priority patent/US20110045572A1/en
Priority to US13/936,300 priority patent/US20140011259A1/en
Priority to US14/514,652 priority patent/US20150037872A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/52Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea
    • C12N9/54Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea bacteria being Bacillus
    • AHUMAN NECESSITIES
    • A21BAKING; EDIBLE DOUGHS
    • A21DTREATMENT OF FLOUR OR DOUGH FOR BAKING, e.g. BY ADDITION OF MATERIALS; BAKING; BAKERY PRODUCTS
    • A21D2/00Treatment of flour or dough by adding materials thereto before or during baking
    • A21D2/08Treatment of flour or dough by adding materials thereto before or during baking by adding organic substances
    • A21D2/24Organic nitrogen compounds
    • A21D2/26Proteins
    • A21D2/267Microbial proteins
    • AHUMAN NECESSITIES
    • A21BAKING; EDIBLE DOUGHS
    • A21DTREATMENT OF FLOUR OR DOUGH FOR BAKING, e.g. BY ADDITION OF MATERIALS; BAKING; BAKERY PRODUCTS
    • A21D8/00Methods for preparing or baking dough
    • A21D8/02Methods for preparing dough; Treating dough prior to baking
    • A21D8/04Methods for preparing dough; Treating dough prior to baking treating dough with microorganisms or enzymes
    • A21D8/042Methods for preparing dough; Treating dough prior to baking treating dough with microorganisms or enzymes with enzymes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/04General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length on carriers
    • C07K1/047Simultaneous synthesis of different peptide species; Peptide libraries
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/42Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • C07K16/4283Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an allotypic or isotypic determinant on Ig
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1002Tetrapeptides with the first amino acid being neutral
    • C07K5/1005Tetrapeptides with the first amino acid being neutral and aliphatic
    • C07K5/1008Tetrapeptides with the first amino acid being neutral and aliphatic the side chain containing 0 or 1 carbon atoms, i.e. Gly, Ala
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1002Tetrapeptides with the first amino acid being neutral
    • C07K5/1005Tetrapeptides with the first amino acid being neutral and aliphatic
    • C07K5/101Tetrapeptides with the first amino acid being neutral and aliphatic the side chain containing 2 to 4 carbon atoms, e.g. Val, Ile, Leu
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1002Tetrapeptides with the first amino acid being neutral
    • C07K5/1005Tetrapeptides with the first amino acid being neutral and aliphatic
    • C07K5/1013Tetrapeptides with the first amino acid being neutral and aliphatic the side chain containing O or S as heteroatoms, e.g. Cys, Ser
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1019Tetrapeptides with the first amino acid being basic
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1021Tetrapeptides with the first amino acid being acidic
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38627Preparations containing enzymes, e.g. protease or amylase containing lipase
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38645Preparations containing enzymes, e.g. protease or amylase containing cellulase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • C12N9/0055Oxidoreductases (1.) acting on diphenols and related substances as donors (1.10)
    • C12N9/0057Oxidoreductases (1.) acting on diphenols and related substances as donors (1.10) with oxygen as acceptor (1.10.3)
    • C12N9/0061Laccase (1.10.3.2)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/18Carboxylic ester hydrolases (3.1.1)
    • C12N9/20Triglyceride splitting, e.g. by means of lipase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y110/00Oxidoreductases acting on diphenols and related substances as donors (1.10)
    • C12Y110/03Oxidoreductases acting on diphenols and related substances as donors (1.10) with an oxygen as acceptor (1.10.3)
    • C12Y110/03002Laccase (1.10.3.2)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y304/00Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/21Serine endopeptidases (3.4.21)
    • C12Y304/21062Subtilisin (3.4.21.62)
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10TECHNICAL SUBJECTS COVERED BY FORMER USPC
    • Y10STECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10S435/00Chemistry: molecular biology and microbiology
    • Y10S435/8215Microorganisms
    • Y10S435/911Microorganisms using fungi

Definitions

  • the present invention relates to a method of selecting a protein variant having modified immunogenicity as compared to the parent protein, to the protein variant and use thereof, as well as to a method for producing said protein variant.
  • proteins including enzymes
  • the sensitisation phase involves a first exposure of an individual to an allergen. This event activates specific T- and B-lymphocytes, and leads to the production of allergen specific IgE antibodies (in the present context the antibodies are denoted as usual, i.e. immunoglobulin E is IgE etc.). These IgE antibodies eventually facilitate allergen capturing and presentation to T-lymphocytes at the onset of the symptomatic phase. This phase is initiated by a second exposure to the same or a resembling antigen.
  • the specific IgE antibodies bind to the specific IgE receptors on mast cells and basophils, among others, and capture at the same time the allergen.
  • the polyclonal nature of this process results in bridging and clustering of the IgE receptors, and subsequently in the activation of mast cells and basophils. This activation triggers the release of various chemical mediators involved in the early as well as late phase reactions of the symptomatic phase of allergy. Prevention of allergy in susceptible individuals is therefore a research area of great importance.
  • allergen vaccines Int. Arch. Allergy Immunol., 1999, vol. 119, pp1-5. This leads to reduction of the allergic symptoms, possibly due to a redirection of the immune response away from the allergic (Th2) pathway and towards the immunoprotective (Th1) pathway (Int. Arch. Allergy Immunol., 1999, vol. 119, pp1-5).
  • Slootstra et al; Molecular Diversity, 2, pp. 156-164, 1996 disclose the screening of a semi-random library of synthetic peptides for their binding properties to three monoclonal antibodies by immobilizing the peptides on polyethylene pins and binding a dilution series of each antibody to the pins. This reference does not disclose any indication of how the antibody binding peptide sequences relate to any full protein antigens or allergens.
  • WO 92/10755 a method for modifying proteins to obtain less immunogenic variants is described. Randomly constructed protein variants, revealing a reduced binding of antibodies to the parent enzyme as compared to the parent enzyme itself, are selected for the measurement in animal models in terms of allergenicity. Finally, it is assessed whether reduction in immunogenicity is due to true elimination of an epitope or a reduction in affinity for antibodies.
  • This method targets the identification of amino acids that may be part of structural epitopes by using a complete protein for assessing antigen binding.
  • the major drawbacks of this approach are the ‘trial and error’ character, which makes it a lengthy and expensive process, and the lack of general information on the epitope patterns. Without this information, the results obtained for one protein can not be applied on another protein.
  • WO 99/47680 discloses the identification and modification of B-cell epitopes by protein engineering.
  • the method is based on crystal structures of Fab-antigen complexes, and B-cell epitopes are defined as “a section of the surface of the antigen comprising 15-25 amino acid residues, which are within a distance from the atoms of the antibody enabling direct interaction” (p.3).
  • This publication does not show how one selects which Fab fragment to use (e.g. to target the most dominant allergy epitopes) or how one selects the substitutions to be made.
  • their method cannot be used in the absence of such crystallographic data for antigen-antibody complexes, which are very cumbersome, sometimes impossible, to obtain—especially since one would need a separate crystal structure for each epitope to be changed.
  • the present invention relates to a method of selecting a protein variant having modified immunogenicity as compared to a parent protein, comprising the steps of:
  • a second aspect of the present invention is a protein variant having modified immunogenicity as compared to its parent protein.
  • the amino acid sequence of the protein variant differs from the amino acid sequence of the parent protein with respect to at least one epitope pattern of the parent protein, such that the immunogenicity of the protein variant is modified as compared with the immunogenicity of the parent protein.
  • a further aspect of the present invention is a composition
  • a composition comprising a protein variant as defined above, as well as the use of the composition for industrial application, such as the production of a formulation for personal care products (for example shampoo; soap; skin, hand and face lotions; skin, hand and face cremes; hair dyes; toothpaste), food (for example in the baking industry), detergents and for the production of pharmaceuticals, e.g. vaccines.
  • a formulation for personal care products for example shampoo; soap; skin, hand and face lotions; skin, hand and face cremes; hair dyes; toothpaste
  • food for example in the baking industry
  • detergents for the production of pharmaceuticals, e.g. vaccines.
  • Yet another aspect is a DNA molecule encoding a protein variant as defined above.
  • vector comprising a DNA molecule as described above as well a host cell comprising said DNA molecule.
  • Another aspect is a method of producing a protein variant having modified immunogenicity as compared to the parent protein as defined above.
  • the term “isolated” indicates that the protein is found in a condition other than its native environment, such as apart from blood and animal tissue. In a preferred form, the isolated protein is substantially free of other proteins, particularly other proteins of animal origin. It is preferred to provide the proteins in a highly purified form, i.e., greater than 95% pure, more preferably greater than 99% pure.
  • the term “isolated” indicates that the molecule is removed from its natural genetic milieu, and is thus free of other extraneous or unwanted coding sequences, and is in a form suitable for use within genetically engineered protein production systems. Such isolated molecules are those that are separated from their natural environment and include cDNA and genomic clones.
  • Isolated DNA molecules of the present invention are free of other genes with which they are ordinarily associated, and may include naturally occurring 5′ and 3′ untranslated regions such as promoters and terminators. The identification of associated regions will be evident to one of ordinary skill in the art (see for example, Dynan and Tijan, Nature 316: 774-78, 1985).
  • polynucleotide is a single- or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5′ to the 3′ end.
  • Polynucleotides include RNA and DNA, and may be isolated from natural sources, synthesized in vitro, or prepared from a combination of natural and synthetic molecules.
  • nucleic acid molecule refers to the phosphate ester polymeric form of ribonucleosides (adenosine, guanosine, uridine or cytidine; “RNA molecules”) or deoxyribonucleosides (deoxyadenosine, deoxyguanosine, deoxythymidine, or deoxycytidine; “DNA molecules”) in either single stranded form, or a double-stranded helix. Double stranded DNA-DNA, DNA-RNA and RNA-RNA helices are possible.
  • nucleic acid molecule refers only to the primary and secondary structure of the molecule, and does not limit it to any particular tertiary or quaternary forms.
  • this term includes double-stranded DNA found, inter alia, in linear or circular DNA molecules (e.g., restriction fragments), plasmids, and chromosomes.
  • sequences may be described herein according to the normal convention of giving only the sequence in the 5′ to 3′ direction along the nontranscribed strand of DNA (i.e., the strand having a sequence homologous to the mRNA).
  • a “recombinant DNA molecule” is a DNA molecule that has undergone a molecular biological manipulation.
  • a DNA “coding sequence” is a double-stranded DNA sequence, which is transcribed and translated into a polypeptide in a cell in vitro or in vivo when placed under the control of appropriate regulatory sequences. The boundaries of the coding sequence are determined by a start codon at the 5′ (amino) terminus and a translation stop codon at the 3′ (carboxyl) terminus.
  • a coding sequence can include, but is not limited to, prokaryotic sequences, cDNA from eukaryotic mRNA, genomic DNA sequences from eukaryotic (e.g., mammalian) DNA, and even synthetic DNA sequences. If the coding sequence is intended for expression in a eukaryotic cell, a polyadenylation signal and transcription termination sequence will usually be located 3′ to the coding sequence.
  • An “Expression vector” is a DNA molecule, linear or circular, that comprises a segment encoding a polypeptide of interest operably linked to additional segments that provide for its transcription. Such additional segments may include promoter and terminator sequences, and optionally one or more origins of replication, one or more selectable markers, an enhancer, a polyadenylation signal, and the like. Expression vectors are generally derived from plasmid or viral DNA, or may contain elements of both.
  • Transcriptional and translational control sequences are DNA regulatory sequences, such as promoters, enhancers, terminators, and the like, that provide for the expression of a coding sequence in a host cell.
  • polyadenylation signals are control sequences.
  • a “secretory signal sequence” is a DNA sequence that encodes a polypeptide (a “secretory peptide” that, as a component of a larger polypeptide, directs the larger polypeptide through a secretory pathway of a cell in which it is synthesized.
  • the larger polypeptide is commonly cleaved to remove the secretory peptide during transit through the secretory pathway.
  • promoter is used herein for its art-recognized meaning to denote a portion of a gene containing DNA sequences that provide for the binding of RNA polymerase and initiation of transcription. Promoter sequences are commonly, but not always, found in the 5′ non-coding regions of genes.
  • “Operably linked”, when referring to DNA segments, indicates that the segments are arranged so that they function in concert for their intended purposes, e.g. transcription initiates in the promoter and proceeds through the coding segment to the terminator.
  • a coding sequence is “under the control” of transcriptional and translational control sequences in a cell when RNA polymerase transcribes the coding sequence into mRNA, which is then trans-RNA spliced and translated into the protein encoded by the coding sequence.
  • isolated polypeptide is a polypeptide which is essentially free of other non-[enzyme] polypeptides, e.g., at least about 20% pure, preferably at least about 40% pure, more preferably about 60% pure, even more preferably about 80% pure, most preferably about 90% pure, and even most preferably about 95% pure, as determined by SDS-PAGE.
  • Heterologous DNA refers to DNA not naturally located in the cell, or in a chromosomal site of the cell.
  • the heterologous DNA includes a gene foreign to the cell.
  • a cell has been “transfected” by exogenous or heterologous DNA when such DNA has been introduced inside the cell.
  • a cell has been “transformed” by exogenous or heterologous DNA when the transfected DNA effects a phenotypic change.
  • the transforming DNA should be integrated (covalently linked) into chromosomal DNA making up the genome of the cell.
  • a “clone” is a population of cells derived from a single cell or common ancestor by mitosis.
  • “Homologous recombination” refers to the insertion of a foreign DNA sequence of a vector in a chromosome.
  • the vector targets a specific chromosomal site for homologous recombination.
  • the vector will contain sufficiently long regions of homology to sequences of the chromosome to allow complementary binding and incorporation of the vector into the chromosome. Longer regions of homology, and greater degrees of sequence similarity, may increase the efficiency of homologous recombination.
  • the techniques used to isolate or clone a nucleic acid sequence encoding a polypeptide include isolation from genomic DNA, preparation from cDNA, or a combination thereof.
  • the cloning of the nucleic acid sequences of the present invention from such genomic DNA can be effected, e.g., by using the well known polymerase chain reaction (PCR) or antibody screening of expression libraries to detect cloned DNA fragments with shared structural features. See, e.g., Innis et al., 1990, A Guide to Methods and Application, Academic Press, New York.
  • nucleic acid amplification procedures such as ligase chain reaction (LCR), ligated activated transcription (LAT) and nucleic acid sequence-based amplification (NASBA) may be used.
  • LCR ligase chain reaction
  • LAT ligated activated transcription
  • NASBA nucleic acid sequence-based amplification
  • the nucleic acid sequence may be cloned from a strain producing the polypeptide, or from another related organism and thus, for example, may be an allelic or species variant of the polypeptide encoding region of the nucleic acid sequence.
  • isolated nucleic acid sequence refers to a nucleic acid sequence which is essentially free of other nucleic acid sequences, e.g., at least about 20% pure, preferably at least about 40% pure, more preferably about 60% pure, even more preferably about 80% pure, most preferably about 90% pure, and even most preferably about 95% pure, as determined by agarose gel electorphoresis.
  • an isolated nucleic acid sequence can be obtained by standard cloning procedures used in genetic engineering to relocate the nucleic acid sequence from its natural location to a different site where it will be reproduced.
  • the cloning procedures may involve excision and isolation of a desired nucleic acid fragment comprising the nucleic acid sequence encoding the polypeptide, insertion of the fragment into a vector molecule, and incorporation of the recombinant vector into a host cell where multiple copies or clones of the nucleic acid sequence will be replicated.
  • the nucleic acid sequence may be of genomic, cDNA, RNA, semisynthetic, synthetic origin, or any combinations thereof.
  • nucleic acid construct is intended to indicate any nucleic acid molecule of cDNA, genomic DNA, synthetic DNA or RNA origin.
  • construct is intended to indicate a nucleic acid segment which may be single- or double-stranded, and which may be based on a complete or partial naturally occurring nucleotide sequence encoding a polypeptide of interest.
  • the construct may optionally contain other nucleic acid segments.
  • the DNA of interest may suitably be of genomic or cDNA origin, for instance obtained by preparing a genomic or cDNA library and screening for DNA sequences coding for all or part of the polypeptide by hybridization using synthetic oligonucleotide probes in accordance with standard techniques (cf. Sambrook et al., supra).
  • the nucleic acid construct may also be prepared synthetically by established standard methods, e.g. the phosphoamidite method described by Beaucage and Caruthers, Tetrahedron Letters 22 (1981), 1859-1869, or the method described by Matthes et al., EMBO Journal 3 (1984), 801-805.
  • phosphoamidite method oligonucleotides are synthesized, e.g. in an automatic DNA synthesizer, purified, annealed, ligated and cloned in suitable vectors.
  • nucleic acid construct may be of mixed synthetic and genomic, mixed synthetic and cDNA or mixed genomic and cDNA origin prepared by ligating fragments of synthetic, genomic or cDNA origin (as appropriate), the fragments corresponding to various parts of the entire nucleic acid construct, in accordance with standard techniques.
  • the nucleic acid construct may also be prepared by polymerase chain reaction using specific primers, for instance as described in U.S. Pat. No. 4,683,202 or Saiki et al., Science 239 (1988), 487-491.
  • nucleic acid construct may be synonymous with the term expression cassette when the nucleic acid construct contains all the control sequences required for expression of a coding sequence of the present invention.
  • coding sequence as defined herein is a sequence which is transcribed into mRNA and translated into a polypeptide of the present invention when placed under the control of the above mentioned control sequences. The boundaries of the coding sequence are generally determined by a translation start codon ATG at the 5′-terminus and a translation stop codon at the 3′-terminus.
  • a coding sequence can include, but is not limited to, DNA, cDNA, and recombinant nucleic acid sequences.
  • control sequences is defined herein to include all components which are necessary or advantageous for expression of the coding sequence of the nucleic acid sequence.
  • Each control sequence may be native or foreign to the nucleic acid sequence encoding the polypeptide.
  • control sequences include, but are not limited to, a leader, a polyadenylation sequence, a propeptide sequence, a promoter, a signal sequence, and a transcription terminator.
  • the control sequences include a promoter, and transcriptional and translational stop signals.
  • the control sequences may be provided with linkers for the purpose of introducing specific restriction sites facilitating ligation of the control sequences with the coding region of the nucleic acid sequence encoding a polypeptide.
  • the control sequence may be an appropriate promoter sequence, a nucleic acid sequence which is recognized by a host cell for expression of the nucleic acid sequence.
  • the promoter sequence contains transcription and translation control sequences which mediate the expression of the polypeptide.
  • the promoter may be any nucleic acid sequence which shows transcriptional activity in the host cell of choice and may be obtained from genes encoding extracellular or intracellular polypeptides either homologous or heterologous to the host cell.
  • the control sequence may also be a suitable transcription terminator sequence, a sequence recognized by a host cell to terminate transcription.
  • the terminator sequence is operably linked to the 3′ terminus of the nucleic acid sequence encoding the polypeptide. Any terminator which is functional in the host cell of choice may be used in the present invention.
  • the control sequence may also be a polyadenylation sequence, a sequence which is operably linked to the 3′ terminus of the nucleic acid sequence and which, when transcribed, is recognized by the host cell as a signal to add polyadenosine residues to transcribed mRNA. Any polyadenylation sequence which is functional in the host cell of choice may be used in the present invention.
  • the control sequence may also be a signal peptide coding region, which codes for an amino acid sequence linked to the amino terminus of the polypeptide which can direct the expressed polypeptide into the cell's secretory pathway of the host cell.
  • the 5′ end of the coding sequence of the nucleic acid sequence may inherently contain a signal peptide coding region naturally linked in translation reading frame with the segment of the coding region which encodes the secreted polypeptide.
  • the 5′ end of the coding sequence may contain a signal peptide coding region which is foreign to that portion of the coding sequence which encodes the secreted polypeptide.
  • a foreign signal peptide coding region may be required where the coding sequence does not normally contain a signal peptide coding region.
  • the foreign signal peptide coding region may simply replace the natural signal peptide coding region in order to obtain enhanced secretion relative to the natural signal peptide coding region normally associated with the coding sequence.
  • the signal peptide coding region may be obtained from a glucoamylase or an amylase gene from an Aspergillus species, a lipase or proteinase gene from a Rhizomucor species, the gene for the alpha-factor from Saccharomyces cerevisiae, an amylase or a protease gene from a Bacillus species, or the calf preprochymosin gene.
  • any signal peptide coding region capable of directing the expressed polypeptide into the secretory pathway of a host cell of choice may be used in the present invention.
  • the control sequence may also be a propeptide coding region, which codes for an amino acid sequence positioned at the amino terminus of a polypeptide.
  • the resultant polypeptide is known as a proenzyme or propolypeptide (or a zymogen in some cases).
  • a propolypeptide is generally inactive and can be converted to mature active polypeptide by catalytic or autocatalytic cleavage of the propeptide from the propolypeptide.
  • the propeptide coding region may be obtained from the Bacillus subtilis alkaline protease gene (aprE), the Bacillus subtilis neutral protease gene (nprT), the Saccharomyces cerevisiae alpha-factor gene, or the Myceliophthora thermophilum laccase gene (WO 95/33836).
  • the nucleic acid constructs of the present invention may also comprise one or more nucleic acid sequences which encode one or more factors that are advantageous in the expression of the polypeptide, e.g., an activator (e.g., a trans-acting factor), a chaperone, and a processing protease. Any factor that is functional in the host cell of choice may be used in the present invention.
  • an activator e.g., a trans-acting factor
  • a chaperone e.g., a chaperone
  • processing protease e.g., a factor that is functional in the host cell of choice.
  • the nucleic acids encoding one or more of these factors are not necessarily in tandem with the nucleic acid sequence encoding the polypeptide.
  • An activator is a protein which activates transcription of a nucleic acid sequence encoding a polypeptide (Kudla et al., 1990, EMBO Journal 9:1355-1364; Jarai and Buxton, 1994, Current Genetics 26:2238-244; Verdier, 1990, Yeast 6:271-297).
  • the nucleic acid sequence encoding an activator may be obtained from the genes encoding Bacillus stearothermophilus NprA (nprA), Saccharomyces cerevisiae heme activator protein 1 (hap1), Saccharomyces cerevisiae galactose metabolizing protein 4 (gal4), and Aspergillus nidulans ammonia regulation protein (areA).
  • nprA Bacillus stearothermophilus NprA
  • hap1 Saccharomyces cerevisiae heme activator protein 1
  • gal4 Saccharomyces cerevisiae galactos
  • a chaperone is a protein which assists another polypeptide in folding properly (Harti et al., 1994, TIBS 19:20-25; Bergeron et al., 1994, TIBS 19:124-128; Demolder et al., 1994, Journal of Biotechnology 32:179-189; Craig, 1993, Science 260:1902-1903; Gething and Sambrook, 1992, Nature 355:33-45; Puig and Gilbert, 1994, Journal of Biological Chemistry 269:7764-7771; Wang and Tsou, 1993, The FASEB Journal 7:1515-11157; Robinson et al., 1994, Bio/Technology 1:381-384).
  • the nucleic acid sequence encoding a chaperone may be obtained from the genes encoding Bacillus subtilis GroE proteins, Aspergillus oryzae protein disulphide isomerase, Saccharomyces cerevisiae calnexin, Saccharomyces cerevisiae BiP/GRP78, and Saccharomyces cerevisiae Hsp7O. For further examples, see Gething and Sambrook, 1992, supra, and Hartl et al., 1994, supra.
  • a processing protease is a protease that cleaves a propeptide to generate a mature biochemically active polypeptide (Enderlin and Ogrydziak, 1994, Yeast 10:67-79; Fuller et al., 1989, Proceedings of the National Academy of Sciences USA 86:1434-1438; Julius et al., 1984, Cell 37:1075-1089; Julius et al., 1983, Cell 32:839-852).
  • the nucleic acid sequence encoding a processing protease may be obtained from the genes encoding Aspergillus niger Kex2, Saccharomyces cerevisiae dipeptidylaminopeptidase, Saccharomyces cerevisiae Kex2, and Yarrowia lipolytica dibasic processing endoprotease (xpr6).
  • regulatory sequences which allow the regulation of the expression of the polypeptide relative to the growth of the host cell.
  • regulatory systems are those which cause the expression of the gene to be turned on or off in response to a chemical or physical stimulus, including the presence of a regulatory compound.
  • Regulatory systems in prokaryotic systems would include the lac, tac, and trp operator systems.
  • yeast the ADH2 system or GAL1 system may be used.
  • filamentous fungi the TAKA alpha-amylase promoter, Aspergillus niger glucoamylase promoter, and the Aspergillus olyzae glucoamylase promoter may be used as regulatory sequences.
  • Other examples of regulatory sequences are those which allow for gene amplification.
  • these include the dihydrofolate reductase gene which is amplified in the presence of methotrexate, and the metallothionein genes which are amplified with heavy metals.
  • the nucleic acid sequence encoding the polypeptide would be placed in tandem with the regulatory sequence.
  • Suitable promoters for directing the transcription of the nucleic acid constructs of the present invention are the promoters obtained from the E. coli lac operon, the Streptomyces coelicolor agarase gene (dagA), the Bacillus subtilis levansucrase gene (sacB), the Bacillus subtilis alkaline protease gene, the Bacillus licheniformis alpha-amylase gene (amyL), the Bacillus stearothermophilus maltogenic amylase gene (amyM), the Bacillus amyloliquefaciens alpha-amylase gene (amyQ), the Bacillus amyloliquefaciens BAN amylase gene, the Bacillus licheniformis penicillinase gene (penP), the Bacillus subtilis xylA and xylB genes, and the prokaryotic beta-lactamase gene (Villa-Kamaroff
  • promoters for directing the transcription of the nucleic acid constructs of the present invention in a filamentous fungal host cell are promoters obtained from the genes encoding Aspergillus oryzae TAKA amylase, Rhizomucor miehei aspartic proteinase, Aspergillus niger neutral alpha-amylase, Aspergillus niger acid stable alpha-amylase, Aspergillus niger or Aspergillus awamori glucoamylase (glaA), Rhizomucor miehei lipase, Aspergillus oryzae alkaline protease, Aspergillus oryzae triose phosphate isomerase, Aspergillus nidulans acetamidase, Fusarium oxysporum trypsin-like protease (as described in U.S.
  • promoters for use in filamentous fungal host cells are the TAKA amylase, NA2-tpi (a hybrid of the promoters from the genes encoding Aspergillus niger neutral alpha-amylase and Aspergillus oryzae triose phosphate isomerase), and glaA promoters.
  • TAKA amylase a hybrid of the promoters from the genes encoding Aspergillus niger neutral alpha-amylase and Aspergillus oryzae triose phosphate isomerase
  • glaA promoters are the ADH3 promoter (McKnight et al., The EMBO J. 4 (1985), 2093-2099) or the tpiA promoter.
  • promoters for use in yeast host cells include promoters from yeast glycolytic genes (Hitzeman et al., J. Biol. Chem. 255 (1980), 12073-12080; Alber and Kawasaki, J. Mol. Appl. Gen. 1 (1982), 419-434) or alcohol dehydrogenase genes (Young et al., in Genetic Engineering of Microorganisms for Chemicals (Hollaender et al, eds.), Plenum Press, New York, 1982), or the TPI1 (U.S. Pat. No. 4,599,311) or ADH2-4c (Russell et al., Nature 304 1983), 652-654) promoters.
  • yeast host cells are described by Romanos et al., 1992, Yeast 8:423-488.
  • useful promoters include viral promoters such as those from Simian Virus 40 (SV40), Rous sarcoma virus (RSV), adenovirus, and bovine papilloma virus (BPV).
  • SV40 Simian Virus 40
  • RSV Rous sarcoma virus
  • BPV bovine papilloma virus
  • Suitable promoters for directing the transcription of the DNA encoding the polypeptide of the invention in mammalian cells are the SV40 promoter (Subramani et al., Mol. Cell Biol. 1 (1981), 854-864), the MT-1 (metallothionein gene) promoter (Palmiter et al., Science 222 (1983), 809-814) or the adenovirus 2 major late promoter.
  • a suitable promoter for use in insect cells is the polyhedrin promoter (U.S. Pat. No. 4,745,051; Vasuvedan et al., FEBS Lett. 311, (1992) 7-11), the P10 promoter (J. M. VIak et al., J. Gen. Virology 69, 1988, pp. 765-776), the Autographa californica polyhedrosis virus basic protein promoter (EP 397 485), the baculovirus immediate early gene 1 promoter (U.S. Pat. No. 5,155,037; U.S. Pat No. 5,162,222), or the baculovirus 39K delayed-early gene promoter (U.S. Pat. No. 5,155,037; U.S. Pat. No. 5,162,222).
  • Preferred terminators for filamentous fungal host cells are obtained from the genes encoding Aspergillus oryzae TAKA amylase, Aspergillus niger glucoamylase, Aspergillus nidulans anthranilate synthase, Aspergillus niger alpha-glucosidase, and Fusarium oxysporum trypsin-like protease. for fungal hosts) the TPI1 (Alber and Kawasaki, op. cit.) or ADH3 (McKnight et al., op. cit.) terminators.
  • TPI1 Alber and Kawasaki, op. cit.
  • ADH3 McKnight et al., op. cit.
  • Preferred terminators for yeast host cells are obtained from the genes encoding Saccharomyces cerevisiae enolase, Saccharomyces cerevisiae cytochrome C (CYC1), or Saccharomyces cerevisiae glyceraldehyde-3-phosphate dehydrogenase.
  • Other useful terminators for yeast host cells are described by Romanos et al., 1992, supra.
  • Preferred polyadenylation sequences for filamentous fungal host cells are obtained from the genes encoding Aspergillus oryzae TAKA amylase, Aspergillus niger glucoamylase, Aspergillus nidulans anthranilate synthase, and Aspergillus niger alpha-glucosidase.
  • Polyadenylation sequences are well known in the art for mammalian host cells such as SV40 or the adenovirus 5 Elb region.
  • An effective signal peptide coding region for bacterial host cells is the signal peptide coding region obtained from the maltogenic amylase gene from Bacillus NCIB 11837, the Bacillus stearothermophilus alpha-amylase gene, the Bacillus licheniformis subtilisin gene, the Bacillus licheniformis beta-lactamase gene, the Bacillus stearothermophilus neutral proteases genes (nprT, nprS, nprM), and the Bacillus subtilis PrsA gene. Further signal peptides are described by Simonen and Palva, 1993, Microbiological Reviews 57:109-137.
  • An effective signal peptide coding region for filamentous fungal host cells is the signal peptide coding region obtained from Aspergillus oryzae TAKA amylase gene, Aspergillus niger neutral amylase gene, the Rhizomucor miehei aspartic proteinase gene, the Humicola lanuginosa cellulase or lipase gene, or the Rhizomucor miehei lipase or protease gene, Aspergillus sp. amylase or glucoamylase, a gene encoding a Rhizomucor miehei lipase or protease.
  • the signal peptide is preferably derived from a gene encoding A. oryzae TAKA amylase, A. niger neutral alpha-amylase, A. niger acid-stable amylase, or A. niger glucoamylase.
  • Useful signal peptides for yeast host cells are obtained from the genes for Saccharomyces cerevisiae alpha-factor and Saccharomyces cerevisiae invertase. Other useful signal peptide coding regions are described by Romanos et al., 1992, supra.
  • the secretory signal sequence may encode any signal peptide which ensures efficient direction of the expressed polypeptide into the secretory pathway of the cell.
  • the signal peptide may be naturally occurring signal peptide, or a functional part thereof, or it may be a synthetic peptide. Suitable signal peptides have been found to be the a-factor signal peptide (cf. U.S. Pat. No. 4,870,008), the signal peptide of mouse salivary amylase (cf. O Hagenbuchle et al., Nature 289, 1981, pp. 643-646), a modified carboxypeptidase signal peptide (cf. L. A. Valls et al., Cell 48, 1987, pp.
  • yeast BAR1 signal peptide cf. WO 87/02670
  • yeast aspartic protease 3 YAP3
  • a sequence encoding a leader peptide may also be inserted downstream of the signal sequence and uptream of the DNA sequence encoding the polypeptide.
  • the function of the leader peptide is to allow the expressed polypeptide to be directed from the endoplasmic reticulum to the Golgi apparatus and further to a secretory vesicle for secretion into the culture medium (i.e. exportation of the polypeptide across the cell wall or at least through the cellular membrane into the periplasmic space of the yeast cell).
  • the leader peptide may be the yeast a-factor leader (the use of which is described in e.g. U.S. Pat. No.
  • the leader peptide may be a synthetic leader peptide, which is to say a leader peptide not found in nature. Synthetic leader peptides may, for instance, be constructed as described in WO 89/02463 or WO 92/11378.
  • the signal peptide may conveniently be derived from an insect gene (cf. WO 90/05783), such as the lepidopteran Manduca sexta adipokinetic hormone precursor signal peptide (cf. U.S. Pat. No. 5,023,328).
  • the present invention also relates to recombinant expression vectors comprising a nucleic acid sequence of the present invention, a promoter, and transcriptional and translational stop signals.
  • the various nucleic acid and control sequences described above may be joined together to produce a recombinant expression vector which may include one or more convenient restriction sites to allow for insertion or substitution of the nucleic acid sequence encoding the polypeptide at such sites.
  • the nucleic acid sequence of the present invention may be expressed by inserting the nucleic acid sequence or a nucleic acid construct comprising the sequence into an appropriate vector for expression.
  • the coding sequence is located in the vector so that the coding sequence is operably linked with the appropriate control sequences for expression, and possibly secretion.
  • the recombinant expression vector may be any vector (e.g., a plasmid or virus) which can be conveniently subjected to recombinant DNA procedures and can bring about the expression of the nucleic acid sequence.
  • the choice of the vector will typically depend on the compatibility of the vector with the host cell into which the vector is to be introduced.
  • the vectors may be linear or closed circular plasmids.
  • the vector may be an autonomously replicating vector, i.e., a vector which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid, an extrachromosomal element, a minichromosome, or an artificial chromosome.
  • the vector may contain any means for assuring self-replication.
  • the vector may be one which, when introduced into the host cell, is integrated into the genome and replicated together with the chromosome(s) into which it has been integrated.
  • the vector system may be a single vector or plasmid or two or more vectors or plasmids which together contain the total DNA to be introduced into the genome of the host cell, or a transposon.
  • the vectors of the present invention preferably contain one or more selectable markers which permit easy selection of transformed cells.
  • a selectable marker is a gene the product of which provides for biocide or viral resistance, resistance to heavy metals, prototrophy to auxotrophs, and the like.
  • Examples of bacterial selectable markers are the dal genes from Bacillus subtilis or Bacillus licheniformis, or markers which confer antibiotic resistance such as ampicillin, kanamycin, chloramphenicol, tetracycline, neomycin, hygromycin or methotrexate resistance.
  • a frequently used mammalian marker is the dihydrofolate reductase gene (DHFR).
  • Suitable markers for yeast host cells are ADE2, HIS3, LEU2, LYS2, MET3, TRP1, and URA3.
  • a selectable marker for use in a filamentous fungal host cell may be selected from the group including, but not limited to, amdS (acetamidase), argB (ornithine carbamoyltransferase), bar (phosphinothricin acetyltransferase), hygB (hygromycin phosphotransferase), niaD (nitrate reductase), pyrG (orotidine-5′-phosphate decarboxylase), sC (sulfate adenyltransferase), trpC (anthranilate synthase), and glufosinate resistance markers, as well as equivalents from other species.
  • amdS and pyrG markers of Aspergillus nidulans or Aspergillus oryzae and the bar marker of Streptomyces hygroscopicus.
  • selection may be accomplished by co-transformation, e.g., as described in WO 91/17243, where the selectable marker is on a separate vector.
  • the vectors of the present invention preferably contain an element(s) that permits stable integration of the vector into the host cell genome or autonomous replication of the vector in the cell independent of the genome of the cell.
  • the vectors of the present invention may be integrated into the host cell genome when introduced into a host cell.
  • the vector may rely on the nucleic acid sequence encoding the polypeptide or any other element of the vector for stable integration of the vector into the genome by homologous or nonhomologous recombination.
  • the vector may contain additional nucleic acid sequences for directing integration by homologous recombination into the genome of the host cell. The additional nucleic acid sequences enable the vector to be integrated into the host cell genome at a precise location(s) in the chromosome(s).
  • the integrational elements should preferably contain a sufficient number of nucleic acids, such as 100 to 1,500 base pairs, preferably 400 to 1,500 base pairs, and most preferably 800 to 1,500 base pairs, which are highly homologous with the corresponding target sequence to enhance the probability of homologous recombination.
  • the integrational elements may be any sequence that is homologous with the target sequence in the genome of the host cell.
  • the integrational elements may be non-encoding or encoding nucleic acid sequences.
  • the vector may be integrated into the genome of the host cell by non-homologous recombination.
  • These nucleic acid sequences may be any sequence that is homologous with a target sequence in the genome of the host cell, and, furthermore, may be non-encoding or encoding sequences.
  • the vector may further comprise an origin of replication enabling the vector to replicate autonomously in the host cell in question.
  • origins of replication are the origins of replication of plasmids pBR322, pUC19, pACYC177, pACYC184, pUB110, pE194, pTA1060, and pAM ⁇ 1.
  • origin of replications for use in a yeast host cell are the 2 micron origin of replication, the combination of CEN6 and ARS4, and the combination of CEN3 and ARS1.
  • the origin of replication may be one having a mutation which makes its functioning temperature-sensitive in the host cell (see, e.g., Ehrlich, 1978, Proceedings of the National Academy of Sciences USA 75:1433).
  • More than one copy of a nucleic acid sequence encoding a polypeptide of the present invention may be inserted into the host cell to amplify expression of the nucleic acid sequence.
  • Stable amplification of the nucleic acid sequence can be obtained by integrating at least one additional copy of the sequence into the host cell genome using methods well known in the art and selecting for transformants.
  • the present invention also relates to recombinant host cells, comprising a nucleic acid sequence of the invention, which are advantageously used in the recombinant production of the polypeptides.
  • host cell encompasses any progeny of a parent cell which is not identical to the parent cell due to mutations that occur during replication.
  • the cell is preferably transformed with a vector comprising a nucleic acid sequence of the invention followed by integration of the vector into the host chromosome.
  • Transformation means introducing a vector comprising a nucleic acid sequence of the present invention into a host cell so that the vector is maintained as a chromosomal integrant or as a self-replicating extra-chromosomal vector. Integration is generally considered to be an advantage as the nucleic acid sequence is more likely to be stably maintained in the cell. Integration of the vector into the host chromosome may occur by homologous or non-homologous recombination as described above.
  • the choice of a host cell will to a large extent depend upon the gene encoding the polypeptide and its source.
  • the host cell may be a unicellular microorganism, e.g., a prokaryote, or a non-unicellular microorganism, e.g., a eukaryote.
  • Useful unicellular cells are bacterial cells such as gram positive bacteria including, but not limited to, a Bacillus cell, e.g., Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus brevis, Bacillus circulans, Bacillus coagulans, Bacillus lautus, Bacillus lentus, Bacillus licheniformis, Bacillus megaterium, Bacillus stearothermophilus, Bacillus subtilis, and Bacillus thuringiensis; or a Streptomyces cell, e.g., Streptomyces lividans or Streptomyces murinus, or gram negative bacteria such as E.
  • a Bacillus cell e.g., Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus brevis, Bacillus circulans, Bacillus coagulans, Bacillus lautus, Bacillus lentus, Bacillus licheniformis
  • the bacterial host cell is a Bacillus lentus, Bacillus licheniformis, Bacillus stearothermophilus or Bacillus subtilis cell.
  • the transformation of a bacterial host cell may, for instance, be effected by protoplast transformation (see, e.g., Chang and Cohen, 1979, Molecular General Genetics 168:111-115), by using competent cells (see, e.g., Young and Spizizin, 1961, Journal of Bacteriology 81:823-829, or Dubnar and Davidoff-Abelson, 1971, Journal of Molecular Biology 56:209-221), by electroporation (see, e.g., Shigekawa and Dower, 1988, Biotechniques 6:742-751), or by conjugation (see, e.g., Koehler and Thorne, 1987, Journal of Bacteriology 169:5771-5278).
  • the host cell may be a eukaryote, such as a mammalian cell, an insect cell, a plant cell or a fungal cell.
  • Useful mammalian cells include Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, COS cells, or any number of other immortalized cell lines available, e.g., from the American Type Culture Collection.
  • suitable mammalian cell lines are the COS (ATCC CRL 1650 and 1651), BHK (ATCC CRL 1632, 10314 and 1573, ATCC CCL 10), CHL (ATCC CCL39) or CHO (ATCC CCL 61) cell lines.
  • Methods of transfecting mammalian cells and expressing DNA sequences introduced in the cells are described in e.g. Kaufman and Sharp, J. Mol. Biol. 159 (1982), 601-621; Southern and Berg, J. Mol. AppI. Genet. 1 (1982), 327-341; Loyter et al., Proc. Natl. Acad. Sci.
  • the host cell is a fungal cell.
  • “Fungi” as used herein includes the phyla Ascomycota, Basidiomycota, Chytridiomycota, and Zygomycota (as defined by Hawksworth et al., In, Ainsworth and Bisby's Dictionary of The Fungi, 8th edition, 1995, CAB International, University Press, Cambridge, UK) as well as the Oomycota (as cited in Hawksworth et al., 1995, supra, page 171) and all mitosporic fungi (Hawksworth et al., 1995, supra).
  • Basidiomycota include mushrooms, rusts, and smuts.
  • Representative groups of Chytridiomycota include, e.g., Allomyces, Blastocladiella, Coelomomyces, and aquatic fungi.
  • Representative groups of Oomycota include, e.g., Saprolegniomycetous aquatic fungi (water molds) such as Achlya. Examples of mitosporic fungi include Aspergillus, Penicillium, Candida, and Alternaria.
  • Representative groups of Zygomycota include, e.g., Rhizopus and Mucor.
  • the fungal host cell is a yeast cell.
  • yeast as used herein includes ascosporogenous yeast ( Endomycetales), basidiosporogenous yeast, and yeast belonging to the Fungi Imperfecti ( Blastomycetes ).
  • the ascosporogenous yeasts are divided into the families Spermophthoraceae and Saccharomycetaceae. The latter is comprised of four subfamilies, Schizosaccharomycoideae (e.g., genus Schizosaccharomyces), Nadsonioideae, Lipomycoideae, and Saccharomycoideae (e.g., genera Pichia, Kluyveromyces and Saccharomyces ).
  • Schizosaccharomycoideae e.g., genus Schizosaccharomyces
  • Nadsonioideae e.g., Lipomycoideae
  • Saccharomycoideae e.g., genera Pi
  • the basidiosporogenous yeasts include the genera Leucosporidim, Rhodosporidium, Sporidiobolus, Filobasidium, and Filobasidiella.
  • Yeast belonging to the Fungi Imperfecti are divided into two families, Sporobolomycetaceae (e.g., genera Sorobolomyces and Bullera ) and Cryptococcaceae (e.g., genus Candida ). Since the classification of yeast may change in the future, for the purposes of this invention, yeast shall be defined as described in Biology and Activities of Yeast (Skinner, F. A., Passmore, S. M., and Davenport, R. R., eds, Soc. App. Bacteriol. Symposium Series No. 9, 1980.
  • yeast and manipulation of yeast genetics are well known in the art (see, e.g., Biochemistry and Genetics of Yeast, Bacil, M., Horecker, B. J., and Stopani, A. O. M., editors, 2nd edition, 1987; The Yeasts, Rose, A. H., and Harrison, J. S., editors, 2nd edition, 1987; and The Molecular Biology of the Yeast Saccharomyces, Strathern et al., editors, 1981).
  • the yeast host cell may be selected from a cell of a species of Candida, Kluyveromyces, Saccharomyces, Schizosaccharomyces, Candida, Pichia, Hansenula, or Yarrowia.
  • the yeast host cell is a Saccharomyces carlsbergensis, Saccharomyces cerevisiae, Saccharomyces diastaticus, Saccharomyces douglasii, Saccharomyces kluyveri, Saccharomyces norbensis or Saccharomyces oviformis cell.
  • yeast host cells are a Kluyveromyces lactis, Kluyveromyces fragilis, Hansenula polymorpha, Pichia pastoris, Yarrowia lipolytica, Schizosaccharomyces pombe, Ustilgo maylis, Candida maltose, Pichia guillermondii and Pichia methanolio cell (cf. Gleeson et al., J. Gen. Microbiol. 132, 1986, pp. 3459-3465; U.S. Pat. No. 4,882,279 and U.S. Pat. No. 4,879,231).
  • the fungal host cell is a filamentous fungal cell.
  • “Filamentous fungi” include all filamentous forms of the subdivision Eumycota and Oomycota (as defined by Hawksworth et al., 1995, supra). The filamentous fungi are characterized by a vegetative mycelium composed of chitin, cellulose, glucan, chitosan, mannan, and other complex polysaccharides. Vegetative growth is by hyphal elongation and carbon catabolism is obligately aerobic. In contrast, vegetative growth by yeasts such as Saccharomyces cerevisiae is by budding of a unicellular thallus and carbon catabolism may be fermentative.
  • the filamentous fungal host cell is a cell of a species of, but not limited to, Acremonium, Aspergillus, Fusarium, Humicola, Mucor, Myceliophthora, Neurospora, Penicillium, Thielavia, Tolypocladium, and Trichoderma or a teleomorph or synonym thereof.
  • the filamentous fungal host cell is an Aspergillus cell.
  • the filamentous fungal host cell is an Acremonium cell.
  • the filamentous fungal host cell is a Fusarium cell.
  • the filamentous fungal host cell is a Humicola cell.
  • the filamentous fungal host cell is a Mucor cell. In another even more preferred embodiment, the filamentous fungal host cell is a Myceliophthora cell. In another even more preferred embodiment, the filamentous fungal host cell is a Neurospora cell. In another even more preferred embodiment, the filamentous fungal host cell is a Penicillium cell. In another even more preferred embodiment, the filamentous fungal host cell is a Thielavia cell. In another even more preferred embodiment, the filamentous fungal host cell is a Tolypocladium cell. In another even more preferred embodiment, the filamentous fungal host cell is a Trichoderma cell.
  • the filamentous fungal host cell is an Aspergillus awamori, Aspergillus foetidus, Aspergillus japonicus, Aspergillus niger, Aspergillus nidulans or Aspergillus oryzae cell.
  • the filamentous fungal host cell is a Fusarium cell of the section Discolor (also known as the section Fusarium ).
  • the filamentous fungal parent cell may be a Fusarium bactridioides, Fusarium cerealis, Fusarium crookwellense, Fusarium culmorum, Fusarium graminearum, Fusarium graminum, Fusarium heterosporum, Fusarium negundi, Fusarium reticulatum, Fusarium roseum, Fusarium sambucinum, Fusarium sarcochroum, Fusarium sulphureum, or Fusarium trichothecioides cell.
  • Fusarium bactridioides Fusarium cerealis, Fusarium crookwellense, Fusarium culmorum, Fusarium graminearum, Fusarium graminum, Fusarium heterosporum, Fusarium negundi, Fusarium reticulatum, Fusarium roseum, Fusarium sambucinum, Fusarium sarc
  • the filamentous fungal parent cell is a Fusarium strain of the section Elegans, e.g., Fusarium oxysporum.
  • the filamentous fungal host cell is a Humicola insolens or Humicola lanuginosa cell.
  • the filamentous fungal host cell is a Mucor miehei cell.
  • the filamentous fungal host cell is a Myceliophthora thermophilum cell.
  • the filamentous fungal host cell is a Neurospora crassa cell.
  • the filamentous fungal host cell is a Penicillium purpurogenum cell.
  • the filamentous fungal host cell is a Thielavia terrestris cell or an Acremonium chrysogenum cell.
  • the Trichoderma cell is a Trichoderma harzianum, Trichoderma koningii, Trichoderma longibrachiatum, Trichoderma reesei or Trichoderma viride cell.
  • Aspergillus spp. for the expression of proteins is described in, e.g., EP 272 277, EP 230 023.
  • Fungal cells may be transformed by a process involving protoplast formation, transformation of the protoplasts, and regeneration of the cell wall in a manner known per se. Suitable procedures for transformation of Aspergillus host cells are described in EP 238 023 25 and Yelton et al., 1984, Proceedings of the National Academy of Sciences USA 81:1470-1474. A suitable method of transforming Fusarium species is described by Malardier et al., 1989, Gene 78:147-156 or in copending U.S. Ser. No. 08/269,449. Examples of other fungal cells are cells of filamentous fungi, e.g. Aspergillus spp., Neurospora spp., Fusarium spp.
  • Trichoderma spp. in particular strains of A. oryzae, A. nidulans or A. niger.
  • the use of Aspergillus spp. for the expression of proteins is described in, e.g., EP 272 277, EP 230 023.
  • the transformation of F. oxysporum may, for instance, be carried out as described by Malardier et al., 1989, Gene 78: 147-156.
  • Yeast may be transformed using the procedures described by Becker and Guarente, In Abelson, J. N. and Simon, M. I., editors, Guide to Yeast Genetics and Molecular Biology, Methods in Enzymology, Volume 194, pp 182-187, Academic Press, Inc., New York; Ito et al., 1983, Journal of Bacteriology 153:163; and Hinnen et al., 1978, Proceedings of the National Academy of Sciences USA 75:1920. Mammalian cells may be transformed by direct uptake using the calcium phosphate precipitation method of Graham and Van der Eb (1978, Virology 52:546).
  • Transformation of insect cells and production of heterologous polypeptides therein may be performed as described in U.S. Pat. No. 4,745,051; U.S. Pat. No. 4,775,624; U.S. Pat. No. 4,879,236; U.S. Pat. No. 5,155,037; U.S. Pat. No. 5,162,222; EP 397,485) all of which are incorporated herein by reference.
  • the insect cell line used as the host may suitably be a Lepidoptera cell line, such as Spodoptera frugiperda cells or Trichoplusia ni cells (cf. U.S. Pat. No. 5,077,214).
  • Culture conditions may suitably be as described in, for instance, WO 89/01029 or WO 89/01028, or any of the aforementioned references.
  • the transformed or transfected host cells described above are cultured in a suitable nutrient medium under conditions permitting the production of the desired molecules, after which these are recovered from the cells, or the culture broth.
  • the medium used to culture the cells may be any conventional medium suitable for growing the host cells, such as minimal or complex media containing appropriate supplements. Suitable media are available from commercial suppliers or may be prepared according to published recipes (e.g. in catalogues of the American Type Culture Collection). The media are prepared using procedures known in the art (see, e.g., references for bacteria and yeast; Bennett, J. W. and LaSure, L., editors, More Gene Manipulations in Fungi, Academic Press, CA, 1991).
  • the molecules are secreted into the nutrient medium, they can be recovered directly from the medium. If they are not secreted, they can be recovered from cell lysates.
  • the molecules are recovered from the culture medium by conventional procedures including separating the host cells from the medium by centrifugation or filtration, precipitating the proteinaceous components of the supernatant or filtrate by means of a salt, e.g. ammonium sulphate, purification by a variety of chromatographic procedures, e.g. ion exchange chromatography, gelfiltration chromatography, affinity chromatography, or the like, dependent on the type of molecule in question.
  • a salt e.g. ammonium sulphate
  • the molecules of interest may be detected using methods known in the art that are specific for the molecules. These detection methods may include use of specific antibodies, formation of a product, or disappearance of a substrate. For example, an enzyme assay may be used to determine the activity of the molecule. Procedures for determining various kinds of activity are known in the art.
  • the molecules of the present invention may be purified by a variety of procedures known in the art including, but not limited to, chromatography (e.g., ion exchange, affinity, hydrophobic, chromatofocusing, and size exclusion), electrophoretic procedures (e.g., preparative isoelectric focusing (IEF), differential solubility (e.g., ammonium sulfate precipitation), or extraction (see, e.g., Protein Purification, J -C Janson and Lars Ryden, editors, VCH Publishers, New York, 1989).
  • chromatography e.g., ion exchange, affinity, hydrophobic, chromatofocusing, and size exclusion
  • electrophoretic procedures e.g., preparative isoelectric focusing (IEF), differential solubility (e.g., ammonium sulfate precipitation), or extraction
  • IEF isoelectric focusing
  • differential solubility e.g., ammonium sulfate precipitation
  • extraction see, e.g
  • immunological response is the response of an organism to a compound, which involves the immune system according to any of the four standard reactions (Type I, II, III and IV according to Coombs & Gell).
  • the “immunogenicity” of a compound used in connection with the present invention refers to the ability of this compound to induce an ‘immunological response’ in animals including man.
  • allergic response is the response of an organism to a compound, which involves IgE mediated responses (Type I reaction according to Coombs & Gell). It is to be understood that sensibilization (i.e. development of compound-specific IgE antibodies) upon exposure to the compound is included in the definition of “allergic response”.
  • the “allergenicity” of a compound used in connection with the present invention refers to the ability of this compound to induce an ‘allergic response’ in animals including man.
  • parent protein refer to the polypeptide to be modified by creating a library of diversified mutants.
  • the “parent protein” may be a naturally occurring (or wild-type) polypeptide or it may be a variant thereof prepared by any suitable means.
  • the “parent protein” may be a variant of a naturally occurring polypeptide which has been modified by substitution, deletion or truncation of one or more amino acid residues or by addition or insertion of one or more amino acid residues to the amino acid sequence of a naturally-occurring polypeptide.
  • enzyme variants or “protein variants” refer to a polypeptide of the invention comprising one or more substitutions of the specified amino acid residues. The total number of such substitutions is typically not more than 10, e.g. one, two, three, four, five or six of said substitutions.
  • the enzyme variant or protein variant of the invention may optionally include other modifications of the parent enzyme, typically not more than 10, e.g. not more than 5 such modifications.
  • the variant generally has a homology with the parent enzyme of at least 80%, e.g. at least 85%, typically at least 90% or at least 95%.
  • randomized library of protein variants refers to a library with at least partially randomized composition of the members, e.g. protein variants.
  • An “epitope” is a set of amino acids on a protein that are involved in an immunological response, such as antibody binding or T-cell activation.
  • One particularly useful method of identifying epitopes involved in antibody binding is to screen a library of peptide-phage membrane protein fusions and selecting those that bind to relevant antigen-specific antibodies, sequencing the randomized part of the fusion gene, aligning the sequences involved in binding, defining consensus sequences based on these alignments, and mapping these consensus sequences on the surface or the sequence and/or structure of the antigen, to identify epitopes involved in antibody binding.
  • epitope pattern such a consensus sequence of antibody binding peptides.
  • An example is the epitope pattern A R R ⁇ R.
  • the sign “ ⁇ ” in this notation indicates that the aligned antibody binding peptides included a non-consensus amino acid between the second and the third arginine.
  • an “epitope area” is defined as the amino acids situated close to the epitope sequence amino acids.
  • the amino acids of an epitope area are located ⁇ 5 ⁇ from the epitope sequence.
  • an epitope area also includes the corresponding epitope sequence itself. Modifications of amino acids of the ‘epitope area’ can possibly affect the immunogenic function of the corresponding epitope.
  • epitope sequence is meant the amino acid residues of a parent protein, which have been identified to belong to an epitope by the methods of the present invention (an example of an epitope sequence is E271 Q12 18 in Savinase).
  • antibody binding peptide denotes a peptide that bind with sufficiently high affinity to antibodies. Identification of ‘antibody binding peptides’ and their sequences constitute the first step of the method of this invention.
  • “Anchor amino acids” are the individual amino acids of an epitope pattern.
  • “Hot spot amino acids” are amino acids of parent protein, which are particularly likely to result in modified immunogenecity if they are mutated. Amino acids, which appear in three or more epitope sequences or which correspond to anchor amino acids are hot spot amino acids.
  • Environmental allergens are protein allergens that are present naturally. They include pollen, dust mite allergens, pet allergens, food allergens, venoms, etc.
  • “Commercial allergens” are protein allergens that are being brought to the market commercially. They include enzymes, pharmaceutical proteins, antimicrobial peptides, as well as allergens of transgenic plants.
  • the “donor protein” is the protein that was used to raise antibodies used to identify antibody binding sequences, hence the donor protein provides the information that leads to the epitope patterns.
  • acceptor protein is the protein, whose structure is used to fit the identified epitope patterns and/or to fit the antibody binding sequences. Hence the acceptor protein is also the parent protein.
  • autoepitope is one that has been identified using antibodies raised against the parent protein, i.e. the acceptor and the donor proteins are identical.
  • heteroepitope is one that has been identified with distinct donor and acceptor proteins.
  • the term “functionality” of protein variants refers to e.g. enzymatic activity; binding to a ligand or receptor; stimulation of a cellular response (e.g. 3 H-thymidine incorporation as response to a mitogenic factor); or anti-microbial activity.
  • polyclonal antibodies polyclonal antibodies isolated according to their specificity for a certain antigen, e.g. the protein backbone.
  • monospecific antibodies polyclonal antibodies isolated according to their specificity for a certain epitope. Such monospecific antibodies will bind to the same epitope, but with different affinity, as they are produced by a number of antibody producing cells recognizing overlapping but not necessarily identical epitopes.
  • randomized library of protein variants refers to a library with at least partially randomized composition of the members, e.g. protein variants.
  • Spiked mutagenesis is a form of site-directed mutagenesis, in which the primers used have been synthesized using mixtures of oligonucleotides at one or more positions.
  • a protein variant having modified immunogenicity as compared to the parent protein is meant a protein variant which differs from the parent protein in one or more amino acids whereby the immunogenicity of the variant is modified.
  • the modification of immunogenicity may be confirmed by testing the ability of the protein variant to elicit an IgE/lgG response.
  • protein is intended to cover oligopeptides, polypeptides as well as proteins as such.
  • the present invention relates to a method of selecting a protein variant having modified immunogenicity as compared to a parent protein, comprising the steps of:
  • a first step of the method is to identify peptide sequences, which bind specifically to antibodies.
  • Antibody binding peptide sequences can be found by testing a set of known peptide sequences for binding to antibodies raised against the donor protein. These sequences are typically selected, such that each represents a segment of the donor protein sequence (Mol. Immunol., 1992, vol. 29, pp. 1383-1389; Am. J. Resp. Cell. Mol. Biol. 2000, vol. 22, pp. 344-351). Also, randomized synthetic peptide libraries can be used to find antibody binding sequences (Slootstra et al; Molecular Diversity, 1996, vol. 2, pp. 156-164).
  • the identification of antibody binding sequences may be achieved by screening of a display package library, preferably a phage display library.
  • a display package library preferably a phage display library.
  • the principle behind phage display is that a heterologous DNA sequence can be inserted in the gene coding for a coat protein of the phage (WO 92/15679).
  • the phage will make and display the hybrid protein on its surface where it can interact with specific target agents.
  • target agent may be antigen-specific antibodies. It is therefore possible to select specific phages that display antibody-binding peptide sequences.
  • the displayed peptides can be of predetermined lengths, for example 9 amino acids long, with randomized sequences, resulting in a random peptide display package library.
  • peptide sequences that have sufficiently high affinity for the particular antibody used.
  • the peptides of the hybrid proteins of the specific phages which bind protein-specific antibodies characterize epitopes that are recognized by the immune system.
  • the antibodies used for reacting with the display package are preferably lgE antibodies to ensure that the epitopes identified are IgE epitopes, i.e. epitopes inducing and binding IgE.
  • the antibodies are polyclonal antibodies, optionally monospecific antibodies.
  • polyclonal antibodies are preferred in order to obtain a broader knowledge about the epitopes of a protein.
  • the amino acid sequence of the peptides presented by the display packages is long enough to represent a significant part of the epitope to be identified.
  • the peptides of the peptide display package library are oligopeptides having from 5 to 25 amino acids, preferably at least 8 amino acids, such as 9 amino acids.
  • the theoretical number of different possible sequences can be calculated as 20 n .
  • the diversity of the package library used must be large enough to provide a suitable representation of the theoretical number of different sequences.
  • each phage has one specific sequence of a determined length. Hence an average phage display library can express 10 8 ⁇ 10 12 different random sequences, and is therefore well-suited to represent the theoretical number of different sequences.
  • the antibody binding peptide sequences can be further analysed by consensus alignment e.g. by the methods described by Feng and Doolittle, Meth. Enzymol., 1996, vol. 266, pp. 368-382; Feng and Doolittle, J. Mol. Evol., 1987, vol. 25, pp. 351-360; and Taylor,. Meth. Enzymol., 1996, vol. 266, pp. 343-367.
  • one can define a geometric body e.g. an ellipsoid, a sphere, or a box
  • a geometric body e.g. an ellipsoid, a sphere, or a box
  • a geometric body e.g. an ellipsoid, a sphere, or a box
  • epitope patterns can be used to facilitate identification of epitope sequences. This can be done, by first matching the anchor amino acids on the 3-D structure and subsequently looking for other elements of the antibody binding peptide sequences, which provide additional matches. If there are many residues to be matched, it is only necessary that a suitable number can be found on the 3-D structure. For example if an epitope pattern comprises 4, 5, 6, or 7 amino acids, it is only necessary that 3 matches surface elements of the acceptor protein.
  • amino acids of the epitope sequence are surface exposed (as described below in Examples).
  • amino acids that surround binding sequences can affect binding of a ligand without participating actively in the binding process.
  • areas covered by amino acids with potential steric effects on the epitope-antibody interaction were defined around the identified epitope sequences. These areas are called ‘epitope areas’.
  • all amino acids situated within 5 ⁇ from the amino acids defining the epitope sequence were included.
  • the epitope area equals the epitope sequence. The accessibility criterium was not used as hidden amino acids of an epitope area also can have an effect on the adjacent amino acids of the epitope sequence.
  • genetic engineering mutations should be designed in the epitope areas, preferably in epitope sequences, and more preferably in the ‘hot spot amino acids’.
  • a protein variant exhibiting a modified immunogenicity may be produced by changing the identified epitope area of the parent protein by genetic engineering mutation of a DNA sequence encoding the parent protein.
  • the epitope identified may be changed by substituting at least one amino acid of the epitope area.
  • at least one anchor amino acid or hot spot amino acid is changed.
  • the change will often be substituting to an amino acid of different size, hydrophilicity, and/or polarity, such as a small amino acid versus a large amino acid, a hydrophilic amino acid versus a hydrophobic amino acid, a polar amino acid versus a non-polar amino acid and a basic versus an acidic amino acid.
  • a position to be changed by substitution, insertion, deletion will be indicated by: “Position xx to aaa, bbb, ccc, insertion, deletion”, meaning that position xx can be substituted by the amino acid aaa, bbb, ccc or that any amino acid can be inserted after position xx or that position xx can be deleted, e.g. “Position 27 to A, D, E, insertion, deletion” means that in position 27 the amino acid can be substituted by A, D or E, or that any amino acid can be inserted after position 27, or that the amino acid in position 27 can be deleted.
  • the protein variant can then be conjugated to activated polymers. Which amino acids to substitute and/or insert, depends in principle on the coupling chemistry to be applied.
  • the chemistry for preparation of covalent bioconjugates can be found in “Bioconjugate Techniques”, Hermanson, G. T. (1996), Academic Press Inc., which is hereby incorporated as reference (see below). It is preferred to make conservative substitutions in the polypeptide when the polypeptide has to be conjugated, as conservative substitutions secure that the impact of the substitution on the polypeptide structure is limited.
  • the conservative substitution may for instance be an asparagine to aspartic acid or glutamine to glutamic acid substitution. These residues resemble each other in size and shape, except from the carboxylic groups being present on the acidic residues.
  • the conservative substitution may be done by changing threonine or serine to cysteine.
  • the protein variant needs to be incubate with an active or activated polymer and subsequently separated from the unreacted polymer. This can be done in solution followed by purification or it can conveniently be done using the immobilized protein variants, which can easily be exposed to different reaction environments and washes.
  • polymeric molecules are to be conjugated with the polypeptide in question and the polymeric molecules are not active they must be activated by the use of a suitable technique. It is also contemplated according to the invention to couple the polymeric molecules to the polypeptide through a linker. Suitable linkers are well-known to the skilled person. Methods and chemistry for activation of polymeric molecules as well as for conjugation of polypeptides are intensively described in the literature.
  • Some of the methods concern activation of insoluble polymers but are also applicable to activation of soluble polymers e.g. periodate, trichlorotriazine, sulfonylhalides, divinylsulfone, carbodiimide etc.
  • the functional groups being amino, hydroxyl, thiol, carboxyl, aldehyde or sulfydryl on the polymer and the chosen attachment group on the protein must be considered in choosing the activation and conjugation chemistry which normally consist of i) activation of polymer, ii) conjugation, and iii) blocking of residual active groups.
  • Coupling polymeric molecules to the free acid groups of polypeptides may be performed with the aid of diimide and for example amino-PEG or hydrazino-PEG (Pollak et al., (1976), J. Am. Chem. Soc., 98, 289-291) or diazoacetate/amide (Wong et al., (1992), “Chemistry of Protein Conjugation and Crosslinking”, CRC Press).
  • Coupling polymeric molecules to hydroxy groups is generally very difficult as it must be performed in water. Usually hydrolysis predominates over reaction with hydroxyl groups.
  • Coupling polymeric molecules to free sulfhydryl groups can be achieved with special groups like maleimido or the ortho-pyridyl disulfide.
  • vinylsulfone U.S. Pat. No. 5,414,135, (1995), Snow et al.
  • Accessible arginine residues in the polypeptide chain may be targeted by groups comprising two vicinal carbonyl groups.
  • Organic sulfonyl chlorides e.g. Tresyl chloride
  • Tresyl chloride effectively converts hydroxy groups in a number of polymers, e.g. PEG, into good leaving groups (sulfonates) that, when reacted with nucleophiles like amino groups in polypeptides allow stable linkages to be formed between polymer and polypeptide.
  • the reaction conditions are in general mild (neutral or slightly alkaline pH, to avoid denaturation and little or no disruption of activity), and satisfy the non-destructive requirements to the polypeptide.
  • Tosylate is more reactive than the mesylate but also less stable decomposing into PEG, dioxane, and sulfonic acid (Zalipsky, (1995), Bioconjugate Chem., 6, 150-165). Epoxides may also been used for creating amine bonds but are much less reactive than the abovementioned groups.
  • isocyanates and isothiocyanates may be employed, yielding ureas and thioureas, respectively.
  • Amides may be obtained from PEG acids using the same leaving groups as mentioned above and cyclic imid thrones (U.S. Pat. No. 5,349,001, (1994), Greenwald et al.). The reactivity of these compounds are very high but may make the hydrolysis to fast.
  • PEG succinate made from reaction with succinic anhydride can also be used.
  • the hereby comprised ester group make the conjugate much more susceptible to hydrolysis (U.S. Pat. No. 5,122,614, (1992), Zalipsky).
  • This group may be activated with N-hydroxy succinimide.
  • Coupling of PEG to an aromatic amine followed by diazotation yields a very reactive diazonium salt, which can be reacted with a peptide in situ.
  • An amide linkage may also be obtained by reacting an azlactone derivative of PEG (U.S. Pat. No. 5,321,095, (1994), Greenwald, R. B.) thus introducing an additional amide linkage.
  • peptides do not comprise many Lysines it may be advantageous to attach more than one PEG to the same Lysine. This can be done e.g. by the use of 1,3-diamino-2-propanol.
  • PEGs may also be attached to the amino-groups of the enzyme with carbamate linkages (WO 95/11924, Greenwald et al.). Lysine residues may also be used as the backbone.
  • the coupling technique used in the examples is the N-succinimidyl carbonate conjugation technique descried in WO 90/13590 (Enzon).
  • the activated polymer is methyl-PEG which has been activated by N-succinimidyl carbonate as described WO 90/13590.
  • the coupling can be carried out at alkaline conditions in high yields.
  • a methyl-PEG 350 could be activated with N-succinimidyl carbonate and incubated with protein variant at a molar ratio of more than 5 calculated as equivalents of activated PEG divided by moles of lysines in the protein of interest.
  • the PEG:protein ratio should be optimized such that the PEG concentration is low enough for the buffer capacity to maintain alkaline pH throughout the reaction; while the PEG concentration is still high enough to ensure sufficient degree of modification of the protein. Further, it is important that the activated PEG is kept at conditions that prevent hydrolysis (i.e. dissolved in acid or solvents) and diluted directly into the alkaline reaction buffer. It is essential that primary amines are not present other than those occurring in the lysine residues of the protein. This can be secured by washing thoroughly in borate buffer. The reaction is stopped by separating the fluid phase containing unreacted PEG from the solid phase containing protein and derivatized protein. Optionally, the solid phase can then be washed with tris buffer, to block any unreacted sites on PEG chains that might still be present.
  • the mutations are designed, such that recognition sites for post-translational modifications are introduced in the epitope areas, and the protein variant is expressed in a suitable host organism capable of the corresponding post-translational modification.
  • These post-translational modifications may serve to shield the epitope and hence lower the immunogenicity of the protein variant relative to the protein backbone.
  • Post-translational modifications include glycosylation, phosphorylation, N-terminal processing, acylation, ribosylation and sulfatation. A good example is N-glycosylation.
  • N-glycosylation is found at sites of the sequence Asn-Xaa-Ser, Asn-Xaa-Thr, or Asn-Xaa-Cys, in which neither the Xaa residue nor the amino acid following the tri-peptide consensus sequence is a proline (T. E. Creighton, ‘Proteins—Structures and Molecular Properties, 2nd edition, W. H. Freeman and Co., New York, 1993, pp. 91-93). It is thus desirable to introduce such recognition sites in the sequence of the backbone protein.
  • the specific nature of the glycosyl chain of the glycosylated protein variant may be linear or branched depending on the protein and the host cells.
  • amino acid residues may be substituted, added or deleted, these amino acids preferably being located in different epitope areas.
  • a diversified library can be established by a range of techniques known to the person skilled in the art (Reetz M T; Jaeger K E, in ‘Biocatalysis—from Discovery to Application’ edited by Fessner W D, Vol. 200, pp. 31-57 (1999); Stemmer, Nature, vol. 370, p.389-391, 1994; Zhao and Arnold, Proc. Natl. Acad. Sci., USA, vol. 94, pp. 7997-8000, 1997; or Yano et al., Proc. Natl. Acad. Sci., USA, vol. 95, pp 5511-5515, 1998).
  • oligonucleotide primers which are synthesized using a mixture of nucleotides for certain positions.
  • the mixtures of oligonucleotides used within each triplet can be designed such that the corresponding amino acid of the mutated gene product is randomized within some predetermined distribution function. Algorithms have been disclosed, which facilitate this design (Jensen L J et al., Nucleic Acids Research, Vol. 26(3), 697-702 (1998)).
  • substitutions are found by a method comprising the following steps: 1) a range of substitutions, additions, and/or deletions are listed encompassing several epitope areas (preferably in the corresponding epitope sequences, anchor amino aids, and/or hot spots), 2) a library is designed which introduces a randomized subset of these changes in the amino acid sequence into the target gene, e.g. by spiked mutagenesis, 3) the library is expressed, and preferred variants are selected.
  • this method is supplemented with additional rounds of screening and/or family shuffling of hits from the first round of screening (J. E. Ness, et al, Nature Biotechnology, vol. 17, pp. 893-896, 1999) and/or combination with other methods of reducing immunogenicity by genetic means (such as that disclosed in WO 92/10755).
  • the library may be designed, such that at least one amino acid of the epitope area is substituted. In a preferred embodiment at least one amino acid of the epitope sequence itself is changed, and in an even more preferred embodiment, one or more hot spot amino acids are changed.
  • the library may be biased such that towards introducing an amino acid of different size, hydrophilicity, and/or polarity relative to the original one of the ‘protein backbone’. For example changing a small amino acid to a large amino acid, a hydrophilic amino acid to a hydrophobic amino acid, a polar amino acid to a non-polar amino acid or a basic to an acidic amino acid. Other changes may be the addition or deletion of at least one amino acid of the epitope area, preferably deleting an anchor amino acid. Furthermore, substituting some amino acids and deleting or adding others may change an epitope.
  • Diversity in the protein variant library can be generated at the DNA triplet level, such that individual codons are variegated e.g. by using primers of partially randomized sequence for a PCR reaction. Further, several techniques have been described, by which one can create a library with such diversity at several locations in the gene, which are too far apart to be covered by a single (spiked) oligonucleotide primer. These techniques include the use of in vivo recombination of the individually diversified gene segments as described in WO 97/07205 on page 3, line 8 to 29 or by using DNA shuffling techniques to create a library of full length genes that combine several gene segments each of which are diversified e.g. by spiked mutagenesis (Stemmer, Nature 370, pp.
  • protein variants have been constructed based on the methods described in this invention, it is desirable to confirm their antibody binding capacity, functionality, immunogenicity and/or allergenicity using a purified preparation.
  • the protein variant of interest can be expressed in larger scale, purified by conventional techniques, and the antibody binding and functionality should be examined in detail using dose-response curves and e.g. direct or competitive ELISA (C-ELISA).
  • the potentially reduced allergenicity (which is likely, but not necessarily true for a variant w. low antibody binding) should be tested in in vivo or in vitro model systems: e.g. an in vitro assays for immunogenicity such as assays based on cytokine expression profiles or other proliferation or differentiation responses of epithelial and other cells inc. B-cells and T-cells.
  • animal models for testing allergenicity should be set up to test a limited number of protein variants that show desired characteristics in vitro.
  • Useful animal models include the guinea pig intratracheal model (GPIT) (Ritz, et al. Fund. Appl. Toxicol., 21, pp.
  • mouse subcutaneous WO 98/30682, Novo Nordisk
  • rat-IT rat intratracheal
  • MINT mouse intranasal
  • the immunogenicity of the protein variant is measured in animal tests, wherein the animals are immunised with the protein variant and the immune response is measured. Specifically, it is of interest to determine the allergenicity of the protein variants by repeatedly exposing the animals to the protein variant by the intratracheal route and following the specific IgG and IgE titers. Alternatively, the mouse intranasal (MINT) test can be used to assess the allergenicity of protein variants.
  • the allergenicity is reduced at least 3 times as compared to the allergenicity of the parent protein, preferably 10 times reduced, more preferably 50 times.
  • the present inventors have demonstrated that the performance in ELISA correlates closely to the immunogenic responses measured in animal tests.
  • the IgE binding capacity of the protein variant must be reduced to at least below 75%, preferably below 50%, more preferably below 25% of the IgE binding capacity of the parent protein as measured by the performance in IgE ELISA, given the value for the IgE binding capacity of the parent protein is set to 100%.
  • a first asessment of the immunogenicity and/or allergenicity of a protein can be made by measuring the antibody binding capacity or antigenicity of the protein variant using appropriate antibodies. This approach has also been used in the literature (WO 99/47680).
  • the immunotherapeutic effect of allergen vaccines can be assessed a number of different ways. One is to measure the specific IgE binding, the reduction of which indicates a better allergen vaccine potential (WO 99/47680, ALK-ABELL ⁇ ). Also, several cellular assays could be employed to show the modified immuneresponse indicative of good allergen vaccine potential as shown in several publications, all of which are hereby incorporated by reference (van Neerven et al, “T lymphocyte responses to allergens: Epitope-specificity and clinical relevance”, Immunol Today, 1996, vol. 17, pp. 526-532; Hoffmann et al., Allergy, 1999, vol. 54, pp. 446-454, WO 99/07880).
  • protease assays WO 99/34011, Genencor International; J. E. Ness, et al, Nature Biotechn., 17, pp. 893-896, 1999
  • oxidoreductase assays Choerry et al., Nature Biotechn., 17, pp. 379-384, 1999
  • assays for several other enzymes WO 99/45143, Novo Nordisk.
  • soluble substrates can be employed for direct analysis of functionality of immobilized protein variants.
  • a related objective is to reduce cross-reactivity between ‘commercial allergens’ and ‘environmental allergens’.
  • Cross-reactivities between food allergens of different origin are well-known (Akkerdaas et al, Allergy 50, pp 215-220, 1995).
  • cross-reactivities between other environmental allergens (like pollen, dust mites etc.) and commercial allergens (like enzyme proteins) have been established in the literature (J. All. Clin. Immunol., 1998, vol. 102, pp. 679-686 and by the present inventors. The molecular reason for this cross-reactivity can be explored using epitope mapping.
  • the acceptor protein By finding epitope patterns using antibodies raised against environmental allergen (donor protein) and mapping this information on a commercial allergen (the acceptor protein), one may find the epitopes that are common to both proteins, and hence responsible for the cross-reactivity. Obviously, one can also use the commercial allergen as donor and the environmental allergen as acceptor. By modifying the commercial allergen using protein engineering in the epitope areas identified as described above, one can reduce the cross-reactivity of the commercial allergen variant towards the environmental allergens (and vice versa). Hence, the use of the modified commercial allergens would be safer than using the unmodified commercial allergen.
  • modifications of the enzymes in the epitope areas as disclosed the present application may cause other effects to the enzyme than modified immunogenicity.
  • a modification may also change the performance of the enzyme, such as the wash performance, thermo stability, storage stability and increased catalytical activity of the enzyme.
  • wash performance The ability of an enzyme to catalyze the degradation of various naturally occurring substrates present on the objects to be cleaned during e.g. wash is often referred to as its washing ability, wash-ability, detergency, or wash performance. Throughout this application the term wash performance will be used to encompass this property.
  • compositions comprising at least one protein (polypeptide) or enzyme of the invention.
  • the composition may comprise other polypeptides, proteins or enzymes and/or ingredients normally used in personal care products, such as shampoo, soap bars, skin lotion, skin creme, hair dye, toothpaste, household articles, agro chemicals, personal care products, such as cleaning preparations e.g. for contact lenses, cosmetics, toiletries, oral and dermal pharmaceuticals, compositions used for treating textiles, compositions used for manufacturing food, e.g. baking, and feed etc.
  • proteins(polypeptides)/enzymes include enzymes exhibiting protease, lipolytic enzyme, oxidoreductase, carbohydrase, transferase, such as transglutaminase, phytase and/or anti-microbial polypeptide activity. These enzymes may be present as conjugates with reduced activity.
  • the protein of the invention may furthermore typically be used in detergent composition. It may be included in the detergent composition in the form of a non-dusting granulate, a stabilized liquid, or a protected enzyme. Non-dusting granulates may be produced, e.g., as disclosed in U.S. Pat. Nos. 4,106,991 and 4,661,452 (both to Novo Industri A/S) and may optionally be coated by methods known in the art.
  • waxy coating materials are poly(ethylene oxide) products (polyethylene glycol, PEG) with mean molecular weights of 1000 to 20000; ethoxylated nonylphenols having from 16 to 50 ethylene oxide units; ethoxylated fatty alcohols in which the alcohol contains from 12 to 20 carbon atoms and in which there are 15 to 80 ethylene oxide units; fatty alcohols; fatty acids; and mono- and di- and triglycerides of fatty acids.
  • PEG poly(ethylene oxide) products
  • ethoxylated nonylphenols having from 16 to 50 ethylene oxide units
  • ethoxylated fatty alcohols in which the alcohol contains from 12 to 20 carbon atoms and in which there are 15 to 80 ethylene oxide units
  • fatty alcohols fatty acids
  • mono- and di- and triglycerides of fatty acids are given in patent GB 1483591.
  • Liquid enzyme preparations may, for instance, be stabilized by adding a polyol such as propylene glycol, a sugar or sugar alcohol, lactic acid or boric acid according to established methods.
  • a polyol such as propylene glycol, a sugar or sugar alcohol, lactic acid or boric acid according to established methods.
  • Other enzyme stabilizers are well known in the art.
  • Protected enzymes may be prepared according to the method disclosed in EP 238,216.
  • the detergent composition may be in any convenient form, e.g. as powder, granules, paste or liquid.
  • a liquid detergent may be aqueous, typically containing up to 70% water and 0-30% organic solvent, or non-aqueous.
  • the detergent composition comprises one or more surfactants, each of which may be anionic, nonionic, cationic, or zwitterionic.
  • the detergent will usually contain 0-50% of anionic surfactant such as linear alkylbenzenesulfonate (LAS), alpha-olefinsulfonate (AOS), alkyl sulfate (fatty alcohol sulfate) (AS), alcohol ethoxysulfate (AEOS or AES), secondary alkanesulfonates (SAS), alpha-sulfo fatty acid methyl esters, alkyl- or alkenylsuccinic acid, or soap.
  • anionic surfactant such as linear alkylbenzenesulfonate (LAS), alpha-olefinsulfonate (AOS), alkyl sulfate (fatty alcohol sulfate) (AS), alcohol ethoxysulfate (AEOS or AES), secondary alkanesulfonates (SAS), alpha-
  • nonionic surfactant such as alcohol ethoxylate (AEO or AE), carboxylated alcohol ethoxylates, nonylphenol ethoxylate, alkylpolyglycoside, alkyldimethylamine oxide, ethoxylated fatty acid monoethanolamide, fatty acid monoethanolamide, or polyhydroxy alkyl fatty acid amide (e.g. as described in WO 92/06154).
  • AEO or AE alcohol ethoxylate
  • carboxylated alcohol ethoxylates such as carboxylated alcohol ethoxylates, nonylphenol ethoxylate, alkylpolyglycoside, alkyldimethylamine oxide, ethoxylated fatty acid monoethanolamide, fatty acid monoethanolamide, or polyhydroxy alkyl fatty acid amide (e.g. as described in WO 92/06154).
  • the detergent composition may additionally comprise one or more other enzymes, such as e.g. proteases, amylases, lipolytic enzymes, cutinases, cellulases, peroxidases, oxidases, and further anti-microbial polypeptides.
  • enzymes such as e.g. proteases, amylases, lipolytic enzymes, cutinases, cellulases, peroxidases, oxidases, and further anti-microbial polypeptides.
  • the detergent may contain 1-65% of a detergent builder or complexing agent such as zeolite, diphosphate, triphosphate, phosphonate, citrate, nitrilotriacetic acid (NTA), ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTMPA), alkyl- or alkenylsuccinic acid, soluble silicates or layered silicates (e.g. SKS-6 from Hoechst).
  • a detergent builder or complexing agent such as zeolite, diphosphate, triphosphate, phosphonate, citrate, nitrilotriacetic acid (NTA), ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTMPA), alkyl- or alkenylsuccinic acid, soluble silicates or layered silicates (e.g. SKS-6 from Hoechst).
  • the detergent may also be unbuilt, i.
  • the detergent may comprise one or more polymers.
  • examples are carboxymethylcellulose (CMC), poly(vinylpyrrolidone) (PVP), polyethyleneglycol (PEG), poly(vinyl alcohol) (PVA), polycarboxylates such as polyacrylates, maleiclacrylic acid copolymers and lauryl methacrylate/acrylic acid copolymers.
  • the detergent may contain a bleaching system which may comprise a H 2 0 2 source such as perborate or percarbonate which may be combined with a peracid-forming bleach activator such as tetraacetylethylenediamine (TAED) or nonanoyloxybenzenesulfon-ate (NOBS).
  • TAED tetraacetylethylenediamine
  • NOBS nonanoyloxybenzenesulfon-ate
  • the bleaching system may comprise peroxyacids of, e.g., the amide, imide, or sulfone type.
  • the detergent composition of the invention comprising the polypeptide of the invention may be stabilized using conventional stabilizing agents, e.g. a polyol such as propylene glycol or glycerol, a sugar or sugar alcohol, lactic acid, boric acid, or a boric acid derivative such as, e.g., an aromatic borate ester, and the composition may be formulated as described in, e.g., WO 92/19709 and WO 92/19708.
  • stabilizing agents e.g. a polyol such as propylene glycol or glycerol
  • a sugar or sugar alcohol lactic acid, boric acid, or a boric acid derivative such as, e.g., an aromatic borate ester
  • the detergent may also contain other conventional detergent ingredients such as, e.g., fabric conditioners including clays, foam boosters, suds suppressors, anti-corrosion agents, soil-suspending agents, anti-soil-redeposition agents, dyes, bactericides, optical brighteners, or perfume.
  • fabric conditioners including clays, foam boosters, suds suppressors, anti-corrosion agents, soil-suspending agents, anti-soil-redeposition agents, dyes, bactericides, optical brighteners, or perfume.
  • the pH (measured in aqueous solution at use concentration) will usually be neutral or alkaline, e.g. in the range of 7-11.
  • a modified enzyme according to the invention may also be used in dishwashing detergents.
  • Dishwashing detergent compositions comprise a surfactant which may be anionic, non-ionic, cationic, amphoteric or a mixture of these types.
  • the detergent will contain 0-90% of non-ionic surfactant such as low- to non-foaming ethoxylated propoxylated straight-chain alcohols.
  • the detergent composition may contain detergent builder salts of inorganic and/or organic types.
  • the detergent builders may be subdivided into phosphorus-containing and non-phosphorus-containing types.
  • the detergent composition usually contains 1-90% of detergent builders.
  • Examples of phosphorus-containing inorganic alkaline detergent builders when present, include the water-soluble salts especially alkali metal pyrophosphates, orthophosphates, and polyphosphates.
  • suitable organic builders include the alkali metal, ammonium and substituted ammonium, citrates, succinates, malonates, fatty acid sulphonates, carboxymetoxy succinates, ammonium polyacetates, carboxylates, polycarboxylates, aminopolycarboxylates, polyacetyl carboxylates and polyhydroxsulphonates.
  • suitable organic builders include the higher molecular weight polymers and co-polymers known to have builder properties, for example appropriate polyacrylic acid, polymaleic and polyacrylic/polymaleic acid copolymers and their salts.
  • the dishwashing detergent composition may contain bleaching agents of the chlorine/bromine-type or the oxygen-type.
  • inorganic chlorine/bromine-type bleaches are lithium, sodium or calcium hypochlorite and hypobromite as well as chlorinated trisodium phosphate.
  • organic chlorine/bromine-type bleaches are heterocyclic N-bromo and N-chloro imides such as trichloroisocyanuric, tribromoisocyanuric, dibromoisocyanuric and dichloroisocyanuric acids, and salts thereof with water-solubilizing cations such as potassium and sodium.
  • Hydantoin compounds are also suitable.
  • oxygen bleaches are preferred, for example in the form of an inorganic persalt, preferably with a bleach precursor or as a peroxy acid compound.
  • suitable peroxy bleach compounds are alkali metal perborates, both tetrahydrates and monohydrates, alkali metal percarbonates, persilicates and perphosphates.
  • Preferred activator materials are TAED and glycerol triacetate.
  • the dishwashing detergent composition of the invention may be stabilized using conventional stabilizing agents for the enzyme(s), e.g. a polyol such as e.g. propylene glycol, a sugar or a sugar alcohol, lactic acid, boric acid, or a boric acid derivative, e.g. an aromatic borate ester.
  • a polyol such as e.g. propylene glycol
  • a sugar or a sugar alcohol lactic acid, boric acid, or a boric acid derivative, e.g. an aromatic borate ester.
  • the dishwashing detergent composition of the invention may also contain other conventional detergent ingredients, e.g. deflocculant material, filler material, foam depressors, anti-corrosion agents, soil-suspending agents, sequestering agents, anti-soil redeposition agents, dehydrating agents, dyes, bactericides, fluorescers, thickeners and perfumes.
  • the enzyme of the invention may be used in conventional dishwashing-detergents, e.g. in any of the detergents described in any of the following patent publications: EP 518719, EP 518720, EP 518721, EP 516553, EP 516554, EP 516555, GB 2200132, DE 3741617, DE 3727911, DE 4212166, DE 4137470, DE 3833047, WO 93/17089, DE 4205071, WO 52/09680, WO 93/18129, WO 93/04153, WO 92/06157, WO 92/08777, EP 429124, WO 93/21299, U.S. Pat. No.
  • a particularly useful application area for low allergenic proteins or of proteins with low cross-reactivity to environmental allergens would be in personal care products where the end-user is in close contact with the protein, and where certain problems with allergenicity has been encountered in experimental set-ups (Kelling et al., J. All. Clin. Imm., 1998, Vol.101, pp. 179-187 and Johnston et al., Hum. Exp. Toxicol., 1999, Vol. 18, p. 527).
  • conjugate or compositions of the invention can advantageously be used for personal care products, such as hair care and hair treatment products.
  • This include products such as shampoo, balsam, hair conditioners, hair waving compositions, hair dyeing compositions, hair tonic, hair liquid, hair cream, shampoo, hair rinse, hair spray.
  • oral care products such as dentifrice, oral washes, chewing gum.
  • skin care products and cosmetics such as skin cream, skin milk, cleansing cream, cleansing lotion, cleansing milk, cold cream, cream soap, nourishing essence, skin lotion, milky lotion, calamine lotion, hand cream, powder soap, transparent soap, sun oil, sun screen, shaving foam, shaving cream, baby oil lipstick, lip cream, creamy foundation, face powder, powder eye-shadow, powder, foundation, make-up base, essence powder, whitening powder.
  • conjugate of the invention can be used advantageously.
  • Such products include cleaning and disinfection products for contact lenses.
  • Proteases are well-known active ingredients for cleaning of contact lenses. They hydrolyse the proteinaceous soil on the lens and thereby makes it soluble. Removal of the protein soil is essential for the wearing comfort.
  • Proteases are also effective ingredients in skin cleaning products, where they remove the upper layer of dead keratinaseous skin cells and thereby make the skin look brighter and fresher.
  • Proteases are also used in oral care products, especially for cleaning of dentures, but also in dentifrices.
  • proteases are used in toiletries, bath and shower products, including shampoos, conditioners, lotions, creams, soap bars, toilet soaps, and liquid soaps.
  • Lipolytic enzymes can be applied for cosmetic use as active ingredients in skin cleaning products and anti-acne products for removal of excessive skin lipids, and in bath and shower products such as creams and lotions as active ingredients for skin care.
  • Lipolytic enzymes can also be used in hair cleaning products (e.g. shampoos) for effective removal of sebum and other fatty material from the surface of hair.
  • Lipolytic enzymes are also effective ingredients in products for cleaning of contact lenses, where they remove lipid deposits from the lens surface.
  • oxidase usually glucose oxidase
  • substrate e.g. glucose
  • peroxidase usually lactoperoxidase
  • Anti-microbial systems comprising the combination of an oxidase and a peroxidase are know in the cleaning of contact lenses.
  • Oxidoreductases Another application of oxidoreductases is oxidative hair dyeing using oxidases, peroxidases and laccases.
  • the free radicals activate chain reactions that lead to destruction of fatty membranes, collagen, and cells.
  • free radical scavengers such as Superoxide dismutase into cosmetics is well known (R. L. Goldemberg, DCI, Nov. 93, p. 48-52).
  • Protein disulfide isomerase is also an oxidoreductase. It can be utilised for waving of hair (reduction and reoxidation of disulfide bonds in hair) and repair of spoiled hair (where the damage is mainly reduction of existing disulfide bonds).
  • Plaque formed on the surface of teeth is composed mainly of polysaccharides. They stick to the surface of the teeth and the microorganisms.
  • the polysaccharides are mainly ⁇ -1,6 bound glucose (dextran) and ⁇ -1,3 bound glucose (mutan).
  • glucanases such as mutanase and dextranase helps hydrolysing the sticky matrix of plaque, making it easier to remove by mechanical action.
  • biofilm for instance the biofilm formed in lens cases can be removed by the action of glucanases.
  • conjugated enzymes or polypeptides with reduced immunogenicity according to the invention may advantageously be used in the manufacturing of food and feed.
  • the gluten in wheat flour is the essential ingredient responsible for the ability of flour to be used in baked foodstuffs.
  • Proteolytic enzymes are sometimes needed to modify the gluten phase of the dough, e.g. a hard wheat flour can be softened with a protease.
  • Neutrase® is a commercially available neutral metallo protease that can be used to ensure a uniform dough quality and bread texture, and to improve flavour.
  • the gluten proteins are degraded either moderately or more extensively to peptides, whereby close control is necessary in order to avoid excessive softening of the dough.
  • Proteases are also used for modifying milk protein.
  • proteases are used for brewing with unmalted cereals and for controlling the nitrogen content.
  • proteases are used so to speak to expand the animals digestion system.
  • lipolytic enzyme results in improved dough properties and an improved breadmaking quality in terms of larger volume, improved crumb structure and whiter crumb colour.
  • the observed effect can be explained by a mechanism where the lipolytic enzyme changes the interaction between gluten and some lipids fragment during dough mixing. This results in an improved gluten network.
  • lipases are used e.g. to minimize the amount of undesirable side-products, to modify fats by interesterification, and to synthesis of esters.
  • oxidoreductases with reduced immunogenicity may advantageously be used in the manufacturing of food and feed.
  • oxidoreductases are used for baking, glucose oxidase, lipoxygenase, peroxidase, catalase and combinations hereof.
  • bakers strengthen gluten by adding ascorbic acid and potassium bromate.
  • Some oxidoreductases can be used to replace bromate in dough systems by oxidation of free sulfydryl units in gluten proteins. Hereby disulphide linkages are formed resulting in stronger, more elastic doughs with greater resistance.
  • GluzymeTM (Novozymes A/S) is a glucose oxidase preparation with catalase activity that can be used to replace bromate.
  • the dough strengthen is measured as greater resistance to mechanical shock, better oven spring and larger loaf volume.
  • Flour has varying content of amylases leading to differences in the baking quality. Addition of amylases can be necessary in order to standardize the flour. Amylases and pentosanases generally provide sugar for the yeast fermentation, improve the bread volume, retard retrogradation, and decrease the staling rate and stickiness that results from pentosan gums.
  • Certain maltogenic amylases can be used for prolonging the shelf life of bread for two or more days without causing gumminess in the product.
  • the starch is modified in such a way that retrogradation is less likely to occur.
  • the produced low-molecular-weight sugars improve the baked goods water retention capacity without creating the intermediate-length dextrins that result in gumminess in the finished product.
  • the enzyme is inactivated during bread baking, so it can be considered a processing aid that does not have to be declared on the label. Overdosing of Novamyl can almost be excluded.
  • the bread volume can be improved by fungal ⁇ -amylases which further provide good and uniform structure of the bread crumb.
  • Said ⁇ -amylases are endoenzymes that produce maltose, dextrins and glucose.
  • Cereal and some bacterial ⁇ -amylases are inactivated at temperatures above the gelatinization temperature of starch, therefore when added to wheat dough it results in a low bread volume and a sticky bread interior.
  • Fungamyl has the advantage of being thermolabile and is inactivated just below the gelatinization temperature.
  • Enzyme preparations containing a number of pentosanase and hemi-cellulase activities can improve the handling and stability of the dough, and improves the freshness, the crumb structure and the volume of the bread.
  • Pentosanases can be used in combination with or as an alternative to emulsifiers.
  • carbohydrases are user for producing syrups from starch, which are widely used in soft drinks, sweets, meat products, dairy products, bread products, ice cream, baby food, jam etc.
  • the conversion of starch is normally carried out three steps. First the starch is liquefied, by the use of alpha-amylases. Maltodextrins, primary consisting of oligosaccharides and dextrins, are obtained.
  • the mixture is then treated with an amyloglucosidase for hydrolysing the oligosaccharides and dextrins into glucose. This way a sweeter product is obtained. If high maltose syrups are desired beta-amylases alone or in combination with a pullulanase (de-branching enzyme) may be used.
  • the glucose mixture can be made even sweeter by isomerization to fructose.
  • an immobilized glucose isomerase can be used for this an immobilized glucose isomerase.
  • dextranases are used to break down dextran in raw sugar juices and syrups.
  • alpha-amylases is advantageously being used for thinning of starch in distilling mashes.
  • alpha-amylases is used for adjunct liquefaction.
  • beta-galactosidases (lactase) is used when producing low lactose milk for persons suffering from lactose malabsorption.
  • flavoured milk drinks are produced from lactase-treated milk, the addition of sugar can be reduced without reducing the sweetness of the product.
  • lactose crystallization can be avoided by lactase treatment, and the risk of thickening caused by casein coagulation in lactose crystals is thus reduced.
  • xylanases are known to be used within a number of food/feed industrial applications as described in WO 94/21785 (Novo Nordisk A/S).
  • Alpha-amylases are used in the animal feed industry to be added to cereal-containing feed to improve the digestibility of starch.
  • Certain bacteriolytic enzymes may be used e.g. to wash carcasses in the meat packing industry (see U.S. Pat. No. 5,354,681 from Novo Industri A/S)
  • Transglutaminases with reduced immunogenicity according to the invention may advantageously be used in the manufacturing of food and feed.
  • Transglutaminases has the ability to crosslinking protein.
  • This property can be used for gelling of aqueous phases containing proteins. This may be used for when producing of spreads (DK patent application no. 1071/84 from Novo Nordisk A/S).
  • Transglutaminases are being used for improvement of baking quality of flour e.g. by modifying wheat flour to be used in the preparation of cakes with improved properties, such as improved taste, dent, mouth-feel and a higher volume (see JP 1-110147).
  • paste type food material e.g. used as fat substitution in foods as ice cream, toppings, frozen desserts, mayonnaises and low fat spreads (see WO 93/22930 from Novo Nordisk A/S).
  • Phytases of the invention may advantageously be used in the manufacturing of food, such as breakfast cereal, cake, sweets, drinks, bread or soup etc., and animal feed.
  • Phytases may be used either for exploiting the phosphorus bound in the phytate/phytic acid present in vegetable protein sources or for exploiting the nutritionally important minerals bound in phytic acid complexes.
  • Microbial phytase may be added to feedstuff of monogastric animals in order to avoid supplementing the feed with inorganic phosphorus (see U.S. Pat. No. 3,297,548).
  • Soyabean meal may contain high levels of the anti-nutritional factor phytate which renders this protein source unsuitable for application in baby food and feed for fish, calves and other non-ruminants, since the phytate chelates essential minerals present therein (see EP 0 420 358).
  • phytases may be used. Bread with better quality can be prepared by baking divided pieces of a dough containing wheat flour etc. and phytase (see JP-0-3076529-A).
  • a high phytase activity as in koji mold are known to be used for producing refined sake (see JP-0-6070749-A).
  • Proteases are used for degumming and sand washing of silk.
  • Lipolytic enzymes are used for removing fatty matter containing hydrophobic esters (e.g. triglycerides) during the finishing of textiles (see e.g. WO 93/13256 from Novo Nordisk A/S).
  • catalases may serve to remove excess hydrogen peroxide.
  • Cellulolytic enzymes are widely used in the finishing of denim garments in order to provide a localized variation in the colour density of the fabric (Enzyme facilitated “stone wash”).
  • Bio-Polishing is a specific treatment of the yarn surface which improves fabric quality with respect to handle and appearance without loss of fabric wettability. Bio-polishing may be obtained by applying the method described e.g. in WO 93/20278.
  • the threads are exposed to considerable mechanical strain.
  • the threads are usually reinforced by the coating (sizing) with a gelatinous substance (size).
  • the most common sizing agent is starch in native or modified form. A uniform and durable finish can thus be obtained only after removal of the size from the fabric, the so-called desizing. Desizing of fabrics sized with a size containing starch or modified starch is preferably facilitated by use of amylolytic enzymes.
  • proteases e.g. Trypsin and Chymotrypsin
  • pharmaceuticals to be taken orally, and dermal pharmaceuticals for combating e.g inflammations, edemata and injuries.
  • Transglutaminase is known to be used to casein-finishing leather by acting as a hardening agent (see WO 94/13839 from Novo Nordisk).
  • surfactant compositions in the form gels and foams comprising enzymes have shown to facilitate and improve hard surface cleaning.
  • Enzymes which advantageously may be added in such surfactant compositions, are in particular proteases, lipolytic enzymes, amylases and cellulases.
  • Such hard surface cleaning compositions comprising enzymes may also advantageously be used in the transport sector, for instance for washing cars and for general vessel wash.
  • this invention relates to the method by which the protein variants are being synthesised and expressed in host cells. This is achieved by culturing host cells capable of expressing a polypeptide in a suitable culture medium to obtain expression and secretion of the polypeptide into the medium, followed by isolation of the polypeptide from the culture medium.
  • the host cell may be any cell suitable for the large-scale production of proteins, capable of expressing a protein and being transformed by an expression vector.
  • the host cell comprises a DNA construct as defined above, optionally the cells may be transformed with an expression vector comprising a DNA construct as defined above.
  • the host cell is selected from any suitable cell, such as a bacterial cell, a fungal cell, an animal cell, such as an insect cell or a mammalian cell, or a plant cell.
  • the antigen provided is an isolated protein or protein-adjuvant mixture and more and more often, the protein is recombinant (e.g. the hepatitits B vaccine from Merck & Co).
  • the protein is recombinant (e.g. the hepatitits B vaccine from Merck & Co).
  • the methods of this invention can be used to identify such minimal structures that define an antigen (or epitope thereof) whether in the form of the parent protein scaffold with a number of mutations introduced in it, or whether it is in the form of the antibody binding peptides themselves.
  • a patient suffering allergic disease may be subjected to allergy vaccine therapy using allergens selected on the basis of testing the specificity of the patient's serum IgE against a bank of allergen extracts (or similar specificity tests of the patient's sensibilization such as skin prick test.
  • This kit would be useful to specifying which allergy the patient is suffering from. This kit will lead to a more specific answer than those kits used today, and hence to a better selection of allergen vaccine therapy for the individual patient.
  • antibody binding sequences could be administered in an isolated form or fused to a membrane protein of the phage display system, or to another protein, which may have beneficial effect for the immunoprotective effect of the antibody binding peptide (Dalum et al., Nature Biotechnology, 1999, Vol. 17, pp. 666-669).
  • the “parent protein” can in principle be any protein molecule of biological origin, non-limiting examples of which are peptides, polypeptides, proteins, enzymes, post-translationally modified polypeptides such as lipopeptides or glycosylated peptides, anti-microbial peptides or molecules, and proteins having pharmaceutical properties etc.
  • the invention relates to a method, wherein the “parent protein” is chosen from the group consisting of polypeptides, small peptides, lipopeptides, antimicrobials, and pharmaceutical polypeptides.
  • pharmaceutical polypeptides is defined as polypeptides, including peptides, such as peptide hormones, proteins and/or enzymes, being physiologically active when introduced into the circulatory system of the body of humans and/or animals.
  • compositions are potentially immunogenic as they are introduced into the circulatory system.
  • “pharmaceutical polypeptides” contemplated according to the invention include insulin, ACTH, glucagon, somatostatin, somatotropin, thymosin, parathyroid hormone, pigmentary hormones, somatomedin, erythropoietin, luteinizing hormone, chorionic gonadotropin, hypothalmic releasing factors, antidiuretic hormones, thyroid stimulating hormone, relaxin, interferon, thrombopoietin (TPO) and prolactin.
  • proteins are preferably to be used in industry, housekeeping and/or medicine, such as proteins used in personal care products (for example shampoo; soap; skin, hand and face lotions; skin, hand and face cremes; hair dyes; toothpaste), food (for example in the baking industry), detergents and pharmaceuticals.
  • personal care products for example shampoo; soap; skin, hand and face lotions; skin, hand and face cremes; hair dyes; toothpaste
  • food for example in the baking industry
  • detergents and pharmaceuticals for example in the baking industry, detergents and pharmaceuticals.
  • the antimicrobial peptide may be, e.g., a membrane-active antimicrobial peptide, or an antimicrobial peptide affecting/interacting with intracellular targets, e.g. binding to cell DNA.
  • the AMP is generally a relatively short peptide, consisting of less than 100 amino acid residues, typically 20-80 residues.
  • the antimicrobial peptide has bactericidal and/or fungicidal effect, and it may also have antiviral or antitumour effects. It generally has low cytotoxicity against normal mammalian cells.
  • the antimicrobial peptide is generally highly cationic and hydrophobic. It typically contains several arginine and lysine residues, and it may not contain a single glutamate or asparatate. It usually contains a large proportion of hydrophobic residues.
  • the peptide generally has an amphiphilic structure, with one surface being highly positive and the other hydrophobic.
  • bioactive peptide and the encoding nucleotide sequence may be derived from plants, invertebrates, insects, amphibians and mammals, or from microorganisms such as bacteria and fungi.
  • the antimicrobial peptide may act on cell membranes of target microorganisms, e.g. through nonspecific binding to the membrane, usually in a membrane-parallel orientation, interacting only with one face of the bilayer.
  • the antimicrobial peptide typically has a structure belonging to one of five major classes: a helical, cystine-rich (defensin-like), b-sheet, peptides with an unusual composition of regular amino acids, and peptides containing uncommon modified amino acids.
  • alpha-helical peptides are Magainin 1 and 2; Cecropin A, B and P1; CAP18; Andropin; Clavanin A or AK; Styelin D and C; and Buforin II.
  • cystine-rich peptides are a-Defensin HNP-1 (human neutrophil peptide) HNP-2 and HNP-3; b-Defensin-12, Drosomycin, g1-purothionin, and Insect defensin A.
  • b-sheet peptides are Lactoferricin B, Tachyplesin I, and Protegrin PG1-5.
  • Examples of peptides with an unusual composition are Indolicidin; PR-39; Bactenicin Bac5 and Bac7; and Histatin 5.
  • Examples of peptides with unusual amino acids are Nisin, Gramicidin A, and Alamethicin.
  • AFP antifungal peptide
  • Aspergillus giganteus Another example is the antifungal peptide (AFP) from Aspergillus giganteus.
  • AFP antifungal peptide
  • the antifungal polypeptide having the amino acid sequence shown in FIG. 1 has been found in several strains of the fungal species A. giganteus, an example of which is the A. giganteus strain deposited with the Centraallbureau voor Schimmelcultures (CBS) under the deposition number CBS 526.65.
  • CBS Centraallbureau voor Schimmelcultures
  • antifungal polypeptide, or variants thereof, suitable for the use according to the invention are expected to be derivable from other fungal species, especially other Aspergillus species such as A. pallidus, A. clavatus, A. longivesica, A. rhizopodus and A. clavatonanicus, because of the close relationship which exists between these species and A. giganteus.
  • the protein is an enzyme, such as glycosyl hydrolases, carbohydrases, peroxidases, proteases, lipolytic enzymes, phytases, polysaccharide lyases, oxidoreductases, transglutaminases and glycoseisomerases, in particular the following.
  • enzyme such as glycosyl hydrolases, carbohydrases, peroxidases, proteases, lipolytic enzymes, phytases, polysaccharide lyases, oxidoreductases, transglutaminases and glycoseisomerases, in particular the following.
  • proteases i.e. enzymes classified under the Enzyme Classification number E.C. 3.4 in accordance with the Recommendations (1992) of the International Union of Biochemistry and Molecular Biology (IUBMB)
  • IUBMB International Union of Biochemistry and Molecular Biology
  • proteases selected from those classified under the Enzyme Classification (E.C.) numbers:
  • 3.4.11 i.e. so-called aminopeptidases
  • aminopeptidases including 3.4.11.5 ( Prolyl aminopeptidase ), 3.4.11.9 (X-pro aminopeptidase), 3.4.11.10 ( Bacterial leucyl aminopeptidase), 3.4.11.12 ( Thermophilic aminopeptidase ), 3.4.11.15 ( Lysyl aminopeptidase ), 3.4.11.17 ( Tryptophanyl aminopeptidase ), 3.4.11.18 ( Methionyl aminopeptidase ).
  • 3.4.21 i.e. so-called serine endopeptidases
  • 3.4.21.1 Chymotrypsin
  • 3.4.21.4 Trypsin
  • 3.4.21.25 Cucumisin
  • 3.4.21.32 Brachyurin
  • 3.4.21.48 Cerevisin
  • 3.4.21.62 Subtilisin
  • cysteine endopeptidases including 3.4.22.2 ( Papain ), 3.4.22.3 ( Ficain ), 3.4.22.6 ( Chymopapain ), 3.4.22.7 ( Asclepain ), 3.4.22.14 ( Actinidain ), 3.4.22.30 ( Caricain ) and 3.4.22.31 ( Ananain );
  • 3.4.23 i.e. so-called aspartic endopeptidases
  • aspartic endopeptidases including 3.4.23.1 ( Pepsin A ), 3.4.23.18 ( Aspergillopepsin I), 3.4.23.20 ( Penicillopepsin ) and 3.4.23.25 ( Saccharopepsin ); and
  • 3.4.24 i.e. so-called metalloendopeptidases
  • 3.4.24.28 Bacillolysin
  • a serine protease is an enzyme which catalyzes the hydrolysis of peptide bonds, and in which there is an essential serine residue at the active site (White, Handler and Smith, 1973 “Principles of Biochemistry,” Fifth Edition, McGraw-Hill Book Company, N.Y., pp. 271-272).
  • the bacterial serine proteases have molecular weights in the 20,000 to 45,000 Dalton range. They are inhibited by diisopropylfluorophosphate. They hydrolyze simple terminal esters and are similar in activity to eukaryotic chymotrypsin, also a serine protease.
  • subtilases A sub-group of the serine proteases tentatively designated subtilases has been proposed by Siezen et al., Protein Engng. 4 (1991) 719-737 and Siezen et al. Protein Science 6 (1997) 501-523. They are defined by homology analysis of more than 170 amino acid sequences of serine proteases previously referred to as subtilisin-like proteases. A subtilisin was previously often defined as a serine protease produced by Gram-positive bacteria or fungi, and according to Siezen et al. now is a subgroup of the subtilases. A wide variety of subtilases have been identified, and the amino acid sequence of a number of subtilases has been determined. For a more detailed description of such subtilases and their amino acid sequences reference is made to Siezen et al.(1997).
  • subtilases may be classified as savinase-like subtilisins, having at least 81% homology to Savinase, preferably at least 85% homology, more preferably at least 90% homology, even more preferably at least 96% homology, most preferably at least 98% homology to Savinase.
  • parent subtilase describes a subtilase defined according to Siezen et al. (1991 and 1997). For further details see description of “SUBTILASES” immediately above.
  • a parent subtilase may also be a subtilase isolated from a natural source, wherein subsequent modifications have been made while retaining the characteristic of a subtilase.
  • a parent subtilase may also be a subtilase which has been prepared by the DNA shuffling technique, such as described by J. E. Ness et al., Nature Biotechnology, 17, 893-896 (1999).
  • subtilase may be termed “wild type subtilase”.
  • modification(s) used herein is defined to include chemical modification of a subtilase as well as genetic manipulation of the DNA encoding a subtilase.
  • the modification(s) can be replacement(s) of the amino acid side chain(s), substitution(s), deletion(s) and/or insertions in or at the amino acid(s) of interest.
  • subtilase variant or mutated subtilase means a subtilase that has been produced by an organism which is expressing a mutant gene derived from a parent microorganism which possessed an original or parent gene and which produced a corresponding parent enzyme, the parent gene having been mutated in order to produce the mutant gene from which said mutated subtilase protease is produced when expressed in a suitable host.
  • subtilisins examples comprise subtilisin BPN′, subtilisin amylosacchariticus, subtilisin 168, subtilisin mesentericopeptidase, subtilisin Carlsberg, subtilisin DY, subtilisin 309, subtilisin 147, PD498 (WO 93/24623), thermitase, aqualysin, Bacillus PB92 protease, proteinase K, Protease TW7, and Protease TW3.
  • Preferred commercially available protease enzymes include AlcalaseTM, SavinaseTM, PrimaseTM, DuralaseTM, Neutrase®, Dyrazym®, EsperaseTM, Pyrase®, Pancreatic Trypsin NOVO (PTN), Bio-FeedTM Pro, Clear-Lens Pro, and Relase® (Novozymes A/S), MaxataseTM, MaxacalTM, MaxapemTM, ProperaseTMM, PurafectTM, Purafect OXPTM (Genencor International Inc.).
  • protease variants are contemplated as the parent protease.
  • protease variants are disclosed in EP 130.756 (Genentech), EP 214.435 (Henkel), WO 87/04461 (Amgen), WO 87/05050 (Genex), EP 251.446 (Genencor), EP 260.105 (Genencor), Thomas et al., (1985), Nature. 318, p. 375-376, Thomas et al., (1987), J. Mol. Biol., 193, pp. 803-813, Russel et al., (1987), Nature, 328, p.
  • proteases The activity of proteases can be determined as described in “Methods of Enzymatic Analysis”, third edition, 1984, Verlag Chemie, Weinheim, vol. 5.
  • Lipolytic enzymes are classified in EC 3.1.1 Carboxylic Ester Hydrolases according to Enzyme Nomenclature (available at http://www.chem.qmw.ac.uk/iubmb/enzyme).
  • the lipolytic enzyme may have a substrate specificity with an activity such as EC 3.1.1.3 triacylglycerol lipase, EC 3.1.1.4 phospholipase A2, EC 3.1.1.5 lysophospholipase, EC 3.1.1.26 galactolipase, EC 3.1.1.32 phospholipase A1, EC 3.1.1.73 feruloyl esterase or EC 3.1.1.74 cutinase.
  • the parent lipolytic enzyme may be prokaryotic, particularly a bacterial enzyme, e.g. from Pseudomonas.
  • Pseudomonas lipases e.g. from P. cepacia (U.S. Pat. No. 5,290,694, pdb file 1OIL), P. glumae (N Frenken et al. (1992), Appl. Envir. Microbiol. 58 3787-3791, pdb files 1TAH and 1QGE), P. pseudoalcaligenes (EP 334 462) and Pseudomonas sp.
  • strain SD 705 (FERM BP-4772) (WO 95/06720, EP 721 981, WO 96/27002, EP 812 910).
  • the P. glumae lipase sequence is identical to the amino acid sequence of Chromobacterium viscosum (DE 3908131 A1).
  • Other examples are bacterial cutinases, e.g. from Pseudomonas such as P. mendocina (U.S. Pat. No. 5,389,536) or P. putida (WO 88/09367).
  • the parent lipolytic enzyme may be eukaryotic, e.g. a fungal lipolytic enzyme such as lipolytic enzymes of the Humicola family and the Zygomycetes family and fungal cutinases.
  • fungal cutinases are the cutinases of Fusarium solani pisi (S. Longhi et al., Journal of Molecular Biology, 268 (4), 779-799 (1997)) and Humicola insolens (U.S. Pat. No. 5,827,719).
  • the parent lipolytic enzyme may be fungal and may have an amino acid sequence that can be aligned with SEQ ID NO: 1 which is the amino acid sequence shown in positions 1-269 of SEQ ID NO: 2 of U.S. Pat. No. 5,869,438 for the lipase from Thermomyces lanuginosus (synonym Humicola lanuginosa ), described in EP 258 068 and EP 305 216 (trade name LIPOLASE).
  • the parent lipolytic enzyme may particularly have an amino acid sequence with at least 50% homology with SEQ ID NO: 1.
  • SEQ ID NO: 1 is the amino acid sequence shown in positions 1-269 of SEQ ID NO: 2 of U.S. Pat. No. 5,869,438 for the lipase from Thermomyces lanuginosus (synonym Humicola lanuginosa ), described in EP 258 068 and EP 305 216 (trade name LIPOLASE).
  • the parent lipolytic enzyme may particularly have an amino
  • lanuginosus other examples are a lipase from Penicillium camembertii (P25234), a lipase from Fusasrium, lipase/phospholipase from Fusarium oxysporum (EP 130064, WO 98/26057), lipase from F. heterosporum (R87979), lysophospholipase from Aspergillus foetidus (W33009), phospholipase A1 from A. oryzae (JP-A 10-155493), lipase from A. oryzae (D85895), lipase/ferulic acid esterase from A.
  • niger Y09330
  • lipase/ferulic acid esterase from A. tubingensis
  • Y09331 lipase/ferulic acid esterase from A. tubingensis
  • WO 98/45453 lipase from A. tubingensis
  • lysophospholipase from A. niger WO 98/31790
  • lipase from F. solanii having an isoelectric point of 6.9 and an apparent molecular weight of 30 kDa (WO 96/18729).
  • Zygomycetes family of lipases comprising lipases having at least 50% homology with the lipase of Rhizomucor miehei (P19515.
  • This family also includes the lipases from Absidia reflexa, A. sporophora, A. corymbifera, A. blakesleeana, A. griseola (all described in WO 96/13578 and WO 97/27276) and Rhizopus oryzae (P21811). Numbers in parentheses indicate publication or accession to the EMBL, GenBank, GeneSeqp or Swiss-Prot databases.
  • lipases examples include lipases derived from the following microorganisms.
  • the indicated patent publications are incorporated herein by reference:
  • Humicola e.g. H. brevispora, H. brevis var. thermoidea.
  • Pseudomonas e.g. Ps. fragi, Ps. stutzeri, Ps. cepacia and Ps. fluorescens (WO 89/04361), or Ps. plantarii or Ps. gladioli (U.S. Pat. No. 4,950,417 (Solvay enzymes)) or Ps. alcaligenes and Ps. pseudoalcaligenes (EP 218272) or.
  • Candida e.g. C. cylindracea (also called C. rugosa ) or C. antarctica (WO 88/02775) or C. antarctica lipase A or B (WO 94/01541 and WO 89/02916).
  • Geotricum e.g. G. candidum (Schimada et al., (1989), J. Biochem., 106, 383-388).
  • Rhizopus e.g. R. delemar (Hass et al., (1991), Gene 109, 107-113) or R. niveus (Kugimiya et al., (1992) Biosci. Biotech. Biochem 56, 716-719) or R. oryzae.
  • Bacillus e.g. B. subtilis (Dartois et al., (1993) Biochemica et Biophysica acta 1131, 253-260) or B. stearothermophilus (JP 64/7744992) or B. pumilus (WO 91/16422).
  • Lipolase® (WO 98/35026) LipolaseTM Ultra, Lipozyme®, Palatase®, Novozym® 435, Lecitase® (all available from Novozymes A/S).
  • lipases examples include LumafastTM, Ps. mendocian lipase from Genencor Int. Inc.; LipomaxTM, Ps. pseudoalcaligenes lipase from Gist Brocades/Genencor Int. Inc.; Fusarium solani lipase (cutinase) from Unilever; Bacillus sp. lipase from Solvay enzymes.
  • LumafastTM Ps. mendocian lipase from Genencor Int. Inc.
  • LipomaxTM Ps. pseudoalcaligenes lipase from Gist Brocades/Genencor Int. Inc.
  • Bacillus sp. lipase from Solvay enzymes.
  • Other lipases are available from other companies.
  • lipase variants are contemplated as the parent enzyme. Examples of such are described in e.g. WO 93/01285 and WO 95/22615.
  • the activity of the lipase can be determined as described in “Methods of Enzymatic Analysis”, Third Edition, 1984, Verlag Chemie, Weinhein, vol. 4, or as described in AF 95/5 GB (available on request from Novozymes A/S).
  • oxidoreductases i.e. enzymes classified under the Enzyme Classification number E.C. 1 (Oxidoreductases) in accordance with the Recommendations (1992) of the International Union of Biochemistry and Molecular Biology (IUBMB)
  • E.C. 1 Enzyme Classification number
  • IUBMB International Union of Biochemistry and Molecular Biology
  • oxidoreductases selected from those classified under the Enzyme Classification (E.C.) numbers:
  • Glycerol-3-phosphate dehydrogenase (NAD) (1.1.1.8), Glycerol-3-phosphate dehydrogenase [NAD(P)] (1.1.1.94), Glycerol-3-phosphate 1-dehydrogenase [NADP] (1.1.1.94), Glucose oxidase (1.1.3.4), Hexose oxidase (1.1.3.5), Catechol oxidase (1.1.3.14), Bilirubin oxidase (1.3.3.5), Alanine dehydrogenase (1.4.1.1), Glutamate dehydrogenase (1.4.1.2), Glutamate dehydrogenase [AND(P)] (1.4.1.3), Glutamate dehydrogenase (NADP) (1.4.1.4), L-Amino acid dehydrogenase (1.4.1.5), Serine dehydrogenase (1.4.1.7), Valine dehydrogenase (NADP) (1.4.1.8), Leucine dehydrogenase
  • Said glucose oxidases may be derived from Aspergillus niger.
  • Said laccases may be derived from Polyporus pinsitus, Myceliophthora thermophila, Coprinus cinereus, Rhizoctonia solani, Rhizoctonia praticola, Scytalidium thermophilum and Rhus vernicifera. Because of the homology found between the above mentioned laccases (see WO 98/38287), they are considered to belong to the same class of laccases, namely the class of “Coprinus-like laccases”.
  • the term “Coptinus-like laccase” is intended to indicate a laccase which, on the amino acid level, displays a homology of at least 50% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 55% and less than 100% to the Copdinus cinereus laccase SEQ ID NO: 3, or at least 60% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 65% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 70% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 75% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 80% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 85% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 90% and less than 100% to the Coprinus cinereus laccase
  • Bilirubin oxidases may be derived from Myrothechecium verrucaria.
  • the peroxidase may be derived from e.g. Soy bean, Horseradish or Coprinus cinereus.
  • the protein disulfide reductase may be any of the mentioned in Danish application nos. 768/93, 265/94 and 264/94 (Novo Nordisk A/S), which are hereby incorporated as references, including Protein Disulfide reductases of bovine origin, Protein Disulfide reductases derived from Aspergillus oryzae or Aspergillus niger, and DsbA or DsbC derived from Escherichia coli.
  • oxidoreductases include GluzymeTM (enzyme available from Novozymes A/S). However, other oxidoreductases are available from others.
  • oxidoreductases The activity of oxidoreductases can be determined as described in “Methods of Enzymatic Analysis”, third edition, 1984, Verlag Chemie, Weinheim, vol. 3.
  • Parent carbohydrases may be defined as all enzymes capable of breaking down carbohydrate chains (e.g. starches) of especially five and six member ring structures (i.e. enzymes classified under the Enzyme Classification number E.C. 3.2 (glycosidases) in accordance with the Recommendations (1992) of the International Union of Biochemistry and Molecular Biology (IUBMB)). Also included in the group of carbohydrases according to the invention are enzymes capable of isomerizing carbohydrates e.g. six member ring structures, such as D-glucose to e.g. five member ring structures like D-fructose.
  • carbohydrases may be defined as all enzymes capable of breaking down carbohydrate chains (e.g. starches) of especially five and six member ring structures (i.e. enzymes classified under the Enzyme Classification number E.C. 3.2 (glycosidases) in accordance with the Recommendations (1992) of the International Union of Bio
  • Examples include carbohydrases selected from those classified under the Enzyme Classification (E.C.) numbers: alpha-amylase (3.2.1.1), beta-amylase (3.2.1.2), glucan 1,4-alpha-glucosidase (3.2.1.3), cellulase (3.2.1.4), endo-1,3(4)-beta-glucanase (3.2.1.6), endo-1,4-beta-xylanase (3.2.1.8), dextranase (3.2.1.11), chitinase (3.2.1.14), polygalacturonase (3.2.1.15), lysozyme (3.2.1.17), beta-glucosidase (3.2.1.21), alpha-galactosidase (3.2.1.22), beta-galactosidase (3.2.1.23), amylo-1,6-glucosidase (3.2.1.33), xylan 1,4-beta-xylosidase (3.
  • carbohydrases examples include alpha-1,3-glucanases derived from Trichoderma harzfanum; alpha-1,6-glucanases derived from a strain of Paecilomyces; beta-glucanases derived from Bacillus subtilis; beta-glucanases derived from Humicola insolens; beta-glucanases derived from Aspergillus niger, beta-glucanases derived from a strain of Trichoderma; beta-glucanases derived from a strain of Oerskovia xanthineolytica; exo-1,4-alpha-D-glucosidases (glucoamylases) derived from Aspergillus niger, alpha-amylases derived from Bacillus subtilis; alpha-amylases derived from Bacillus amyloliquefaciens; alpha-amylases derived from Bacillus stearothermophilus; alpha-amylases
  • carbohydrases include Alpha-GalTM, Bio-FeedTM Alpha, Bio-FeedTM Beta, Bio-FeedTM Plus, Bio-FeedTM Plus, Novozyme® 188, Carezyme® (SEQ ID NO: 5), Celluclast®, Cellusoft®, Ceremyl®, CitrozymTM, DenimaxTM, DezymeTM, DextrozymeTM, Finizym®, FungamylTM, GamanaseTM, Glucanex®, Lactozym®, MaltogenaseTM, PentopanTM, PectinexTM, Promozyme®, PulpzymeTM, NovamylTM, Termamyl®, AMG (Amyloglucosidase Novo), Maltogenase®, Sweetzyme®, Aquazym®, Natalase® (SEQ ID NO: 4), SP722, AA560 (all enzymes available from Novozymes A/S).
  • Other carbohydrases are available from other companies
  • the parent cellulase is preferably a microbial cellulase.
  • the cellulase may be selected from bacterial cellulases, e.g. Pseudomonas cellulases or Bacillus, such as the Bacillus strains described in U.S. Pat. No. 4,822,516, U.S. Pat. No. 5,045,464 or EP 468 464, or B. lautus (cf. WO 91/10732), cellulases.
  • the parent cellulases may be a fungal cellulase, in particular Humicola, Trichoderma, Irpex, Aspergillus, Penicillium, Myceliophthora or Fusarium cellulases.
  • suitable parent cellulases are described in, e.g. WO 91/17244.
  • suitable Trichoderma cellulases are those described in T. T. Teeri, Gene 51, 1987, pp. 43-52.
  • the parent cellulase is selected from the cellulases classified in family 45, e.g.
  • EG B Pseudomonas fluorescens
  • EG V Humicola insolens
  • alpha-amylases produced by Bacillus spp. are highly homologous on the amino acid level.
  • the B. licheniformis alpha-amylase comprising the amino acid sequence shown in SEQ ID NO: 4 of WO 00/29560 (commercially available as Termamyl® has been found to be about 89% homologous with the B. amyloliquefaciens alpha-amylase comprising the amino acid sequence shown in SEQ ID NO: 5 of WO 00/29560 and about 79% homologous with the B. stearothermophilus alpha-amylase comprising the amino acid sequence shown in SEQ ID NO: 3 of WO 00/29560.
  • alpha-amylases include an alpha-amylase derived from a strain of the Bacillus sp. NCIB 12289, NCIB 12512, NCIB 12513 or DSM 9375, all of which are described in detail in WO 95/26397, and the alpha-amylase described by Tsukamoto et al., Biochemical and Biophysical Research Communications, 151 (1988), pp. 25-31.
  • Still further homologous alpha-amylases include the alpha-amylase produced by the B. licheniformis strain described in EP 0252666 (ATCC 27811), and the alpha-amylases identified in WO 91/00353 and WO 94/18314.
  • Other commercial Termamyl-like B. licheniformis alpha-amylases are Optitherm® and Takatherm® (available from Solvay), Maxamyl® (available from Gist-brocades/Genencor), Spezym AA® and Spezyme Delta AATM (available from Genencor), and Keistase® (available from Daiwa).
  • alpha-amylases Because of the substantial homology found between these alpha-amylases, they are considered to belong to the same class of alpha-amylases, namely the class of “Termamyl-like alpha-amylases”.
  • Termamyl-like alpha-amylase is intended to indicate an alpha-amylase which, at the amino acid level, exhibits a substantial homology to Termamyl®, i.e., the B. licheniformis alpha-amylase having the amino acid sequence shown in SEQ ID NO: 4 (WO 00/29560).
  • a Termamyl-like alpha-amylase is an alpha-amylase which has the amino acid sequence shown in SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7 or 8 of WO 00/29560, and the amino acid sequence shown in SEQ ID NO: 1 of WO 95/26397 (the same as the amino acid sequence shown as SEQ ID NO: 7 of WO 00/29560) or in SEQ ID NO: 2 of WO 95/26397 (the same as the amino acid sequence shown as SEQ ID NO: 8 of WO 00/29560) or in Tsukamoto et al., 1988, (which amino acid sequence is shown in SEQ ID NO: 6 of WO 00/29560) or i) which displays at least 60% homology (identity), preferred at least 70%, more preferred at least 75%, even more preferred at least 80%, especially at least 85%, especially preferred at least 90%, especially at least 95%, even especially more preferred at least 97%, especially at least 99% homology with at least one
  • the “homology” may be determined by use of any conventional algorithm, preferably by use of the gap progamme from the GCG package version 8 (August 1994) using default values for gap penalties, i.e., a gap creation penalty of 3.0 and gap extension penalty of 0.1 (Genetic Computer Group (1991) Programme Manual for the GCG Package, version 8, 575 Science Drive, Madison, Wis., USA 53711).
  • the parent Termamyl-like alpha-amylase backbone may in an embodiment have an amino acid sequence which has a degree of identity to SEQ ID NO: 4 (WO 00/29560) of at least 65%, preferably at least 70%, preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least about 90%, even more preferably at least 95%, even more preferably at least 97%, and even more preferably at least 99% identity determined as described above.
  • a structural alignment between Termamyl® (SEQ ID NO: 4) and a Termamyl-like alpha-amylase may be used to identify equivalent/corresponding positions in other Termamyl-like alpha-amylases.
  • One method of obtaining said structural alignment is to use the Pile Up programme from the GCG package using default values of gap penelties, i.e., a gap creation penalty of 3.0 and gap extension penalty of 0.1.
  • Other structural alignment methods include the hydrophobic cluster analysis (Gaboriaud et al., (1987), FEBS LETTERS 224, pp. 149-155) and reverse threading (Huber, T; Torda, AE, PROTEIN SCIENCE Vol. 7, No. 1 pp. 142-149 (1998).
  • Parent glucoamylase contemplated according to the present invention include fungal glucoamylases, in particular fungal glucoamylases obtainable from an Aspergillus strain, such as an Aspergillus niger or Aspergillus awamori glucoamylases and variants or mutants thereof, homologous glucoamylases, and further glucoamylases being structurally and/or functionally similar to SEQ ID NO: 2 (WO 00/04136).
  • Aspergillus niger glucoamylases G1 and G2 disclosed in Boel et al.
  • Glucoamylases G1 and G2 from Aspergillus niger are synthesized from two different but closely related mRNAs”, EMBO J. 3 (5), p. 1097-1102.
  • the G2 glucoamylase is disclosed in SEQ ID NO: 2 (WO 00/04136).
  • the G1 glucoamylase is disclosed in SEQ ID NO: 13 (WO 00/04136).
  • Another AMG backbone contemplated is Talaromyces emersonii, especially Talaromyces emersonii DSM disclosed in WO 99/28448 (Novo Nordisk).
  • the homology referred to above of the parent glucoamylase is determined as the degree of identity between two protein sequences indicating a derivation of the first sequence from the second.
  • the homology may suitably be determined by means of computer programs known in the art such as GAP provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wis., USA 53711) (Needleman, S. B. and Wunsch, C. D., (1970), Journal of Molecular Biology, 48, p. 443-453).
  • the mature part of a polypeptide encoded by an analogous DNA sequence of the invention exhibits a degree of identity preferably of at least 60%, such as 70%, at least 80%, at least 90%, more preferably at least 95%, more preferably at least 97%, and most preferably at least 99% with the mature part of the amino acid sequence shown in SEQ ID NO: 2 (WO 00/04136).
  • the parent glucoamylase comprise the amino acid sequences of SEQ ID NO: 2(WO 00/04136); or allelic variants thereof; or fragments thereof that has glucoamylase activity.
  • a fragment of SEQ ID NO: 2 is a polypeptide which have one or more amino acids deleted from the amino and/or carboxyl terminus of this amino acid sequence.
  • the AMG G2 (SEQ ID NO: 2) is a fragment of the Aspergillus niger G1 glucoamylase (Boel et al. (1984), EMBO J. 3 (5), p. 1097-1102) having glucoamylase activity.
  • An allelic variant denotes any of two or more alternative forms of a gene occupying the same chromosomal locus. Allelic variation arises naturally through mutation, and may result in polymorphism within populations. Gene mutations can be silent (no change in the encoded polypeptide) or may encode polypeptides having altered amino acid sequences.
  • An allelic variant of a polypeptide is a polypeptide encoded by an allelic variant of a gene.
  • carbohydrase variants are contemplated as the parent enzyme.
  • carbohydrases The activity of carbohydrases can be determined as described in “Methods of Enzymatic Analysis”, third edition, 1984, Verlag Chemie, Weinheim, vol. 4.
  • Parent transferases i.e. enzymes classified under the Enzyme Classification number E.C. 2 in accordance with the Recommendations (1992) of the International Union of Biochemistry and Molecular Biology (IUBMB)
  • IUBMB International Union of Biochemistry and Molecular Biology
  • the parent transferases may be any transferase in the subgroups of transferases: transferases transferring one-carbon groups (E.C. 2.1); transferases transferring aldehyde or residues (E.C 2.2); acyltransferases (E.C. 2.3); glucosyltransferases (E.C. 2.4); transferases transferring alkyl or aryl groups, other that methyl groups (E.C. 2.5); transferases transferring nitrogeneous groups (2.6).
  • the parent transferase is a transglutaminase E.C 2.3.2.13 (Protein-glutamine ⁇ -glutamyltransferase).
  • Transglutaminases are enzymes capable of catalyzing an acyl transfer reaction in which a gamma-carboxyamide group of a peptide-bound glutamine residue is the acyl donor.
  • Primary amino groups in a variety of compounds may function as acyl acceptors with the subsequent formation of monosubstituted gamma-amides of peptide-bound glutamic acid.
  • the transferases form intramolecular or intermolecular gamma-glutamyl-epsilon-lysyl crosslinks.
  • transglutaminases are described in the pending DK patent application no. 990/94 (Novo Nordisk ANS).
  • the parent transglutaminase may be of human, animal (e.g. bovine) or microbial origin.
  • transglutaminases animal derived Transglutaminase, FXIIIa; microbial transglutaminases derived from Physarum polycephalum (Klein et al., Journal of Bacteriology, Vol. 174, p.
  • transglutaminases derived from Streptomyces sp. including Streptomyces lavendulae, Streptomyces lydicus (former Streptomyces libani ) and Streptoverticillium sp., including Streptoverticillium mobaraense, Streptoverticillium cinnamoneum, and Streptoverticillium griseocarneum (Motoki et al., U.S. Pat. No. 5,156,956; Andou et al., U.S. Pat. No. 5,252,469; Kaempfer et al., Journal of General Microbiology, Vol. 137, p.
  • transglutaminases The activity of transglutaminases can be determined as described in “Methods of Enzymatic Analysis”, third edition, 1984, Verlag Chemie, Weinheim, vol. 1-10.
  • Phytases are enzymes produced by microorganisms which catalyse the conversion of phytate to inositol and inorganic phosphorus
  • Phytase producing microorganisms comprise bacteria such as Bacillus subtilis, Bacillus natto and Pseudomonas; yeasts such as Saccharomyces cerevisiae; and fungi such as Aspergillus niger, Aspergillus ficuum, Aspergillus awamori, Aspergillus oryzae, Aspergillus terreus or Aspergillus nidulans, and various other Aspergillus species).
  • bacteria such as Bacillus subtilis, Bacillus natto and Pseudomonas
  • yeasts such as Saccharomyces cerevisiae
  • fungi such as Aspergillus niger, Aspergillus ficuum, Aspergillus awamori, Aspergillus oryzae, Aspergillus terreus or Aspergillus nidulans, and various other Aspergillus species).
  • parent phytases examples include phytases selected from those classified under the Enzyme Classification (E.C.) numbers: 3-phytase (3.1.3.8) and 6-phytase (3.1.3.26).
  • the activity of phytases can be determined as described in “Methods of Enzymatic Analysis”, third edition, 1984, Verlag Chemie, Weinheim, vol. 1-10, or may be measured according to the method described in EP-A1-0 420 358, Example 2 A.
  • Suitable lyases include Polysaccharide lyases: Pectate lyases (4.2.2.2) and pectin lyases (4.2.2.10), such as those from Bacillus licheniformis disclosed in WO 99/27083.
  • suitable protein disulfide isomerases include PDls described in WO 95/01425 (Novo Nordisk A/S) and suitable glucose isomerases include those described in Biotechnology Letter, Vol. 20, No 6, June 1998, pp. 553-56.
  • Contemplated isomerases include xylose/glucose Isomerase (5.3.1.5) including Sweetzyme®.
  • the environmental allergens that are of interest for epitope mapping include allergens from pollen, dust mites, mammals, venoms, fungi, food items, and other plants.
  • allergens include but are not limited to those of the order Fagales, Oleales, Pinales, Poales, Asterales, and Urticales; including those from Betula, Alnus, Corylus, Carpinus, Olea, Phleum pratense and Artemisia vulgaris, such as Aln g1, Cor a1, Car b1, Cry j1, Amb a1 and a2, Art v1, Par j1, Ole e1, Ave v1, and Bet v1 (WO 99/47680).
  • Mite allergens include but are not limited to those from Derm. farinae and Derm. pteronys., such as Der f1 and f2, and Der p1 and p2.
  • relevant environmental allergens include but are not limited to those from cat, dog, and horse as well as from dandruff from the hair of those animals, such as Fel d1; Can f1; Equ c1; Equ c2; Equ c3.
  • Venum allergens include but are not limited to PLA2 from bee venom as well as Apis m1 and m2, Ves g1, g2 and g5, Ves v5 and te Pol and Sol allergens.
  • Fungal allergens include those from Alternaria alt. and Cladospo. herb. such as Alt a1 and Cla h1.
  • Food allergens include but are not limited to those from milk (lactoglobulin), egg (ovalbumin), peanuts, hazelnuts, wheat (alpha-amylase inhibitor),
  • plant allergens include latex (hevea brasiliensis).
  • proteins of interest for expression in transgenic plants could be useful objects for epitope engineering. If for instance a heterologous enzyme is introduced into a transgenic plant e.g. to increase the nutritional value of food or feed derived from that plant, that enzyme may lead to allergenicity problems in humans or animals ingesting the plant-derived material. Epitope mapping and engineering of such heterologous enzymes or other proteins of transgenic plants may lead to reduction or elimination of this problem. Hence, the methods of this patent are also useful for potentially modifying proteins for heterologous expression in plants and plant cells.
  • OPD o-phenylene-diamine
  • the implementation consists of 3 pieces of code:
  • the wrapper receives the input and calls the core program and several other utilities. Apart from the standard Unix utility programs (mv, rm, awk, etc..) the following must be installed:
  • KAAKD SEQ ID NO: 41
  • KLASD SEQ ID NO: 42
  • KLYSD SEQ ID NO: 43
  • KLY-D SEQ ID NO: 44
  • R-M-D R-M-D.
  • the “core” of the program is the algorithm that scans the protein surface for the epitope patterns.
  • the principle is that several “trees” are built, where each of their branches describes one epitope:
  • the core program accepts only one structure and one epitope consensus sequence. It is usually desirable to use a library of epitope consensus sequences and sometimes several protein structures.
  • the wrapper reads the user input and calls the utility programs and the core program the necessary number of times. The output is collected and presented on the web page returned to the user.
  • wrapper works in different modes:
  • the epitope library consists of a number of text files, each containing one epitope consensus sequence as specified above.
  • the layout of the wrapper is like this:
  • I intratracheal immunisations were performed weekly with 0.100 ml 0.9% (wt/vol) NaCl (control group), or 0.100 ml of a protein dilution ( ⁇ 0.1 ⁇ 1 mg/ml). Each group contained 10 rats. Blood samples (2 ml) were collected from the eye one week after every second immunisation. Serum was obtained by blood clothing and centrifugation and analysed as indicated below.
  • SC immunisations Twenty subcutaneous (SC) immunisations were performed weekly with 0.05 ml 0.9% (wt/vol) NaCl (control group), or 0,050 ml of a protein dilution ( ⁇ 0.01 ⁇ 0.1 mg/ml). Each group contained 10 female Balb/C mice (about 20 grams) purchased from Bomholdtgaard, Ry, Denmark. Blood samples (0.100 ml) were collected from the eye one week after every second immunisation. Serum was obtained by blood clothing and centrifugation and analysed as indicated below.
  • IgG1 and IgE levels were determined using the ELISA specific for mouse or rat IgG1 or IgE. Differences between data sets were analysed by using appropriate statistical methods.
  • a fresh stock solution of cyanuric chloride in acetone (10 mg/ml) is diluted into PBS, while stirring, to a final concentration of 1 mg/ml and immediately aliquoted into CovaLink NH2 plates (100 microliter per well) and incubated for 5 minutes at room temperature. After three washes with PBS, the plates are dryed at 50° C. for 30 minutes, sealed with sealing tape, and stored in plastic bags at room temperature for up to 3 weeks.
  • Mouse anti-Rat IgE was diluted 200 ⁇ in PBS (5 microgram/ml). 100 microliter was added to each well. The plates were coated overnight at 4° C.
  • Unknown rat sera and a known rat IgE solution were diluted in dilution buffer: Typically 10 ⁇ , 20 ⁇ and 40 ⁇ for the unknown sera, and 1 ⁇ 2 dilutions for the standard IgE starting from 1 ⁇ g/ml. 100 microliter was added to each well. Incubation was for 1 hour at room temperature.
  • Unbound material was removed by washing 3 ⁇ with washing buffer.
  • the anti-rat IgE (biotin) was diluted 2000 ⁇ in dilution buffer. 100 microliter was added to each well. Incubation was for 1 hour at room temperature. Unbound material was removed by washing 3 ⁇ with washing buffer.
  • Streptavidin was diluted 1000 ⁇ in dilution buffer. 100 microliter was added to each well. Incubation was for 1 hour at room temperature. Unbound material was removed by washing 3 ⁇ with 300 microliter washing buffer. OPD (0.6 mg/ml) and H 2 O 2 (0.4 microliter/ml) were dissolved in citrate buffer. 100 microliter was added to each well. Incubation was for 30 minutes at room temperature. The reaction was stopped by addition of 100 microliter H 2 SO 4 . The plates were read at 492 nm with 620 nm as reference.
  • the relative IgE binding capacity (end-point and/or affinity) of the protein variants relative to that of the parent protein are determined from the dilution-response curves.
  • the IgE-positive serum can be of other animals (including humans that inadvertently have been senstitized to the parent protein) provided that the species-specific anti-IgE capture antibodies are changed accordingly.
  • C-ELISA Competitive ELISA
  • C-ELISA was performed according to established procedures. In short, a 96 well ELISA plate was coated with the parent protein. After proper blocking and washing, the coated antigen was incubated with rabbit anti-enzyme polyclonal antiserum in the presence of various amounts of modified protein (the competitior). The residual amount of rabbit antiserum was detected by horseraddish peroxidase-labelled pig anti-rabbit immunoglobulin.
  • the degree of homology may be suitably determined by means of computer programs known in the art, such as GAP provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wis., USA 53711) (Needleman, S. B. and Wunsch, C. D., (1970), Journal of Molecular Biology, 48, 443-45).
  • subtilisin protease sequences are defined by alignment with Subtilisin Novo (BPN′) from B. amyloliquefaciens, as shown in Table 1A for Alcalase, Protease B, Esperase, Protease C, Protease D, Protease E, Protease A, PD498, Properase, Relase, Savinase.
  • BPN′ Subtilisin Novo
  • the sequence of interest is aligned to the sequence of BPN′ as shown in Table 1B for YaB protease and Subtilisin sendai.
  • the new sequence is aligned to the BPN′ sequence by using the GAP alignment to the most homologous sequence found by the GAP program.
  • GAP is provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wis., USA 53711) (Needleman, S. B. and Wunsch, C. D., (1970), Journal of Molecular Biology, 48, 443-45).
  • the sequence of the YaB protease is disclosed by Kaneko, R.; Koyama, N.; Tsai,Y. -C.; Juang,R. -Y.; Yoda, K.; Yamasaki, M.; Molecular cloning of the structural gene for alkaline elastase YaB, a new subtilisin produced by an alkalophilic Bacillus strain. J. Bacteriol. 171:5232 (1989), it has Swissprot number P20724, and is shown in SEQ ID NO: 35.
  • Subtilisin sendai The sequence of the Subtilisin sendai is disclosed by Yamagata, Y.; Isshiki, K.; lchishima, E.; Subtilisin Sendai from alkalophilic Bacillus sp.: molecular and enzymatic properties of the enzyme and molecular cloning and characterization of the gene, aprS. Enzyme Microb. Technol. 17:653 (1995), it has SPTREMBL accession number Q45522, and is shown in SEQ ID NO: 34.
  • subtilisin sequences and positions mentioned in the present invention are given in the BPN′ numeration, and can be converted by alignement as described above (Tables 1A and 1B).
  • the protein structure of PD498 is disclosed in WO 98/35026 (Novo Nordisk).
  • the structure of Savinase can be found in BETZEL et al, J. MOL. BIOL., Vol. 223, p. 427, 1992 (1svn.pdb).
  • T. lanuginosus lipase (trade name Lipolase) is provided in SEQ ID NO: 1 and the structure is disclosed in WO 98/35026 and as “1tib”, available in Structural Classification of Proteins (SCOP) on the Internet.
  • amylase used in the examples is the alpha-amylase of Bacillus halmapalus (WO 96/23873), which is called amylase SP722 (the wild-type). Its sequence is shown in SEQ ID NO: 2 and the corresponding protein structure was built from the BA2 structure, as described in WO 96/23874. The first four amino acids of the structural model are not defined, hence the sequence used for numeration of amino acid residues in the examples of this invention is four amino acids shorter than the one of the full length protein SP722.
  • amylase AA560 This alkaline alpha-amylase may be derived from a strain of Bacillus sp. DSM 12649. The strain was deposited on 25th Jan. 1999 by the assignee under the terms of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at Deutshe Sammmlung von Microorganismen und Zellkulturen GmbH (DSMZ), Mascheroder Weg 1b, D-38124 Braunschweig DE.
  • DSMZ Sammmlung von Microorganismen und Zellkulturen GmbH
  • the laccase used in this invention is that from Coprinus cinereus (WO 98/38287), the sequence of which is shown as SEQ ID NO: 3.
  • the structure of the Myceliophthora thermophila laccase can be built by homology modeling to the Coprinus cinereus laccase as shown in WO 98/38287.
  • the cellulase sequence and structure used in the present invention is that of the core fragment of endoglucanase V from Humicola insolens (aka Cel45 or Carezyme).
  • the core fragment structure is available as 3eng.pdb (G. J.DAVIES et al. ACTA CRYSTALLOGR.,SECT.D, Vol. 52, p. 7 1996; G. J.DAVIES et al. BIOCHEMISTRY, V. 34, p. 16210, 1995); SwissProt accession number P43316, and the sequences shown in SEQ ID 4.
  • the corresponding full-length sequence is disclosed in WO 91/17243 and shown here in SEQ ID NO: 5.
  • the phage libraries were obtained according to prior art (se WO 9215679 hereby incorporated by reference).
  • the antibodies were raised in the respective animals by subcutaneous, intradermal, or intratracheal injection of relevant proteins (e.g. proteases, lipolytic enzymes, amylases, oxidoreductases) dissolved in phosphate buffered saline (PBS).
  • relevant proteins e.g. proteases, lipolytic enzymes, amylases, oxidoreductases
  • PBS phosphate buffered saline
  • the respective antibodies were purified from the serum of immunised animals by affinity chromatography using paramagnetic immunobeads (Dynal AS) loaded with pig anti-rabbit lgG, mouse anti-rat IgG1 or IgE, or rat anti-mouse IgGl or IgE antibodies.
  • the respective phage libraries were incubated with the IgG, IgG1 and IgE antibody coated beads.
  • Phages, which express oligopeptides with affinity for rabbit IgG, or rat or mouse IgG1 or IgE antibodies, were collected by exposing these paramagnetic beads to a magnetic field. The collected phages were eluted from the immobilised antibodies by mild acid treatment, or by elution with intact enzyme. The isolated phages were amplified as know to the specialist. Alternatively, immobilised phages were directly incubated with E. coli for infection. In short, F-factor positive E. coli (e.g.
  • XL-1 Blue, JM101, TG1 were infected with M13-derived vector in the presence of a helper-phage (e.g. M13K07), and incubated, typically in 2 ⁇ YT containing glucose or IPTG, and appropriate antibiotics for selection. Finally, cells were removed by centrifugation. This cycle of events was repeated 2-5 times on the respective cell supernatants. After selection round 2, 3, 4, and 5, a fraction of the infected E. coli was incubated on selective 2 ⁇ YT agar plates, and the specificity of the emerging phages was assessed immunologically. Thus, phages were transferred to a nitrocellulase (NC) membrane. For each plate, 2 NC-replicas were made.
  • NC nitrocellulase
  • One replica was incubated with the selection antibodies, the other replica was incubated with the selection antibodies and the immunogen used to obtain the antibodies as competitor. Those plaques that were absent in the presence of immunogen, were considered specific, and were amplified according to the procedure described above.
  • the specific phage-clones were isolated from the cell supernatant by centrifugation in the presence of polyethylenglycol. DNA was isolated, the DNA sequence coding for the oligopeptide was amplified by PCR, and the DNA sequence was determined, all according to standard procedures. The amino acid sequence of the corresponding oligopeptide was deduced from the DNA sequence.
  • sequences with specificity for the protein specific antibodies were obtained. These sequences were collected in a database, and analysed by sequence alignment to identify epitope patterns. For this sequence alignment, conservative substitutions (e.g. aspartate for glutamate, lysine for arginine, serine for threonine) were considered as one. This showed that most sequences were specific for the protein the antibodies were raised against. However, several cross-reacting sequences were obtained from phages that went through 2 selection rounds only. In the first round 22 epitope patterns were identified.
  • conservative substitutions e.g. aspartate for glutamate, lysine for arginine, serine for threonine
  • a first generation database of antibody binding peptides identified and their corresponding epitope patterns are shown in Table 2-7 below.
  • Tables 2-7 Overview of the antibody binding peptide sequences, epitope patterns and epitope sequences.
  • the type of antibody used for identifying the antibody binding sequences is indicated as IgG or IgE and the species from which the antibodies were derived are indicated as mo (mouse), ra (rat) and hu (human).
  • Epitope sequences were assessed manually on the screen on the 3D-structure of the protein of interest, using apropriate software (e.g. SwissProt Pdb Viewer, WebLite Viewer).
  • apropriate software e.g. SwissProt Pdb Viewer, WebLite Viewer.
  • the identified epitope patterns were fitted with the 3D-structure of the enzymes.
  • a sequence of at least 3 amino acids, defining a specific epitope pattern was localised on the 3D-structure of the acceptor protein.
  • Conservative mutations e.g. aspartate for glutamate, lysine for arginine, serine for threonine
  • those patterns for which phage display had evidenced such exchanges to occur were considered as one for those patterns for which phage display had evidenced such exchanges to occur.
  • the possible sequences provided by the protein structure only those were retained where the sequence matched a primary sequence, or where it matched a structural sequence of amino acids, where each amino acid was situated within a distance of 5 ⁇ from the next one.
  • the mobility of the amino acid side chains, as provided by the software programme had to be taken in to consideration for this criterium to be fulfilled.
  • the remaining anchor amino acids as well as the variable amino acids i.e. amino acids that were not defining a pattern but were present in the individual sequences identified by phage library screening, were assessed in the area around the various amino acid sequences localised in step 1. Only amino acids situated within a distance of 5 ⁇ from the next one were included.
  • the criterium was that at least half of the anchor amino acids had a surface that was >30% accessible. Typically, 0-2 epitopes were retained for each epitope pattern. In some cases, two different amino acids could with equal probability be part of the epitope (e.g. two leucines located close to each other in the protein 3D-structure). For example, in Savinase two epitopes actually fit to the antibody binding peptide LDQIFFTRW (SEQ ID NO:62): L75 D41 Q2 179 and L42 D41 Q2 179. A shorthand notation for such a situation is: L42/L75 D41 Q2 179.
  • epitope sequences were identified and localised on the surface of various proteins. As suggested by sequence alignment of the antibody binding peptides, structural analysis confirmed most of the epitopes to be enzyme specific, with only few exceptions. Overall, most of the identified epitopes were at least partially structural. However, some proteins (e.g. amylase) expressed predominantly primary sequence epitopes. Typically, the epitopes were localised in very discrete areas of the enzymes, and different epitope sequences often shared some amino acids (hot-spots).
  • the identified epitope sequences are shown in Tables 2-7.
  • Bet v1 (WO 99/47680) was used as the parent protein for identification of epitope sequences that may cross react with enzyme epitopes.
  • the structural coordinates from 1BV1.pdb (Gajhede et al., NAT.STRUCT.BIOL., Vol. 3, p. 1040, 1996) were used as well the corresponding sequence (Swissprot accession number P15494).
  • the epitope pattern P>PAP>S (which had been identified from antibody binding peptides specific for anti-Lipolase antibodies) was found to match three (overlapping) epitope sequences on the surface of Bet v1: Bet v1 1.1: P31 A34 P35 A37 P59 S39/S40; Bet v1 1.2: P63 L62 P59 A37 P35 S39/S40; and Bet v1 1.3: P59 S39/S40 P31 A34 P35 S39/S40.
  • epitope sequences e.g. >DF>>K>
  • epitope patterns e.g. >DF>>K>
  • the anchor amino acid residues are transferred to a three dimensional structure of the protein of interest, by colouring D red, F white and K blue. Any surface area having all three residues within a distance of 18 ⁇ , preferably 15 ⁇ , more preferably 12 ⁇ , is then claimed to be an epitope.
  • the relevant distance can easily be measured using e.g. molecular graphics programs like InsightII from Molecular Simulations Inc.
  • the residues in question should be surface exposed, meaning that the residue should be more than 20% surface exposed, preferably more than 50% surface exposed, more preferably 70% surface exposed.
  • the percentage “surface accessible area” of an amino acid residue of the parent protein is defined as the Connolly surface (ACC value) measured using the DSSP program to the relevant protein part of the structure, divided by the residue total surface area and multiplied by 100.
  • the DSSP program is disclosed in W. Kabsch and C. Sander, BIOPOLYMERS 22 (1983) pp. 2577-2637.
  • the residue total surface areas of the 20 natural amino acids are tabulated in Thomas E. Creighton, PROTEINS; Structure and Molecular Principles, W. H. Freeman and Company, N.Y., ISBN: 0-7167-1566-X (1984).
  • Substitutions of one or more residue (s) within 18 ⁇ , prefereably 15 ⁇ , more prefereably 12 ⁇ , around the geometrical center of the residues involved in the epitope, for a bigger or smaller residues, may destroy the epitope, and make the protein less antigenic.
  • Residues involved in epitope is 2, preferably 3 and more prefereably 4
  • Epitope sequences and hot-spots amino acids were mutated using standard techniques know to the person skilled in the field (e.g. site-directed mutagenesis, error-prone PCR—see for example Sambrook et al. (1989), Molecular Cloning. A Laboratory Manual, Cold Spring Harbour, N.Y.).
  • variants were made by site-directed mutagenesis. Amino acid exchanges giving new epitopes or duplicating existing epitopes, according to the information collected in the epitope-database (See Example 1), were avoided in the mutagenesis process.
  • Enzyme variants were screened for reduced binding of antibodies raised against the backbone enzyme. Antibody binding was assessed by competitive ELISA as described in the Methods section.
  • Hot-spots or epitopes were mutated using techniques known to the expert in the field (e.g. site-directed mutagenesis, error-prone PCR).
  • variants were made by site-directed mutagenesis. Amino acid exchanges giving new epitopes or duplicating existing epitopes according to the information collected in the epitope-database, were avoided in the mutagenesis process. Enzyme variants were screened for reduced binding of antibodies raised against the backbone enzyme. This antibody binding was assessed by established assays (e.g. competitive ELISA, agglutination assay).
  • mice were immunised subcutanuous weekly, for a period of 20 weeks, with 50 microliters 0.9% (wt/vol) NaCl (control group), or 50 microliters 0.9% (wt/vol) NaCl containing 10 micrograms of protein.
  • Blood samples 100 microliters were collected from the eye one week after every second immunization. Serum was obtained by blood clothing, and centrifugation.
  • IgG1 and IgE levels were determined using the ELISA specific for mouse or rat IgG1 or IgE. Differences between data sets were analysed by using appropriate statistical methods.
  • the variant carried the mutation R170F.
  • this variant was less effective in competing for anti-savinase antibodies, giving a 15% lower endpoint inhibition as compared to the savinase backbone.
  • the variant carried the mutation S216W.
  • the variant was less effective in competing for Lipolase antibodies, giving a 38% decrease in endpoint inhibition as compared to the enzyme backbone.
  • the variant carried the mutation E136R.
  • the variants was less effective in competing for savinase antibodies, giving a 38% decrease in endpoint inhibition as compared to the savinase backbone.
  • Mutation E136R establishes an IgG1 epitope of the R Y P R/K pattern, previously identified on PD498. Apparently, this new epitope was more antigenic in mice than the existing epitope. The introduction of a savinase unrelated epitope on the savinase backbone could explain the observed discrepancy between competitive ELISA and animal studies.
  • Epitope A172/A169 R170 A194 G193 N261 Pattern: A R>R>A>N
  • Backbone Savinase Epitope area: P131, S132, A133, L135, E136, V139, A151, A152, S153, G161, S162, I165, S166, Y167, P168, Y171, N173, A174, A176, Q191, Y192, G195, L196, R247, S259, T260, L262, Y263, G264.
  • the variant was different at position Y167 by the mutation Y1671.
  • the variant was less effective in competing for anti-savinase antibodies, giving a 8% lower endpoint inhibition as compared to the its backbone.
  • variant no. 1 was mutated at the epitope position (N140D)
  • variant no. 2 was mutated at N140 (N140D), but also at the epitope area position (A172D).
  • variant no. 1 was less effective in competing for anti-savinase antibodies, as compared to savinase.
  • This variant revealed a 21% lower endpoint inhibition as compared to the its backbone.
  • Variant no. 2 resulted in an endpoint inhibition that was 60% lower as compared to savinase, and 40% as compared to variant no. 1.
  • the derivatives was purified and reagent excess removed by size exclusion chromatography on a Superdex-75 column (Pharmacia) equilibrated in 50 mM Sodium Borate, 5 mM Succinic Acid, 150 mM NaCl, 1 mM CaCl 2 pH 6.0.
  • the conjugate was stored at ⁇ 20° C., in the above described buffer.
  • the amounts of residual rabbit antiserum was detected by pig anti-rabbit immunoglobulin, horseraddish peroxidase labelled.
  • epitope sequences were determined in four environmental allergens (Bet v1; Der f2; Der p2 and PhI p2), based on their structures (1btv.pdb; 1ahm.pdb; a19v.pdb; and 1whp.pdb, respectively), sequences (SEQ ID NOS: 6, 7, 8 and 9, respectively) and computer modelling of the epitope patterns that had been assembled in our database (shown in Table 8).
  • the allergens arise from common sources of allergy: Birch (Bet v1 from Betula pendula ), House dust mites (Der f2 from Dermatophagoides farinae and Der p2 from Dermatophagoides pteronyssinus ), and Timothy grass (Phl p2 from Phleum pratense ).
  • the protein surface is scanned for epitope patterns matching the given “consensus” sequence of about 6-12 residues. First, residues on the protein surface that match the first residue of the consensus sequence are identified. Within a specified distance from each of these, residues on the protein surface that match the next residue of the consensus sequence are identified. This procedure is repeated for the remaining residues of the consensus sequence. The method is further described under the paragraph “Methods” above and the computer program can be found in the Appendixes.
  • epitopes are identified.
  • the epitopes are sorted according to total surface accessible area, and certain entries removed:
  • Each row indicates an epitope pattern.
  • the cells indicate which amino acids (single letter coding) are allowed at that position.
  • the last column indicates the patterns identified using IgE antibody binding.
  • the third-generation epitope sequences were determined in further 11 environmental allergens (Bosd2, Equc1, Gald4-mutant (with alanine substituted for glycine in position 102), Hevb8, Profillin1-AC, Profillin1-AT, Profillin2-AC, Profillin-birch pollen, Rag weed pollen5 and Vesv5), based on their structures sequences (SEQ ID NOS: 12, 13, 15, 16, 17, 18, 19, 20, 21 and 22, respectively), their structures (1bj7.pdb, 1ew3.pdb, 1flu.pdb, 1g5u.pdb, 1prq.pdb, 1a0k.pdb, 1f2k.pdb, 1cqa.pdb, 1bbg.pdb, and 1qnx.pdb, respectively), and computer modelling of the epitope patterns that had been assembled in our database (shown in Table 8). Further, the epitope sequences of the four environmental allergens (
  • the additional allergens arise from common sources of allergy: cows (Bos d2 which is a bovine member of the lipocalin family of allergens), horses (Equ C 1, a major horse allergen aslo of the lipocalin family), Hen egg white (Lysozyme Gal D 4), Latex (Hev b8, a profilin from Hevea Brasiliensis), Acanthamoeba castellani (Profilin1-AC, a profilin isoform IA and Profilin2-AC, a profilin isoform II), Arabidosis thaliana (Profillin1-AT a cytoskeleton profilin), Birch (Profilin-birch pollen (Birch pollen profilin), Rag weed pollen5 (Ragweed pollen allergen V from Ambrosia trifida ) and whasp venom (Ves v5 allergen from Vespula vulgaris venom).
  • cows Bos d2 which is
  • the protein surface is scanned for epitope patterns matching the given “consensus” sequence of about 6-12 residues. First, residues on the protein surface that match the first residue of the consensus sequence are identified. Within a specified distance from each of these, residues on the protein surface that match the next residue of the consensus sequence are identified. This procedure is repeated for the remaining residues of the consensus sequence. The method is further described under the paragraph “Methods” above and the program can be found in Appendixes.
  • epitopes are identified.
  • the epitopes are sorted according to total surface accessible area, and certain entries removed:
  • “Size” is the total suface area of the epitope in ⁇ 2.
  • Derf2 Epi#02 A98, K100, S101, P99, R128, R31 A98, K100, R128, P99, R31, V94 T91, N93, P95, P34, R31, R128 L61, N93, P95, P34, R31, R128 Epi#03 L40, K15, A39, I13, Y86 L40, K14, A39, I88, Y90 Epi#05 G32, A98, R31, P34, G20, T36, T91, Y90 G32, A98, R31, P34, G20, T36, T91, V94 G32, A98, R31, P34, G20, T36, T91, V94 G32, A98, R31, P34, G20, T36, T91, L37 G32, A98, R31, P34, G20, T36, T91, V18 Epi#06 A98
  • a third-generation epitope sequences were determined for some additional enzymes and redetermined for all of the enzymes in example 1-3.
  • New enzymes are AMG (AMG pdb), BPN′ (1sup.pdb), Esperase (structure see Appendix D), Natalase (structure modelling based on SP722), Amylase-AA560 (Structure modelling based on SP722), Protease A, Alcalase, Protease B, ProteaseC, ProteaseD, ProteaseE, Properase and Relase based on their sequences and structures.
  • Protease B Properase, Relase, Protease A, Alcalase, ProteaseC, ProteaseD and ProteaseE
  • Homology modelling see above
  • computer modelling computer modelling of the epiope patterns that had been assembled in our database (shown in Table 8).
  • Furhermore, the epitope sequences were redetermined for CAREZYME, Laccase, PD498, Savinase, Amylase SP722, and Cellulase, according to the method.
  • the protein surface is scanned for epitope patterns matching the given “consensus” sequence of about 6-12 residues. First, residues on the protein surface that match the first residue of the consensus sequence are identified. Within a specified distance from each of these, residues on the protein surface that match the next residue of the consensus sequence are identified. This procedure is repeated for the remaining residues of the consensus sequence. The method is further described under the paragraph “Methods” above and the program can be found in Appendixes.
  • epitopes are identified.
  • the epitopes are sorted according to total surface accessible area, and certain entries removed:
  • subtilisin sequences and positions mentioned in the following are not given in the BPN′ numeration but in the subtilisins own numeration (see the alignement as described above in Tables 1A and 1B).
  • AMG Epi#01 L104, P123, P107, R125, R122, N182, S184, Q172, T173 L104, P107, P123, R125, R122, N182, S184, Q172, S453 L104, P107, P123, R125, R122, N182, S184, Q172, S453 L104, P107, P123, R125, R122, N182, S184, Q172, T452 Epi#02 L234, R241, S240, F237, T173, Y175, R122, R125 L234, R241, S240, F237, T173, Y169, R125, R122 L234, R241, S240, F237, T173, Y175, R125, R54 Epi#03 L291, K404, I288, Y289 L66, K61, H254, I253, Y329 Epi#04 R122, Y175, S184, Q172, Y169, A454, I455 R122, Y
  • the object of this example is to provide evidence showing that subtilisins with an homology to BPN′ of as low as 44,8% reveal a similar epitope distribution as BPN′.
  • Alcalase, Protease B, Savinase, Esperase, and PD498 (which range from 44.8% to 69.5% in sequence identity to BPN′) were epitope mapped as described in the above example, and compared with epitope mapped BPN′ ( FIG. 1 ).
  • FIG. 1 show a significant overlap between the areas on the primary structure of the respective proteases. Overall, 6 regions were identified: 1-20, 35-65, 95-115, 130-145, 170-220, and 260-270.
  • pH is adjusted to 10.5 which is within the normal range for a powder detergent.
  • Measurement of reflectance (R) on the test material was done at 460 nm using a Macbeth ColorEye 7000 photometer. The measurements were done according to the manufacturers protocol.
  • the variants all have improved wash performance compared to Savinase®—i.e. P>1.
  • Improvement class Variants C I44V, Q12D
  • SAVINASE® variants of the invention exhibits an improvement in wash performance.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Immunology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Food Science & Technology (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • General Chemical & Material Sciences (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Analytical Chemistry (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Detergent Compositions (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Chemical Or Physical Treatment Of Fibers (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Immobilizing And Processing Of Enzymes And Microorganisms (AREA)

Abstract

The present invention relates to a method of selecting a protein variant having modified immunogenicity as compared to the parent protein comprising the steps obtaining antibody binding peptide sequences, using the sequences to localise epitope sequences on the 3-dimensional structure of parent protein, defining an epitope area including amino acids situated within 5 Å from the epitope amino acids constituting the epitope sequence, changing one or more of the amino acids defining the epitope area of the parent protein by genetical engineering mutations of a DNA sequence encoding the parent protein, introducing the mutated DNA sequence into a suitable host, culturing said host and expressing the protein variant, and evaluating the immunogenicity of the protein variant using the parent protein as reference. The invention further relates to the protein variant and use thereof, as well as to a method for producing said protein variant.

Description

    CROSS-REFERENCE TO RELATED APPLICATIONS
  • This application is a 35 U.S.C. 371 national application of PCT/DK01/00293 filed Apr. 30, 2001 and claims, under 35 U.S.C. 119, priority or the benefit of Danish application nos. PA 2000 00707 and PA 2001 00327 filed Apr. 28, 2000 and Feb. 28, 2001, respectively, and U.S. application Ser. Nos. 60/203,345 and 60/277,817 filed May 10, 2000 and Mar. 21, 2001, respectively, the contents of which are fully incorporated herein by reference.
  • FIELD OF INVENTION
  • The present invention relates to a method of selecting a protein variant having modified immunogenicity as compared to the parent protein, to the protein variant and use thereof, as well as to a method for producing said protein variant.
  • BACKGROUND OF THE INVENTION
  • An increasing number of proteins, including enzymes, are being produced industrially, for use in various industries, housekeeping and medicine. Being proteins they are likely to stimulate an immunological response in man and animals, including an allergic response.
  • Depending on the application, individuals get sensitised to the respective allergens by inhalation, direct contact with skin and eyes, or injection. The general mechanism behind an allergic response is divided in a sensitisation phase and a symptomatic phase. The sensitisation phase involves a first exposure of an individual to an allergen. This event activates specific T- and B-lymphocytes, and leads to the production of allergen specific IgE antibodies (in the present context the antibodies are denoted as usual, i.e. immunoglobulin E is IgE etc.). These IgE antibodies eventually facilitate allergen capturing and presentation to T-lymphocytes at the onset of the symptomatic phase. This phase is initiated by a second exposure to the same or a resembling antigen. The specific IgE antibodies bind to the specific IgE receptors on mast cells and basophils, among others, and capture at the same time the allergen. The polyclonal nature of this process results in bridging and clustering of the IgE receptors, and subsequently in the activation of mast cells and basophils. This activation triggers the release of various chemical mediators involved in the early as well as late phase reactions of the symptomatic phase of allergy. Prevention of allergy in susceptible individuals is therefore a research area of great importance.
  • For certain forms of IgE-mediated allergies, a therapy exists, which comprises repeated administration of allergen preparations called ‘allergen vaccines’ (Int. Arch. Allergy Immunol., 1999, vol. 119, pp1-5). This leads to reduction of the allergic symptoms, possibly due to a redirection of the immune response away from the allergic (Th2) pathway and towards the immunoprotective (Th1) pathway (Int. Arch. Allergy Immunol., 1999, vol. 119, pp1-5).
  • Various attempts to reduce the immunogenicity of polypeptides and proteins have been conducted. It has been found that small changes in an epitope may affect the binding to an antibody. This may result in a reduced importance of such an epitope, maybe converting it from a high affinity to a low affinity epitope, or maybe even result in epitope loss, i.e. that the epitope cannot sufficiently bind an antibody to elicit an immunogenic response.
  • There is a need for methods to identify epitopes on proteins and alter these epitopes in order to modify the immunogenicity of proteins in a targeted manner. Such methods and kits for their execution can have at least four useful purposes:
  • 1) reduce the allergenicity of a commercial protein using protein engineering.
  • 2) reduce the potential of commercial proteins to cross-react with environmental allergens and hence cause allergic reactions in people sensitized to the environmental allergens (or vice versa).
  • 3) improve the immunotherapeutic effect of allergen vaccines.
  • 4) assist characterization of clinical allergies in order to select the appropriate treatment, including allergen vaccination.
  • In WO 99/53038 (Genencor Int.) as well as in prior references (Kammerer et al, Clin. Exp. Allergy, 1997, vol. 27, pp 1016-1026; Sakakibara et al, J. Vet. Med. Sci., 1998; vol. 60, pp. 599-605), methods are described, which identify linear T-cell epitopes among a library of known peptide sequences, each representing part of the primary sequence of the protein of interest. Further, several similar techniques for localization of B-cell epitopes are disclosed by Walshet et al, J. Immunol. Methods, vol.121, 1275-280, (1989), and by Schoofs et al. J. Immunol. vol.140, 611-616, (1987). All of these methods, however, only leads to identification of linear epitopes, not to identification of ‘structural’ or ‘discontinuous’ epitopes, which are found on the 3-dimensional surface of protein molecules and which comprise amino acids from several discrete sites of the primary sequence of the protein. For several allergens, it has been realized that the dominant epitopes are of such discontinuous nature (Collins et al., Clin. Exp. All. 1996, vol. 26, pp. 36-42).
  • Slootstra et al; Molecular Diversity, 2, pp. 156-164, 1996 disclose the screening of a semi-random library of synthetic peptides for their binding properties to three monoclonal antibodies by immobilizing the peptides on polyethylene pins and binding a dilution series of each antibody to the pins. This reference does not disclose any indication of how the antibody binding peptide sequences relate to any full protein antigens or allergens.
  • In WO 92/10755 a method for modifying proteins to obtain less immunogenic variants is described. Randomly constructed protein variants, revealing a reduced binding of antibodies to the parent enzyme as compared to the parent enzyme itself, are selected for the measurement in animal models in terms of allergenicity. Finally, it is assessed whether reduction in immunogenicity is due to true elimination of an epitope or a reduction in affinity for antibodies. This method targets the identification of amino acids that may be part of structural epitopes by using a complete protein for assessing antigen binding. The major drawbacks of this approach are the ‘trial and error’ character, which makes it a lengthy and expensive process, and the lack of general information on the epitope patterns. Without this information, the results obtained for one protein can not be applied on another protein.
  • WO 99/47680 (ALK-ABELLÓ) discloses the identification and modification of B-cell epitopes by protein engineering. However, the method is based on crystal structures of Fab-antigen complexes, and B-cell epitopes are defined as “a section of the surface of the antigen comprising 15-25 amino acid residues, which are within a distance from the atoms of the antibody enabling direct interaction” (p.3). This publication does not show how one selects which Fab fragment to use (e.g. to target the most dominant allergy epitopes) or how one selects the substitutions to be made. Further, their method cannot be used in the absence of such crystallographic data for antigen-antibody complexes, which are very cumbersome, sometimes impossible, to obtain—especially since one would need a separate crystal structure for each epitope to be changed.
  • Hence, it is of interest to establish a general and efficient method to identify structural epitopes on the 3-dimensional surface of commercial and environmental allergens.
  • SUMMARY OF THE INVENTION
  • The present invention relates to a method of selecting a protein variant having modified immunogenicity as compared to a parent protein, comprising the steps of:
  • a) obtaining antibody binding peptide sequences,
  • b) using the sequences to localise epitope sequences on the 3-dimensional structure of parent protein,
  • c) defining an epitope area including amino acids situated within 5 Å from the epitope amino acids constituting the epitope sequence,
  • d) changing one or more of the amino acids defining the epitope area of the parent protein by genetic engineering mutations of a DNA sequence encoding the parent protein,
  • e) introducing the mutated DNA sequence into a suitable host, culturing said host and expressing the protein variant, and
  • f) evaluating the immunogenicity of the protein variant using the parent protein as reference.
  • A second aspect of the present invention is a protein variant having modified immunogenicity as compared to its parent protein. The amino acid sequence of the protein variant differs from the amino acid sequence of the parent protein with respect to at least one epitope pattern of the parent protein, such that the immunogenicity of the protein variant is modified as compared with the immunogenicity of the parent protein.
  • A further aspect of the present invention is a composition comprising a protein variant as defined above, as well as the use of the composition for industrial application, such as the production of a formulation for personal care products (for example shampoo; soap; skin, hand and face lotions; skin, hand and face cremes; hair dyes; toothpaste), food (for example in the baking industry), detergents and for the production of pharmaceuticals, e.g. vaccines.
  • Yet another aspect is a DNA molecule encoding a protein variant as defined above.
  • Further aspects are a vector comprising a DNA molecule as described above as well a host cell comprising said DNA molecule.
  • Another aspect is a method of producing a protein variant having modified immunogenicity as compared to the parent protein as defined above.
  • Definitions
  • Prior to a discussion of the detailed embodiments of the invention, a definition of specific terms related to the main aspects of the invention is provided.
  • In accordance with the present invention there may be employed conventional molecular biology, microbiology, and recombinant DNA techniques within the skill of the art. Such techniques are explained fully in the literature. See, e.g., Sambrook, Fritsch & Maniatis, Molecular Cloning: A Laboratory Manual, Second Edition (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (herein “Sambrook et al., 1989”) DNA Cloning: A Practical Approach, Volumes I and II/D. N. Glover ed. 1985); Oligonucleotide Synthesis (M. J. Gait ed. 1984); Nucleic Acid Hybridization (B. D. Hames & S. J. Higgins eds (1985)); Transcription And Translation (B. D. Hames & S. J. Higgins, eds. (1984)); Animal Cell Culture (R. I. Freshney, ed. (1986)); Immobilized Cells And Enzymes (IRL Press, (1986)); B. Perbal, A Practical Guide To Molecular Cloning (1984).
  • When applied to a protein, the term “isolated” indicates that the protein is found in a condition other than its native environment, such as apart from blood and animal tissue. In a preferred form, the isolated protein is substantially free of other proteins, particularly other proteins of animal origin. It is preferred to provide the proteins in a highly purified form, i.e., greater than 95% pure, more preferably greater than 99% pure. When applied to a polynucleotide molecule, the term “isolated” indicates that the molecule is removed from its natural genetic milieu, and is thus free of other extraneous or unwanted coding sequences, and is in a form suitable for use within genetically engineered protein production systems. Such isolated molecules are those that are separated from their natural environment and include cDNA and genomic clones. Isolated DNA molecules of the present invention are free of other genes with which they are ordinarily associated, and may include naturally occurring 5′ and 3′ untranslated regions such as promoters and terminators. The identification of associated regions will be evident to one of ordinary skill in the art (see for example, Dynan and Tijan, Nature 316: 774-78, 1985).
  • A “polynucleotide” is a single- or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5′ to the 3′ end. Polynucleotides include RNA and DNA, and may be isolated from natural sources, synthesized in vitro, or prepared from a combination of natural and synthetic molecules.
  • A “nucleic acid molecule” refers to the phosphate ester polymeric form of ribonucleosides (adenosine, guanosine, uridine or cytidine; “RNA molecules”) or deoxyribonucleosides (deoxyadenosine, deoxyguanosine, deoxythymidine, or deoxycytidine; “DNA molecules”) in either single stranded form, or a double-stranded helix. Double stranded DNA-DNA, DNA-RNA and RNA-RNA helices are possible. The term nucleic acid molecule, and in particular DNA or RNA molecule, refers only to the primary and secondary structure of the molecule, and does not limit it to any particular tertiary or quaternary forms. Thus, this term includes double-stranded DNA found, inter alia, in linear or circular DNA molecules (e.g., restriction fragments), plasmids, and chromosomes. In discussing the structure of particular double-stranded DNA molecules, sequences may be described herein according to the normal convention of giving only the sequence in the 5′ to 3′ direction along the nontranscribed strand of DNA (i.e., the strand having a sequence homologous to the mRNA). A “recombinant DNA molecule” is a DNA molecule that has undergone a molecular biological manipulation.
  • A DNA “coding sequence” is a double-stranded DNA sequence, which is transcribed and translated into a polypeptide in a cell in vitro or in vivo when placed under the control of appropriate regulatory sequences. The boundaries of the coding sequence are determined by a start codon at the 5′ (amino) terminus and a translation stop codon at the 3′ (carboxyl) terminus. A coding sequence can include, but is not limited to, prokaryotic sequences, cDNA from eukaryotic mRNA, genomic DNA sequences from eukaryotic (e.g., mammalian) DNA, and even synthetic DNA sequences. If the coding sequence is intended for expression in a eukaryotic cell, a polyadenylation signal and transcription termination sequence will usually be located 3′ to the coding sequence.
  • An “Expression vector” is a DNA molecule, linear or circular, that comprises a segment encoding a polypeptide of interest operably linked to additional segments that provide for its transcription. Such additional segments may include promoter and terminator sequences, and optionally one or more origins of replication, one or more selectable markers, an enhancer, a polyadenylation signal, and the like. Expression vectors are generally derived from plasmid or viral DNA, or may contain elements of both.
  • Transcriptional and translational control sequences are DNA regulatory sequences, such as promoters, enhancers, terminators, and the like, that provide for the expression of a coding sequence in a host cell. In eukaryotic cells, polyadenylation signals are control sequences.
  • A “secretory signal sequence” is a DNA sequence that encodes a polypeptide (a “secretory peptide” that, as a component of a larger polypeptide, directs the larger polypeptide through a secretory pathway of a cell in which it is synthesized. The larger polypeptide is commonly cleaved to remove the secretory peptide during transit through the secretory pathway.
  • The term “promoter” is used herein for its art-recognized meaning to denote a portion of a gene containing DNA sequences that provide for the binding of RNA polymerase and initiation of transcription. Promoter sequences are commonly, but not always, found in the 5′ non-coding regions of genes.
  • “Operably linked”, when referring to DNA segments, indicates that the segments are arranged so that they function in concert for their intended purposes, e.g. transcription initiates in the promoter and proceeds through the coding segment to the terminator.
  • A coding sequence is “under the control” of transcriptional and translational control sequences in a cell when RNA polymerase transcribes the coding sequence into mRNA, which is then trans-RNA spliced and translated into the protein encoded by the coding sequence.
  • “Isolated polypeptide” is a polypeptide which is essentially free of other non-[enzyme] polypeptides, e.g., at least about 20% pure, preferably at least about 40% pure, more preferably about 60% pure, even more preferably about 80% pure, most preferably about 90% pure, and even most preferably about 95% pure, as determined by SDS-PAGE.
  • “Heterologous” DNA refers to DNA not naturally located in the cell, or in a chromosomal site of the cell. Preferably, the heterologous DNA includes a gene foreign to the cell.
  • A cell has been “transfected” by exogenous or heterologous DNA when such DNA has been introduced inside the cell. A cell has been “transformed” by exogenous or heterologous DNA when the transfected DNA effects a phenotypic change. Preferably, the transforming DNA should be integrated (covalently linked) into chromosomal DNA making up the genome of the cell.
  • A “clone” is a population of cells derived from a single cell or common ancestor by mitosis. “Homologous recombination” refers to the insertion of a foreign DNA sequence of a vector in a chromosome. Preferably, the vector targets a specific chromosomal site for homologous recombination. For specific homologous recombination, the vector will contain sufficiently long regions of homology to sequences of the chromosome to allow complementary binding and incorporation of the vector into the chromosome. Longer regions of homology, and greater degrees of sequence similarity, may increase the efficiency of homologous recombination.
  • Nucleic Acid Sequence
  • The techniques used to isolate or clone a nucleic acid sequence encoding a polypeptide are known in the art and include isolation from genomic DNA, preparation from cDNA, or a combination thereof. The cloning of the nucleic acid sequences of the present invention from such genomic DNA can be effected, e.g., by using the well known polymerase chain reaction (PCR) or antibody screening of expression libraries to detect cloned DNA fragments with shared structural features. See, e.g., Innis et al., 1990, A Guide to Methods and Application, Academic Press, New York. Other nucleic acid amplification procedures such as ligase chain reaction (LCR), ligated activated transcription (LAT) and nucleic acid sequence-based amplification (NASBA) may be used. The nucleic acid sequence may be cloned from a strain producing the polypeptide, or from another related organism and thus, for example, may be an allelic or species variant of the polypeptide encoding region of the nucleic acid sequence.
  • The term “isolated” nucleic acid sequence as used herein refers to a nucleic acid sequence which is essentially free of other nucleic acid sequences, e.g., at least about 20% pure, preferably at least about 40% pure, more preferably about 60% pure, even more preferably about 80% pure, most preferably about 90% pure, and even most preferably about 95% pure, as determined by agarose gel electorphoresis. For example, an isolated nucleic acid sequence can be obtained by standard cloning procedures used in genetic engineering to relocate the nucleic acid sequence from its natural location to a different site where it will be reproduced. The cloning procedures may involve excision and isolation of a desired nucleic acid fragment comprising the nucleic acid sequence encoding the polypeptide, insertion of the fragment into a vector molecule, and incorporation of the recombinant vector into a host cell where multiple copies or clones of the nucleic acid sequence will be replicated. The nucleic acid sequence may be of genomic, cDNA, RNA, semisynthetic, synthetic origin, or any combinations thereof.
  • Nucleic Acid Construct
  • As used herein the term “nucleic acid construct” is intended to indicate any nucleic acid molecule of cDNA, genomic DNA, synthetic DNA or RNA origin. The term “construct” is intended to indicate a nucleic acid segment which may be single- or double-stranded, and which may be based on a complete or partial naturally occurring nucleotide sequence encoding a polypeptide of interest. The construct may optionally contain other nucleic acid segments.
  • The DNA of interest may suitably be of genomic or cDNA origin, for instance obtained by preparing a genomic or cDNA library and screening for DNA sequences coding for all or part of the polypeptide by hybridization using synthetic oligonucleotide probes in accordance with standard techniques (cf. Sambrook et al., supra).
  • The nucleic acid construct may also be prepared synthetically by established standard methods, e.g. the phosphoamidite method described by Beaucage and Caruthers, Tetrahedron Letters 22 (1981), 1859-1869, or the method described by Matthes et al., EMBO Journal 3 (1984), 801-805. According to the phosphoamidite method, oligonucleotides are synthesized, e.g. in an automatic DNA synthesizer, purified, annealed, ligated and cloned in suitable vectors.
  • Furthermore, the nucleic acid construct may be of mixed synthetic and genomic, mixed synthetic and cDNA or mixed genomic and cDNA origin prepared by ligating fragments of synthetic, genomic or cDNA origin (as appropriate), the fragments corresponding to various parts of the entire nucleic acid construct, in accordance with standard techniques.
  • The nucleic acid construct may also be prepared by polymerase chain reaction using specific primers, for instance as described in U.S. Pat. No. 4,683,202 or Saiki et al., Science 239 (1988), 487-491.
  • The term nucleic acid construct may be synonymous with the term expression cassette when the nucleic acid construct contains all the control sequences required for expression of a coding sequence of the present invention. The term “coding sequence” as defined herein is a sequence which is transcribed into mRNA and translated into a polypeptide of the present invention when placed under the control of the above mentioned control sequences. The boundaries of the coding sequence are generally determined by a translation start codon ATG at the 5′-terminus and a translation stop codon at the 3′-terminus. A coding sequence can include, but is not limited to, DNA, cDNA, and recombinant nucleic acid sequences.
  • The term “control sequences” is defined herein to include all components which are necessary or advantageous for expression of the coding sequence of the nucleic acid sequence. Each control sequence may be native or foreign to the nucleic acid sequence encoding the polypeptide. Such control sequences include, but are not limited to, a leader, a polyadenylation sequence, a propeptide sequence, a promoter, a signal sequence, and a transcription terminator. At a minimum, the control sequences include a promoter, and transcriptional and translational stop signals. The control sequences may be provided with linkers for the purpose of introducing specific restriction sites facilitating ligation of the control sequences with the coding region of the nucleic acid sequence encoding a polypeptide.
  • The control sequence may be an appropriate promoter sequence, a nucleic acid sequence which is recognized by a host cell for expression of the nucleic acid sequence. The promoter sequence contains transcription and translation control sequences which mediate the expression of the polypeptide. The promoter may be any nucleic acid sequence which shows transcriptional activity in the host cell of choice and may be obtained from genes encoding extracellular or intracellular polypeptides either homologous or heterologous to the host cell.
  • The control sequence may also be a suitable transcription terminator sequence, a sequence recognized by a host cell to terminate transcription. The terminator sequence is operably linked to the 3′ terminus of the nucleic acid sequence encoding the polypeptide. Any terminator which is functional in the host cell of choice may be used in the present invention.
  • The control sequence may also be a polyadenylation sequence, a sequence which is operably linked to the 3′ terminus of the nucleic acid sequence and which, when transcribed, is recognized by the host cell as a signal to add polyadenosine residues to transcribed mRNA. Any polyadenylation sequence which is functional in the host cell of choice may be used in the present invention.
  • The control sequence may also be a signal peptide coding region, which codes for an amino acid sequence linked to the amino terminus of the polypeptide which can direct the expressed polypeptide into the cell's secretory pathway of the host cell. The 5′ end of the coding sequence of the nucleic acid sequence may inherently contain a signal peptide coding region naturally linked in translation reading frame with the segment of the coding region which encodes the secreted polypeptide.
  • Alternatively, the 5′ end of the coding sequence may contain a signal peptide coding region which is foreign to that portion of the coding sequence which encodes the secreted polypeptide. A foreign signal peptide coding region may be required where the coding sequence does not normally contain a signal peptide coding region. Alternatively, the foreign signal peptide coding region may simply replace the natural signal peptide coding region in order to obtain enhanced secretion relative to the natural signal peptide coding region normally associated with the coding sequence. The signal peptide coding region may be obtained from a glucoamylase or an amylase gene from an Aspergillus species, a lipase or proteinase gene from a Rhizomucor species, the gene for the alpha-factor from Saccharomyces cerevisiae, an amylase or a protease gene from a Bacillus species, or the calf preprochymosin gene. However, any signal peptide coding region capable of directing the expressed polypeptide into the secretory pathway of a host cell of choice may be used in the present invention.
  • The control sequence may also be a propeptide coding region, which codes for an amino acid sequence positioned at the amino terminus of a polypeptide. The resultant polypeptide is known as a proenzyme or propolypeptide (or a zymogen in some cases). A propolypeptide is generally inactive and can be converted to mature active polypeptide by catalytic or autocatalytic cleavage of the propeptide from the propolypeptide. The propeptide coding region may be obtained from the Bacillus subtilis alkaline protease gene (aprE), the Bacillus subtilis neutral protease gene (nprT), the Saccharomyces cerevisiae alpha-factor gene, or the Myceliophthora thermophilum laccase gene (WO 95/33836).
  • The nucleic acid constructs of the present invention may also comprise one or more nucleic acid sequences which encode one or more factors that are advantageous in the expression of the polypeptide, e.g., an activator (e.g., a trans-acting factor), a chaperone, and a processing protease. Any factor that is functional in the host cell of choice may be used in the present invention. The nucleic acids encoding one or more of these factors are not necessarily in tandem with the nucleic acid sequence encoding the polypeptide.
  • An activator is a protein which activates transcription of a nucleic acid sequence encoding a polypeptide (Kudla et al., 1990, EMBO Journal 9:1355-1364; Jarai and Buxton, 1994, Current Genetics 26:2238-244; Verdier, 1990, Yeast 6:271-297). The nucleic acid sequence encoding an activator may be obtained from the genes encoding Bacillus stearothermophilus NprA (nprA), Saccharomyces cerevisiae heme activator protein 1 (hap1), Saccharomyces cerevisiae galactose metabolizing protein 4 (gal4), and Aspergillus nidulans ammonia regulation protein (areA). For further examples, see Verdier, 1990, supra and MacKenzie et al., 1993, Journal of General Microbiology 139:2295-2307.
  • A chaperone is a protein which assists another polypeptide in folding properly (Harti et al., 1994, TIBS 19:20-25; Bergeron et al., 1994, TIBS 19:124-128; Demolder et al., 1994, Journal of Biotechnology 32:179-189; Craig, 1993, Science 260:1902-1903; Gething and Sambrook, 1992, Nature 355:33-45; Puig and Gilbert, 1994, Journal of Biological Chemistry 269:7764-7771; Wang and Tsou, 1993, The FASEB Journal 7:1515-11157; Robinson et al., 1994, Bio/Technology 1:381-384). The nucleic acid sequence encoding a chaperone may be obtained from the genes encoding Bacillus subtilis GroE proteins, Aspergillus oryzae protein disulphide isomerase, Saccharomyces cerevisiae calnexin, Saccharomyces cerevisiae BiP/GRP78, and Saccharomyces cerevisiae Hsp7O. For further examples, see Gething and Sambrook, 1992, supra, and Hartl et al., 1994, supra.
  • A processing protease is a protease that cleaves a propeptide to generate a mature biochemically active polypeptide (Enderlin and Ogrydziak, 1994, Yeast 10:67-79; Fuller et al., 1989, Proceedings of the National Academy of Sciences USA 86:1434-1438; Julius et al., 1984, Cell 37:1075-1089; Julius et al., 1983, Cell 32:839-852). The nucleic acid sequence encoding a processing protease may be obtained from the genes encoding Aspergillus niger Kex2, Saccharomyces cerevisiae dipeptidylaminopeptidase, Saccharomyces cerevisiae Kex2, and Yarrowia lipolytica dibasic processing endoprotease (xpr6).
  • It may also be desirable to add regulatory sequences which allow the regulation of the expression of the polypeptide relative to the growth of the host cell. Examples of regulatory systems are those which cause the expression of the gene to be turned on or off in response to a chemical or physical stimulus, including the presence of a regulatory compound. Regulatory systems in prokaryotic systems would include the lac, tac, and trp operator systems. In yeast, the ADH2 system or GAL1 system may be used. In filamentous fungi, the TAKA alpha-amylase promoter, Aspergillus niger glucoamylase promoter, and the Aspergillus olyzae glucoamylase promoter may be used as regulatory sequences. Other examples of regulatory sequences are those which allow for gene amplification. In eukaryotic systems, these include the dihydrofolate reductase gene which is amplified in the presence of methotrexate, and the metallothionein genes which are amplified with heavy metals. In these cases, the nucleic acid sequence encoding the polypeptide would be placed in tandem with the regulatory sequence.
  • Promoters
  • Examples of suitable promoters for directing the transcription of the nucleic acid constructs of the present invention, especially in a bacterial host cell, are the promoters obtained from the E. coli lac operon, the Streptomyces coelicolor agarase gene (dagA), the Bacillus subtilis levansucrase gene (sacB), the Bacillus subtilis alkaline protease gene, the Bacillus licheniformis alpha-amylase gene (amyL), the Bacillus stearothermophilus maltogenic amylase gene (amyM), the Bacillus amyloliquefaciens alpha-amylase gene (amyQ), the Bacillus amyloliquefaciens BAN amylase gene, the Bacillus licheniformis penicillinase gene (penP), the Bacillus subtilis xylA and xylB genes, and the prokaryotic beta-lactamase gene (Villa-Kamaroff et al., 1978, Proceedings of the National Academy of Sciences USA 75:3727-3731), as well as the tac promoter (DeBoer et al., 1983, Proceedings of the National Academy of Sciences USA 80:21-25), or the Bacillus pumilus xylosidase gene, or by the phage Lambda PR or PL promoters or the E. coli lac, trp or tac promoters. Further promoters are described in “Useful proteins from recombinant bacteria” in Scientific American, 1980, 242:74-94; and in Sambrook et al., 1989, supra.
  • Examples of suitable promoters for directing the transcription of the nucleic acid constructs of the present invention in a filamentous fungal host cell are promoters obtained from the genes encoding Aspergillus oryzae TAKA amylase, Rhizomucor miehei aspartic proteinase, Aspergillus niger neutral alpha-amylase, Aspergillus niger acid stable alpha-amylase, Aspergillus niger or Aspergillus awamori glucoamylase (glaA), Rhizomucor miehei lipase, Aspergillus oryzae alkaline protease, Aspergillus oryzae triose phosphate isomerase, Aspergillus nidulans acetamidase, Fusarium oxysporum trypsin-like protease (as described in U.S. Pat. No. 4,288,627, which is incorporated herein by reference), and hybrids thereof. Particularly preferred promoters for use in filamentous fungal host cells are the TAKA amylase, NA2-tpi (a hybrid of the promoters from the genes encoding Aspergillus niger neutral alpha-amylase and Aspergillus oryzae triose phosphate isomerase), and glaA promoters. Further suitable promoters for use in filamentous fungus host cells are the ADH3 promoter (McKnight et al., The EMBO J. 4 (1985), 2093-2099) or the tpiA promoter.
  • Examples of suitable promoters for use in yeast host cells include promoters from yeast glycolytic genes (Hitzeman et al., J. Biol. Chem. 255 (1980), 12073-12080; Alber and Kawasaki, J. Mol. Appl. Gen. 1 (1982), 419-434) or alcohol dehydrogenase genes (Young et al., in Genetic Engineering of Microorganisms for Chemicals (Hollaender et al, eds.), Plenum Press, New York, 1982), or the TPI1 (U.S. Pat. No. 4,599,311) or ADH2-4c (Russell et al., Nature 304 1983), 652-654) promoters.
  • Further useful promoters are obtained from the Saccharomyces cerevisiae enolase (ENO-1) gene, the Saccharomyces cerevisiae galactokinase gene (GAL1), the Saccharomyces cerevisiae alcohol dehydrogenase/glyceraldehyde-3-phosphate dehydrogenase genes (ADH2/GAP), and the Saccharomyces cerevisiae 3-phosphoglycerate kinase gene. Other useful promoters for yeast host cells are described by Romanos et al., 1992, Yeast 8:423-488. In a mammalian host cell, useful promoters include viral promoters such as those from Simian Virus 40 (SV40), Rous sarcoma virus (RSV), adenovirus, and bovine papilloma virus (BPV).
  • Examples of suitable promoters for directing the transcription of the DNA encoding the polypeptide of the invention in mammalian cells are the SV40 promoter (Subramani et al., Mol. Cell Biol. 1 (1981), 854-864), the MT-1 (metallothionein gene) promoter (Palmiter et al., Science 222 (1983), 809-814) or the adenovirus 2 major late promoter.
  • An example of a suitable promoter for use in insect cells is the polyhedrin promoter (U.S. Pat. No. 4,745,051; Vasuvedan et al., FEBS Lett. 311, (1992) 7-11), the P10 promoter (J. M. VIak et al., J. Gen. Virology 69, 1988, pp. 765-776), the Autographa californica polyhedrosis virus basic protein promoter (EP 397 485), the baculovirus immediate early gene 1 promoter (U.S. Pat. No. 5,155,037; U.S. Pat No. 5,162,222), or the baculovirus 39K delayed-early gene promoter (U.S. Pat. No. 5,155,037; U.S. Pat. No. 5,162,222).
  • Terminators
  • Preferred terminators for filamentous fungal host cells are obtained from the genes encoding Aspergillus oryzae TAKA amylase, Aspergillus niger glucoamylase, Aspergillus nidulans anthranilate synthase, Aspergillus niger alpha-glucosidase, and Fusarium oxysporum trypsin-like protease. for fungal hosts) the TPI1 (Alber and Kawasaki, op. cit.) or ADH3 (McKnight et al., op. cit.) terminators.
  • Preferred terminators for yeast host cells are obtained from the genes encoding Saccharomyces cerevisiae enolase, Saccharomyces cerevisiae cytochrome C (CYC1), or Saccharomyces cerevisiae glyceraldehyde-3-phosphate dehydrogenase. Other useful terminators for yeast host cells are described by Romanos et al., 1992, supra.
  • Polyadenylation Signals
  • Preferred polyadenylation sequences for filamentous fungal host cells are obtained from the genes encoding Aspergillus oryzae TAKA amylase, Aspergillus niger glucoamylase, Aspergillus nidulans anthranilate synthase, and Aspergillus niger alpha-glucosidase.
  • Useful polyadenylation sequences for yeast host cells are described by Guo and Sherman, 1995, Molecular Cellular Biology 15:5983-5990.
  • Polyadenylation sequences are well known in the art for mammalian host cells such as SV40 or the adenovirus 5 Elb region.
  • Signal Sequences
  • An effective signal peptide coding region for bacterial host cells is the signal peptide coding region obtained from the maltogenic amylase gene from Bacillus NCIB 11837, the Bacillus stearothermophilus alpha-amylase gene, the Bacillus licheniformis subtilisin gene, the Bacillus licheniformis beta-lactamase gene, the Bacillus stearothermophilus neutral proteases genes (nprT, nprS, nprM), and the Bacillus subtilis PrsA gene. Further signal peptides are described by Simonen and Palva, 1993, Microbiological Reviews 57:109-137.
  • An effective signal peptide coding region for filamentous fungal host cells is the signal peptide coding region obtained from Aspergillus oryzae TAKA amylase gene, Aspergillus niger neutral amylase gene, the Rhizomucor miehei aspartic proteinase gene, the Humicola lanuginosa cellulase or lipase gene, or the Rhizomucor miehei lipase or protease gene, Aspergillus sp. amylase or glucoamylase, a gene encoding a Rhizomucor miehei lipase or protease. The signal peptide is preferably derived from a gene encoding A. oryzae TAKA amylase, A. niger neutral alpha-amylase, A. niger acid-stable amylase, or A. niger glucoamylase.
  • Useful signal peptides for yeast host cells are obtained from the genes for Saccharomyces cerevisiae alpha-factor and Saccharomyces cerevisiae invertase. Other useful signal peptide coding regions are described by Romanos et al., 1992, supra.
  • For secretion from yeast cells, the secretory signal sequence may encode any signal peptide which ensures efficient direction of the expressed polypeptide into the secretory pathway of the cell. The signal peptide may be naturally occurring signal peptide, or a functional part thereof, or it may be a synthetic peptide. Suitable signal peptides have been found to be the a-factor signal peptide (cf. U.S. Pat. No. 4,870,008), the signal peptide of mouse salivary amylase (cf. O Hagenbuchle et al., Nature 289, 1981, pp. 643-646), a modified carboxypeptidase signal peptide (cf. L. A. Valls et al., Cell 48, 1987, pp. 887-897), the yeast BAR1 signal peptide (cf. WO 87/02670), or the yeast aspartic protease 3 (YAP3) signal peptide (cf. M. Egel-Mitani et al., east 6, 1990, pp. 127-137).
  • For efficient secretion in yeast, a sequence encoding a leader peptide may also be inserted downstream of the signal sequence and uptream of the DNA sequence encoding the polypeptide. The function of the leader peptide is to allow the expressed polypeptide to be directed from the endoplasmic reticulum to the Golgi apparatus and further to a secretory vesicle for secretion into the culture medium (i.e. exportation of the polypeptide across the cell wall or at least through the cellular membrane into the periplasmic space of the yeast cell). The leader peptide may be the yeast a-factor leader (the use of which is described in e.g. U.S. Pat. No. 4,546,082, EP 16 201, EP 123 294, EP 123 544 and EP 163 529). Alternatively, the leader peptide may be a synthetic leader peptide, which is to say a leader peptide not found in nature. Synthetic leader peptides may, for instance, be constructed as described in WO 89/02463 or WO 92/11378.
  • For use in insect cells, the signal peptide may conveniently be derived from an insect gene (cf. WO 90/05783), such as the lepidopteran Manduca sexta adipokinetic hormone precursor signal peptide (cf. U.S. Pat. No. 5,023,328).
  • Expression Vectors
  • The present invention also relates to recombinant expression vectors comprising a nucleic acid sequence of the present invention, a promoter, and transcriptional and translational stop signals. The various nucleic acid and control sequences described above may be joined together to produce a recombinant expression vector which may include one or more convenient restriction sites to allow for insertion or substitution of the nucleic acid sequence encoding the polypeptide at such sites. Alternatively, the nucleic acid sequence of the present invention may be expressed by inserting the nucleic acid sequence or a nucleic acid construct comprising the sequence into an appropriate vector for expression. In creating the expression vector, the coding sequence is located in the vector so that the coding sequence is operably linked with the appropriate control sequences for expression, and possibly secretion.
  • The recombinant expression vector may be any vector (e.g., a plasmid or virus) which can be conveniently subjected to recombinant DNA procedures and can bring about the expression of the nucleic acid sequence. The choice of the vector will typically depend on the compatibility of the vector with the host cell into which the vector is to be introduced. The vectors may be linear or closed circular plasmids. The vector may be an autonomously replicating vector, i.e., a vector which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid, an extrachromosomal element, a minichromosome, or an artificial chromosome. The vector may contain any means for assuring self-replication. Alternatively, the vector may be one which, when introduced into the host cell, is integrated into the genome and replicated together with the chromosome(s) into which it has been integrated. The vector system may be a single vector or plasmid or two or more vectors or plasmids which together contain the total DNA to be introduced into the genome of the host cell, or a transposon.
  • The vectors of the present invention preferably contain one or more selectable markers which permit easy selection of transformed cells. A selectable marker is a gene the product of which provides for biocide or viral resistance, resistance to heavy metals, prototrophy to auxotrophs, and the like. Examples of bacterial selectable markers are the dal genes from Bacillus subtilis or Bacillus licheniformis, or markers which confer antibiotic resistance such as ampicillin, kanamycin, chloramphenicol, tetracycline, neomycin, hygromycin or methotrexate resistance. A frequently used mammalian marker is the dihydrofolate reductase gene (DHFR). Suitable markers for yeast host cells are ADE2, HIS3, LEU2, LYS2, MET3, TRP1, and URA3. A selectable marker for use in a filamentous fungal host cell may be selected from the group including, but not limited to, amdS (acetamidase), argB (ornithine carbamoyltransferase), bar (phosphinothricin acetyltransferase), hygB (hygromycin phosphotransferase), niaD (nitrate reductase), pyrG (orotidine-5′-phosphate decarboxylase), sC (sulfate adenyltransferase), trpC (anthranilate synthase), and glufosinate resistance markers, as well as equivalents from other species. Preferred for use in an Aspergillus cell are the amdS and pyrG markers of Aspergillus nidulans or Aspergillus oryzae and the bar marker of Streptomyces hygroscopicus. Furthermore, selection may be accomplished by co-transformation, e.g., as described in WO 91/17243, where the selectable marker is on a separate vector.
  • The vectors of the present invention preferably contain an element(s) that permits stable integration of the vector into the host cell genome or autonomous replication of the vector in the cell independent of the genome of the cell.
  • The vectors of the present invention may be integrated into the host cell genome when introduced into a host cell. For integration, the vector may rely on the nucleic acid sequence encoding the polypeptide or any other element of the vector for stable integration of the vector into the genome by homologous or nonhomologous recombination. Alternatively, the vector may contain additional nucleic acid sequences for directing integration by homologous recombination into the genome of the host cell. The additional nucleic acid sequences enable the vector to be integrated into the host cell genome at a precise location(s) in the chromosome(s). To increase the likelihood of integration at a precise location, the integrational elements should preferably contain a sufficient number of nucleic acids, such as 100 to 1,500 base pairs, preferably 400 to 1,500 base pairs, and most preferably 800 to 1,500 base pairs, which are highly homologous with the corresponding target sequence to enhance the probability of homologous recombination. The integrational elements may be any sequence that is homologous with the target sequence in the genome of the host cell. Furthermore, the integrational elements may be non-encoding or encoding nucleic acid sequences. On the other hand, the vector may be integrated into the genome of the host cell by non-homologous recombination. These nucleic acid sequences may be any sequence that is homologous with a target sequence in the genome of the host cell, and, furthermore, may be non-encoding or encoding sequences.
  • For autonomous replication, the vector may further comprise an origin of replication enabling the vector to replicate autonomously in the host cell in question. Examples of bacterial origins of replication are the origins of replication of plasmids pBR322, pUC19, pACYC177, pACYC184, pUB110, pE194, pTA1060, and pAMβ1. Examples of origin of replications for use in a yeast host cell are the 2 micron origin of replication, the combination of CEN6 and ARS4, and the combination of CEN3 and ARS1. The origin of replication may be one having a mutation which makes its functioning temperature-sensitive in the host cell (see, e.g., Ehrlich, 1978, Proceedings of the National Academy of Sciences USA 75:1433).
  • More than one copy of a nucleic acid sequence encoding a polypeptide of the present invention may be inserted into the host cell to amplify expression of the nucleic acid sequence. Stable amplification of the nucleic acid sequence can be obtained by integrating at least one additional copy of the sequence into the host cell genome using methods well known in the art and selecting for transformants.
  • The procedures used to ligate the elements described above to construct the recombinant expression vectors of the present invention are well known to one skilled in the art (see, e.g., Sambrook et al., 1989, supra).
  • Host Cells
  • The present invention also relates to recombinant host cells, comprising a nucleic acid sequence of the invention, which are advantageously used in the recombinant production of the polypeptides. The term “host cell” encompasses any progeny of a parent cell which is not identical to the parent cell due to mutations that occur during replication.
  • The cell is preferably transformed with a vector comprising a nucleic acid sequence of the invention followed by integration of the vector into the host chromosome. “Transformation” means introducing a vector comprising a nucleic acid sequence of the present invention into a host cell so that the vector is maintained as a chromosomal integrant or as a self-replicating extra-chromosomal vector. Integration is generally considered to be an advantage as the nucleic acid sequence is more likely to be stably maintained in the cell. Integration of the vector into the host chromosome may occur by homologous or non-homologous recombination as described above.
  • The choice of a host cell will to a large extent depend upon the gene encoding the polypeptide and its source. The host cell may be a unicellular microorganism, e.g., a prokaryote, or a non-unicellular microorganism, e.g., a eukaryote. Useful unicellular cells are bacterial cells such as gram positive bacteria including, but not limited to, a Bacillus cell, e.g., Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus brevis, Bacillus circulans, Bacillus coagulans, Bacillus lautus, Bacillus lentus, Bacillus licheniformis, Bacillus megaterium, Bacillus stearothermophilus, Bacillus subtilis, and Bacillus thuringiensis; or a Streptomyces cell, e.g., Streptomyces lividans or Streptomyces murinus, or gram negative bacteria such as E. coli and Pseudomonas sp. In a preferred embodiment, the bacterial host cell is a Bacillus lentus, Bacillus licheniformis, Bacillus stearothermophilus or Bacillus subtilis cell. The transformation of a bacterial host cell may, for instance, be effected by protoplast transformation (see, e.g., Chang and Cohen, 1979, Molecular General Genetics 168:111-115), by using competent cells (see, e.g., Young and Spizizin, 1961, Journal of Bacteriology 81:823-829, or Dubnar and Davidoff-Abelson, 1971, Journal of Molecular Biology 56:209-221), by electroporation (see, e.g., Shigekawa and Dower, 1988, Biotechniques 6:742-751), or by conjugation (see, e.g., Koehler and Thorne, 1987, Journal of Bacteriology 169:5771-5278).
  • The host cell may be a eukaryote, such as a mammalian cell, an insect cell, a plant cell or a fungal cell.
  • Useful mammalian cells include Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, COS cells, or any number of other immortalized cell lines available, e.g., from the American Type Culture Collection.
  • Examples of suitable mammalian cell lines are the COS (ATCC CRL 1650 and 1651), BHK (ATCC CRL 1632, 10314 and 1573, ATCC CCL 10), CHL (ATCC CCL39) or CHO (ATCC CCL 61) cell lines. Methods of transfecting mammalian cells and expressing DNA sequences introduced in the cells are described in e.g. Kaufman and Sharp, J. Mol. Biol. 159 (1982), 601-621; Southern and Berg, J. Mol. AppI. Genet. 1 (1982), 327-341; Loyter et al., Proc. Natl. Acad. Sci. USA 79 (1982), 422-426; Wigler et al., Cell 14 (1978), 725; Corsaro and Pearson, Somatic Cell Genetics 7 (1981), 603, Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Inc., N.Y., 1987, Hawley-Nelson et al., Focus 15 (1993), 73; Ciccarone et al., Focus 15 (1993), 80; Graham and van der Eb, Virology 52 (1973), 456; and Neumann et al., EMBO J.1 (1982), 841-845.
  • In a preferred embodiment, the host cell is a fungal cell. “Fungi” as used herein includes the phyla Ascomycota, Basidiomycota, Chytridiomycota, and Zygomycota (as defined by Hawksworth et al., In, Ainsworth and Bisby's Dictionary of The Fungi, 8th edition, 1995, CAB International, University Press, Cambridge, UK) as well as the Oomycota (as cited in Hawksworth et al., 1995, supra, page 171) and all mitosporic fungi (Hawksworth et al., 1995, supra). Representative groups of Ascomycota include, e.g., Neurospora, Eupenicillium (=Penicillium), Emericella (=Aspergillus), Eurotium (=Aspergillus), and the true yeasts listed above. Examples of Basidiomycota include mushrooms, rusts, and smuts. Representative groups of Chytridiomycota include, e.g., Allomyces, Blastocladiella, Coelomomyces, and aquatic fungi. Representative groups of Oomycota include, e.g., Saprolegniomycetous aquatic fungi (water molds) such as Achlya. Examples of mitosporic fungi include Aspergillus, Penicillium, Candida, and Alternaria. Representative groups of Zygomycota include, e.g., Rhizopus and Mucor.
  • In a preferred embodiment, the fungal host cell is a yeast cell. “Yeast” as used herein includes ascosporogenous yeast (Endomycetales), basidiosporogenous yeast, and yeast belonging to the Fungi Imperfecti (Blastomycetes). The ascosporogenous yeasts are divided into the families Spermophthoraceae and Saccharomycetaceae. The latter is comprised of four subfamilies, Schizosaccharomycoideae (e.g., genus Schizosaccharomyces), Nadsonioideae, Lipomycoideae, and Saccharomycoideae (e.g., genera Pichia, Kluyveromyces and Saccharomyces). The basidiosporogenous yeasts include the genera Leucosporidim, Rhodosporidium, Sporidiobolus, Filobasidium, and Filobasidiella. Yeast belonging to the Fungi Imperfecti are divided into two families, Sporobolomycetaceae (e.g., genera Sorobolomyces and Bullera) and Cryptococcaceae (e.g., genus Candida). Since the classification of yeast may change in the future, for the purposes of this invention, yeast shall be defined as described in Biology and Activities of Yeast (Skinner, F. A., Passmore, S. M., and Davenport, R. R., eds, Soc. App. Bacteriol. Symposium Series No. 9, 1980. The biology of yeast and manipulation of yeast genetics are well known in the art (see, e.g., Biochemistry and Genetics of Yeast, Bacil, M., Horecker, B. J., and Stopani, A. O. M., editors, 2nd edition, 1987; The Yeasts, Rose, A. H., and Harrison, J. S., editors, 2nd edition, 1987; and The Molecular Biology of the Yeast Saccharomyces, Strathern et al., editors, 1981).
  • The yeast host cell may be selected from a cell of a species of Candida, Kluyveromyces, Saccharomyces, Schizosaccharomyces, Candida, Pichia, Hansenula, or Yarrowia. In a preferred embodiment, the yeast host cell is a Saccharomyces carlsbergensis, Saccharomyces cerevisiae, Saccharomyces diastaticus, Saccharomyces douglasii, Saccharomyces kluyveri, Saccharomyces norbensis or Saccharomyces oviformis cell. Other useful yeast host cells are a Kluyveromyces lactis, Kluyveromyces fragilis, Hansenula polymorpha, Pichia pastoris, Yarrowia lipolytica, Schizosaccharomyces pombe, Ustilgo maylis, Candida maltose, Pichia guillermondii and Pichia methanolio cell (cf. Gleeson et al., J. Gen. Microbiol. 132, 1986, pp. 3459-3465; U.S. Pat. No. 4,882,279 and U.S. Pat. No. 4,879,231).
  • In a preferred embodiment, the fungal host cell is a filamentous fungal cell. “Filamentous fungi” include all filamentous forms of the subdivision Eumycota and Oomycota (as defined by Hawksworth et al., 1995, supra). The filamentous fungi are characterized by a vegetative mycelium composed of chitin, cellulose, glucan, chitosan, mannan, and other complex polysaccharides. Vegetative growth is by hyphal elongation and carbon catabolism is obligately aerobic. In contrast, vegetative growth by yeasts such as Saccharomyces cerevisiae is by budding of a unicellular thallus and carbon catabolism may be fermentative. In a more preferred embodiment, the filamentous fungal host cell is a cell of a species of, but not limited to, Acremonium, Aspergillus, Fusarium, Humicola, Mucor, Myceliophthora, Neurospora, Penicillium, Thielavia, Tolypocladium, and Trichoderma or a teleomorph or synonym thereof. In an even more preferred embodiment, the filamentous fungal host cell is an Aspergillus cell. In another even more preferred embodiment, the filamentous fungal host cell is an Acremonium cell. In another even more preferred embodiment, the filamentous fungal host cell is a Fusarium cell. In another even more preferred embodiment, the filamentous fungal host cell is a Humicola cell. In another even more preferred embodiment, the filamentous fungal host cell is a Mucor cell. In another even more preferred embodiment, the filamentous fungal host cell is a Myceliophthora cell. In another even more preferred embodiment, the filamentous fungal host cell is a Neurospora cell. In another even more preferred embodiment, the filamentous fungal host cell is a Penicillium cell. In another even more preferred embodiment, the filamentous fungal host cell is a Thielavia cell. In another even more preferred embodiment, the filamentous fungal host cell is a Tolypocladium cell. In another even more preferred embodiment, the filamentous fungal host cell is a Trichoderma cell. In a most preferred embodiment, the filamentous fungal host cell is an Aspergillus awamori, Aspergillus foetidus, Aspergillus japonicus, Aspergillus niger, Aspergillus nidulans or Aspergillus oryzae cell. In another most preferred embodiment, the filamentous fungal host cell is a Fusarium cell of the section Discolor (also known as the section Fusarium). For example, the filamentous fungal parent cell may be a Fusarium bactridioides, Fusarium cerealis, Fusarium crookwellense, Fusarium culmorum, Fusarium graminearum, Fusarium graminum, Fusarium heterosporum, Fusarium negundi, Fusarium reticulatum, Fusarium roseum, Fusarium sambucinum, Fusarium sarcochroum, Fusarium sulphureum, or Fusarium trichothecioides cell. In another prefered embodiment, the filamentous fungal parent cell is a Fusarium strain of the section Elegans, e.g., Fusarium oxysporum. In another most preferred embodiment, the filamentous fungal host cell is a Humicola insolens or Humicola lanuginosa cell. In another most preferred embodiment, the filamentous fungal host cell is a Mucor miehei cell. In another most preferred embodiment, the filamentous fungal host cell is a Myceliophthora thermophilum cell. In another most preferred embodiment, the filamentous fungal host cell is a Neurospora crassa cell. In another most preferred embodiment, the filamentous fungal host cell is a Penicillium purpurogenum cell. In another most preferred embodiment, the filamentous fungal host cell is a Thielavia terrestris cell or an Acremonium chrysogenum cell. In another most preferred embodiment, the Trichoderma cell is a Trichoderma harzianum, Trichoderma koningii, Trichoderma longibrachiatum, Trichoderma reesei or Trichoderma viride cell. The use of Aspergillus spp. for the expression of proteins is described in, e.g., EP 272 277, EP 230 023.
  • Transformation
  • Fungal cells may be transformed by a process involving protoplast formation, transformation of the protoplasts, and regeneration of the cell wall in a manner known per se. Suitable procedures for transformation of Aspergillus host cells are described in EP 238 023 25 and Yelton et al., 1984, Proceedings of the National Academy of Sciences USA 81:1470-1474. A suitable method of transforming Fusarium species is described by Malardier et al., 1989, Gene 78:147-156 or in copending U.S. Ser. No. 08/269,449. Examples of other fungal cells are cells of filamentous fungi, e.g. Aspergillus spp., Neurospora spp., Fusarium spp. or Trichoderma spp., in particular strains of A. oryzae, A. nidulans or A. niger. The use of Aspergillus spp. for the expression of proteins is described in, e.g., EP 272 277, EP 230 023. The transformation of F. oxysporum may, for instance, be carried out as described by Malardier et al., 1989, Gene 78: 147-156.
  • Yeast may be transformed using the procedures described by Becker and Guarente, In Abelson, J. N. and Simon, M. I., editors, Guide to Yeast Genetics and Molecular Biology, Methods in Enzymology, Volume 194, pp 182-187, Academic Press, Inc., New York; Ito et al., 1983, Journal of Bacteriology 153:163; and Hinnen et al., 1978, Proceedings of the National Academy of Sciences USA 75:1920. Mammalian cells may be transformed by direct uptake using the calcium phosphate precipitation method of Graham and Van der Eb (1978, Virology 52:546).
  • Transformation of insect cells and production of heterologous polypeptides therein may be performed as described in U.S. Pat. No. 4,745,051; U.S. Pat. No. 4,775,624; U.S. Pat. No. 4,879,236; U.S. Pat. No. 5,155,037; U.S. Pat. No. 5,162,222; EP 397,485) all of which are incorporated herein by reference. The insect cell line used as the host may suitably be a Lepidoptera cell line, such as Spodoptera frugiperda cells or Trichoplusia ni cells (cf. U.S. Pat. No. 5,077,214). Culture conditions may suitably be as described in, for instance, WO 89/01029 or WO 89/01028, or any of the aforementioned references.
  • Methods of Production
  • The transformed or transfected host cells described above are cultured in a suitable nutrient medium under conditions permitting the production of the desired molecules, after which these are recovered from the cells, or the culture broth.
  • The medium used to culture the cells may be any conventional medium suitable for growing the host cells, such as minimal or complex media containing appropriate supplements. Suitable media are available from commercial suppliers or may be prepared according to published recipes (e.g. in catalogues of the American Type Culture Collection). The media are prepared using procedures known in the art (see, e.g., references for bacteria and yeast; Bennett, J. W. and LaSure, L., editors, More Gene Manipulations in Fungi, Academic Press, CA, 1991).
  • If the molecules are secreted into the nutrient medium, they can be recovered directly from the medium. If they are not secreted, they can be recovered from cell lysates. The molecules are recovered from the culture medium by conventional procedures including separating the host cells from the medium by centrifugation or filtration, precipitating the proteinaceous components of the supernatant or filtrate by means of a salt, e.g. ammonium sulphate, purification by a variety of chromatographic procedures, e.g. ion exchange chromatography, gelfiltration chromatography, affinity chromatography, or the like, dependent on the type of molecule in question.
  • The molecules of interest may be detected using methods known in the art that are specific for the molecules. These detection methods may include use of specific antibodies, formation of a product, or disappearance of a substrate. For example, an enzyme assay may be used to determine the activity of the molecule. Procedures for determining various kinds of activity are known in the art.
  • The molecules of the present invention may be purified by a variety of procedures known in the art including, but not limited to, chromatography (e.g., ion exchange, affinity, hydrophobic, chromatofocusing, and size exclusion), electrophoretic procedures (e.g., preparative isoelectric focusing (IEF), differential solubility (e.g., ammonium sulfate precipitation), or extraction (see, e.g., Protein Purification, J -C Janson and Lars Ryden, editors, VCH Publishers, New York, 1989).
  • The term “immunological response”, used in connection with the present invention, is the response of an organism to a compound, which involves the immune system according to any of the four standard reactions (Type I, II, III and IV according to Coombs & Gell).
  • Correspondingly, the “immunogenicity” of a compound used in connection with the present invention refers to the ability of this compound to induce an ‘immunological response’ in animals including man.
  • The term “allergic response”, used in connection with the present invention, is the response of an organism to a compound, which involves IgE mediated responses (Type I reaction according to Coombs & Gell). It is to be understood that sensibilization (i.e. development of compound-specific IgE antibodies) upon exposure to the compound is included in the definition of “allergic response”.
  • Correspondingly, the “allergenicity” of a compound used in connection with the present invention refers to the ability of this compound to induce an ‘allergic response’ in animals including man.
  • The term “parent protein” refer to the polypeptide to be modified by creating a library of diversified mutants. The “parent protein” may be a naturally occurring (or wild-type) polypeptide or it may be a variant thereof prepared by any suitable means. For instance, the “parent protein” may be a variant of a naturally occurring polypeptide which has been modified by substitution, deletion or truncation of one or more amino acid residues or by addition or insertion of one or more amino acid residues to the amino acid sequence of a naturally-occurring polypeptide.
  • The term “enzyme variants” or “protein variants” refer to a polypeptide of the invention comprising one or more substitutions of the specified amino acid residues. The total number of such substitutions is typically not more than 10, e.g. one, two, three, four, five or six of said substitutions. In addition, the enzyme variant or protein variant of the invention may optionally include other modifications of the parent enzyme, typically not more than 10, e.g. not more than 5 such modifications. The variant generally has a homology with the parent enzyme of at least 80%, e.g. at least 85%, typically at least 90% or at least 95%.
  • The term “randomized library” of protein variants refers to a library with at least partially randomized composition of the members, e.g. protein variants.
  • An “epitope” is a set of amino acids on a protein that are involved in an immunological response, such as antibody binding or T-cell activation. One particularly useful method of identifying epitopes involved in antibody binding is to screen a library of peptide-phage membrane protein fusions and selecting those that bind to relevant antigen-specific antibodies, sequencing the randomized part of the fusion gene, aligning the sequences involved in binding, defining consensus sequences based on these alignments, and mapping these consensus sequences on the surface or the sequence and/or structure of the antigen, to identify epitopes involved in antibody binding.
  • By the term “epitope pattern” is meant such a consensus sequence of antibody binding peptides. An example is the epitope pattern A R R<R. The sign “<” in this notation indicates that the aligned antibody binding peptides included a non-consensus amino acid between the second and the third arginine.
  • An “epitope area” is defined as the amino acids situated close to the epitope sequence amino acids. Preferably, the amino acids of an epitope area are located <5 Å from the epitope sequence. Hence, an epitope area also includes the corresponding epitope sequence itself. Modifications of amino acids of the ‘epitope area’ can possibly affect the immunogenic function of the corresponding epitope.
  • By the term “epitope sequence” is meant the amino acid residues of a parent protein, which have been identified to belong to an epitope by the methods of the present invention (an example of an epitope sequence is E271 Q12 18 in Savinase).
  • The term ‘antibody binding peptide’ denotes a peptide that bind with sufficiently high affinity to antibodies. Identification of ‘antibody binding peptides’ and their sequences constitute the first step of the method of this invention.
  • “Anchor amino acids” are the individual amino acids of an epitope pattern.
  • “Hot spot amino acids” are amino acids of parent protein, which are particularly likely to result in modified immunogenecity if they are mutated. Amino acids, which appear in three or more epitope sequences or which correspond to anchor amino acids are hot spot amino acids.
  • “Environmental allergens” are protein allergens that are present naturally. They include pollen, dust mite allergens, pet allergens, food allergens, venoms, etc.
  • “Commercial allergens” are protein allergens that are being brought to the market commercially. They include enzymes, pharmaceutical proteins, antimicrobial peptides, as well as allergens of transgenic plants.
  • The “donor protein” is the protein that was used to raise antibodies used to identify antibody binding sequences, hence the donor protein provides the information that leads to the epitope patterns.
  • The “acceptor protein” is the protein, whose structure is used to fit the identified epitope patterns and/or to fit the antibody binding sequences. Hence the acceptor protein is also the parent protein.
  • An “autoepitope” is one that has been identified using antibodies raised against the parent protein, i.e. the acceptor and the donor proteins are identical.
  • A “heteroepitope” is one that has been identified with distinct donor and acceptor proteins.
  • The term “functionality” of protein variants refers to e.g. enzymatic activity; binding to a ligand or receptor; stimulation of a cellular response (e.g. 3H-thymidine incorporation as response to a mitogenic factor); or anti-microbial activity.
  • By the term “specific polyclonal antibodies” is meant polyclonal antibodies isolated according to their specificity for a certain antigen, e.g. the protein backbone.
  • By the term “monospecific antibodies” is meant polyclonal antibodies isolated according to their specificity for a certain epitope. Such monospecific antibodies will bind to the same epitope, but with different affinity, as they are produced by a number of antibody producing cells recognizing overlapping but not necessarily identical epitopes.
  • The term “randomized library” of protein variants refers to a library with at least partially randomized composition of the members, e.g. protein variants.
  • ‘Spiked mutagenesis’ is a form of site-directed mutagenesis, in which the primers used have been synthesized using mixtures of oligonucleotides at one or more positions.
  • By the term “a protein variant having modified immunogenicity as compared to the parent protein” is meant a protein variant which differs from the parent protein in one or more amino acids whereby the immunogenicity of the variant is modified. The modification of immunogenicity may be confirmed by testing the ability of the protein variant to elicit an IgE/lgG response.
  • In the present context the term “protein” is intended to cover oligopeptides, polypeptides as well as proteins as such.
  • DETILED DESCRIPTION OF THE INVENTION
  • The present invention relates to a method of selecting a protein variant having modified immunogenicity as compared to a parent protein, comprising the steps of:
  • a) obtaining antibody binding peptide sequences,
  • b) using the sequences to localise epitope sequences on the 3-dimensional structure of parent protein,
  • c) defining an epitope area including amino acids situated within 5 Å from the epitope amino acids constituting the epitope sequence,
  • d) changing one or more of the amino acids defining the epitope area of the parent protein by genetic engineering mutations of a DNA sequence encoding the parent protein,
  • e) introducing the mutated DNA sequence into a suitable host, culturing said host and expressing the protein variant, and
  • f) evaluating the immunogenicity of the protein variant using the parent protein as reference.
  • A) How to Find Antibody Binding Peptide Sequences and Epitope Patterns
  • A first step of the method is to identify peptide sequences, which bind specifically to antibodies.
  • Antibody binding peptide sequences can be found by testing a set of known peptide sequences for binding to antibodies raised against the donor protein. These sequences are typically selected, such that each represents a segment of the donor protein sequence (Mol. Immunol., 1992, vol. 29, pp. 1383-1389; Am. J. Resp. Cell. Mol. Biol. 2000, vol. 22, pp. 344-351). Also, randomized synthetic peptide libraries can be used to find antibody binding sequences (Slootstra et al; Molecular Diversity, 1996, vol. 2, pp. 156-164).
  • In a preferred method, the identification of antibody binding sequences may be achieved by screening of a display package library, preferably a phage display library. The principle behind phage display is that a heterologous DNA sequence can be inserted in the gene coding for a coat protein of the phage (WO 92/15679). The phage will make and display the hybrid protein on its surface where it can interact with specific target agents. Such target agent may be antigen-specific antibodies. It is therefore possible to select specific phages that display antibody-binding peptide sequences. The displayed peptides can be of predetermined lengths, for example 9 amino acids long, with randomized sequences, resulting in a random peptide display package library. Thus, by screening for antibody binding, one can isolate the peptide sequences that have sufficiently high affinity for the particular antibody used. The peptides of the hybrid proteins of the specific phages which bind protein-specific antibodies characterize epitopes that are recognized by the immune system.
  • The antibodies used for reacting with the display package are preferably lgE antibodies to ensure that the epitopes identified are IgE epitopes, i.e. epitopes inducing and binding IgE. In a preferred embodiment the antibodies are polyclonal antibodies, optionally monospecific antibodies.
  • For the purpose of the present invention polyclonal antibodies are preferred in order to obtain a broader knowledge about the epitopes of a protein.
  • It is of great importance that the amino acid sequence of the peptides presented by the display packages is long enough to represent a significant part of the epitope to be identified. In a preferred embodiment of the invention the peptides of the peptide display package library are oligopeptides having from 5 to 25 amino acids, preferably at least 8 amino acids, such as 9 amino acids. For a given length of peptide sequences (n), the theoretical number of different possible sequences can be calculated as 20n. The diversity of the package library used must be large enough to provide a suitable representation of the theoretical number of different sequences. In a phage-display library, each phage has one specific sequence of a determined length. Hence an average phage display library can express 108−1012 different random sequences, and is therefore well-suited to represent the theoretical number of different sequences.
  • The antibody binding peptide sequences can be further analysed by consensus alignment e.g. by the methods described by Feng and Doolittle, Meth. Enzymol., 1996, vol. 266, pp. 368-382; Feng and Doolittle, J. Mol. Evol., 1987, vol. 25, pp. 351-360; and Taylor,. Meth. Enzymol., 1996, vol. 266, pp. 343-367.
  • This leads to identification of epitope patterns, which can assist the comparison of the linear information obtained from the antibody binding peptide sequences to the 3-dimensional structure of the acceptor protein in order to identify epitope sequences at the surface of the acceptor protein.
  • B) How to Identify Epitope Sequences and Epitope Areas
  • Given a number of antibody binding peptide sequences and possibly the corresponding epitope patterns, one need the 3-dimensional structure coordinates of an acceptor protein to find the epitope sequences on its surface.
  • These coordinates can be found in databases (NCBI: http://www.ncbi.nlm.nih.gov/), determined experimentally using conventional methods (Ducruix and Giegé: Crystallization of Nucleic Acids and Proteins, IRL PRess, Oxford, 1992, ISBN 0-19-963245-6), or they can be deduced from the coordinates of a homologous protein. Typical actions required for the construction of a model structure are: alignment of homologous sequences for which 3-dimensional structures exist, definition of Structurally Conserved Regions (SCRs), assignment of coordinates to SCRs, search for structural fragments/loops in structure databases to replace Variable Regions, assignment of coordinates to these regions, and structural refinement by energy minimization. Regions containing large inserts (>3 residues) relative to the known 3-dimensional structures are known to be quite difficult to model, and structural predictions must be considered with care.
  • Using the coordinates and the several methods of mapping the linear information on the 3-dimensional surface are possible, as described in the examples below.
  • One can match each amino acid residue of the antibody binding peptide to an identical or homologous amino acid on the 3-D surface of the acceptor protein, such that amino acids that are adjacent in the primary sequence are close on the surface of the acceptor protein, with close being <5 Å, preferably <3 Å between any two atoms of the two amino acids.
  • Alternatively, one can define a geometric body (e.g. an ellipsoid, a sphere, or a box) of a size that matches a possible binding interface between antibody and antigen and look for a positioning of this body where it will contain most of or all the anchor amino acids.
  • Also, one can use the epitope patterns to facilitate identification of epitope sequences. This can be done, by first matching the anchor amino acids on the 3-D structure and subsequently looking for other elements of the antibody binding peptide sequences, which provide additional matches. If there are many residues to be matched, it is only necessary that a suitable number can be found on the 3-D structure. For example if an epitope pattern comprises 4, 5, 6, or 7 amino acids, it is only necessary that 3 matches surface elements of the acceptor protein.
  • In all cases, it is desirable that amino acids of the epitope sequence are surface exposed (as described below in Examples).
  • It is known, that amino acids that surround binding sequences can affect binding of a ligand without participating actively in the binding process. Based on this knowledge, areas covered by amino acids with potential steric effects on the epitope-antibody interaction, were defined around the identified epitope sequences. These areas are called ‘epitope areas’. Practically, all amino acids situated within 5 Å from the amino acids defining the epitope sequence were included. Preferably, the epitope area equals the epitope sequence. The accessibility criterium was not used as hidden amino acids of an epitope area also can have an effect on the adjacent amino acids of the epitope sequence.
  • C) How to Use the Epitope Information
  • There are at least four ways to utilize the information about epitope sequences, which has been derived by the methods of this invention:
  • 1) reduce the allergenicity of a commercial protein using protein engineering.
  • 2) reduce the potential of commercial proteins to cross-react with environmental allergens and hence cause allergic reactions in people sensitized to the environmental allergens (or vice versa).
  • 3) improve the immunotherapeutic effect of allergen vaccines.
  • 4) assist characterization of clinical allergies in order to select the appropriate allergen vaccine.
  • Protein Engineering to Reduce the Allergenicity, Cross-Reactivity and/or Immunotherapeutic Effect of Proteins
  • The methods described thus far have led to identification of epitope areas on an acceptor protein, each containing epitope sequences. These subsets of amino acids, are preferred for introducing mutations that are meant to modify the immunogenecity of the acceptor protein. An even more preferred subset of amino acids to target by mutagenesis are ‘hot spot amino acids’, which appear in several different epitope sequences, or which corresponds to anchor amino acids of the epitope patterns.
  • Thus, genetic engineering mutations should be designed in the epitope areas, preferably in epitope sequences, and more preferably in the ‘hot spot amino acids’.
  • Substitution, Deletion, Insertion
  • When the epitope area(s) have been identified, a protein variant exhibiting a modified immunogenicity may be produced by changing the identified epitope area of the parent protein by genetic engineering mutation of a DNA sequence encoding the parent protein.
  • The epitope identified may be changed by substituting at least one amino acid of the epitope area. In a preferred embodiment at least one anchor amino acid or hot spot amino acid is changed. The change will often be substituting to an amino acid of different size, hydrophilicity, and/or polarity, such as a small amino acid versus a large amino acid, a hydrophilic amino acid versus a hydrophobic amino acid, a polar amino acid versus a non-polar amino acid and a basic versus an acidic amino acid.
  • Other changes may be the addition/insertion or deletion of at least one amino acid of the epitope sequence, preferably deleting an anchor amino acid or a hot spot amino acid. Furthermore, an epitope pattern may be changed by substituting some amino acids, and deleting/adding other.
  • In the claims a position to be changed by substitution, insertion, deletion will be indicated by: “Position xx to aaa, bbb, ccc, insertion, deletion”, meaning that position xx can be substituted by the amino acid aaa, bbb, ccc or that any amino acid can be inserted after position xx or that position xx can be deleted, e.g. “Position 27 to A, D, E, insertion, deletion” means that in position 27 the amino acid can be substituted by A, D or E, or that any amino acid can be inserted after position 27, or that the amino acid in position 27 can be deleted.
  • When one uses protein engineering to eliminate epitopes, it is indeed possible that new epitopes are created, or existing epitopes are duplicated. To reduce this risk, one can map the planned mutations at a given position on the 3-dimensional structure of the protein of interest, and control the emerging amino acid constellation against a database of known epitope patterns, to rule out those possible replacement amino acids, which are predicted to result in creation or duplication of epitopes. Thus, risk mutations can be identified and eliminated by this procedure, thereby reducing the risk of making mutations that lead to increased rather than decreased allergenicity.
  • Introduction of Residues for Chemical Derivatization in Epitope Areas
  • In yet another embodiment, one can design the mutation, such that amino acids suitable for chemical modification are substituted for existing ones in the epitope areas. The protein variant can then be conjugated to activated polymers. Which amino acids to substitute and/or insert, depends in principle on the coupling chemistry to be applied. The chemistry for preparation of covalent bioconjugates can be found in “Bioconjugate Techniques”, Hermanson, G. T. (1996), Academic Press Inc., which is hereby incorporated as reference (see below). It is preferred to make conservative substitutions in the polypeptide when the polypeptide has to be conjugated, as conservative substitutions secure that the impact of the substitution on the polypeptide structure is limited. In the case of providing additional amino groups this may be done by substitution of arginine to lysine, both residues being positively charged, but only the lysine having a free amino group suitable as an attachment groups. In the case of providing additional carboxylic acid groups the conservative substitution may for instance be an asparagine to aspartic acid or glutamine to glutamic acid substitution. These residues resemble each other in size and shape, except from the carboxylic groups being present on the acidic residues. In the case of providing SH-groups the conservative substitution may be done by changing threonine or serine to cysteine.
  • Chemical Conjugation
  • For chemical conjugation, the protein variant needs to be incubate with an active or activated polymer and subsequently separated from the unreacted polymer. This can be done in solution followed by purification or it can conveniently be done using the immobilized protein variants, which can easily be exposed to different reaction environments and washes.
  • In the case were polymeric molecules are to be conjugated with the polypeptide in question and the polymeric molecules are not active they must be activated by the use of a suitable technique. It is also contemplated according to the invention to couple the polymeric molecules to the polypeptide through a linker. Suitable linkers are well-known to the skilled person. Methods and chemistry for activation of polymeric molecules as well as for conjugation of polypeptides are intensively described in the literature. Commonly used methods for activation of insoluble polymers include activation of functional groups with cyanogen bromide, periodate, glutaraldehyde, biepoxides, epichlorohydrin, divinylsulfone, carbodiimide, sulfonyl halides, trichlorotriazine etc. (see R. F. Taylor, (1991), “Protein immobilisation. Fundamental and applications”, Marcel Dekker, N.Y.; S. S. Wong, (1992), “Chemistry of Protein Conjugation and Crosslinking”, CRC Press, Boca Raton; G. T. Hermanson et al., (1993), “Immobilized Affinity Ligand Techniques”, Academic Press, N.Y.). Some of the methods concern activation of insoluble polymers but are also applicable to activation of soluble polymers e.g. periodate, trichlorotriazine, sulfonylhalides, divinylsulfone, carbodiimide etc. The functional groups being amino, hydroxyl, thiol, carboxyl, aldehyde or sulfydryl on the polymer and the chosen attachment group on the protein must be considered in choosing the activation and conjugation chemistry which normally consist of i) activation of polymer, ii) conjugation, and iii) blocking of residual active groups.
  • In the following a number of suitable polymer activation methods will be described shortly. However, it is to be understood that also other methods may be used.
  • Coupling polymeric molecules to the free acid groups of polypeptides may be performed with the aid of diimide and for example amino-PEG or hydrazino-PEG (Pollak et al., (1976), J. Am. Chem. Soc., 98, 289-291) or diazoacetate/amide (Wong et al., (1992), “Chemistry of Protein Conjugation and Crosslinking”, CRC Press).
  • Coupling polymeric molecules to hydroxy groups is generally very difficult as it must be performed in water. Usually hydrolysis predominates over reaction with hydroxyl groups.
  • Coupling polymeric molecules to free sulfhydryl groups can be achieved with special groups like maleimido or the ortho-pyridyl disulfide. Also vinylsulfone (U.S. Pat. No. 5,414,135, (1995), Snow et al.) has a preference for sulfhydryl groups but is not as selective as the other mentioned.
  • Accessible arginine residues in the polypeptide chain may be targeted by groups comprising two vicinal carbonyl groups.
  • Techniques involving coupling of electrophilically activated PEGs to the amino groups of Lysines may also be useful. Many of the usual leaving groups for alcohols give rise to an amine linkage. For instance, alkyl sulfonates, such as tresylates (Nilsson et al., (1984), Methods in Enzymology vol. 104, Jacoby, W. B., Ed., Academic Press: Orlando, p. 56-66; Nilsson et al., (1987), Methods in Enzymology vol. 135; Mosbach, K., Ed.; Academic Press: Orlando, pp. 65-79; Scouten et al., (1987), Methods in Enzymology vol. 135, Mosbach, K., Ed., Academic Press: Orlando, 1987; pp 79-84; Crossland et al., (1971), J. Amr. Chem. Soc. 1971, 93, pp. 4217-4219), mesylates (Harris, (1985), supra; Harris et al., (1984), J. Polym. Sci. Polym. Chem. Ed. 22, pp 341-352), aryl sulfonates like tosylates, and para-nitrobenzene sulfonates can be used.
  • Organic sulfonyl chlorides, e.g. Tresyl chloride, effectively converts hydroxy groups in a number of polymers, e.g. PEG, into good leaving groups (sulfonates) that, when reacted with nucleophiles like amino groups in polypeptides allow stable linkages to be formed between polymer and polypeptide. In addition to high conjugation yields, the reaction conditions are in general mild (neutral or slightly alkaline pH, to avoid denaturation and little or no disruption of activity), and satisfy the non-destructive requirements to the polypeptide.
  • Tosylate is more reactive than the mesylate but also less stable decomposing into PEG, dioxane, and sulfonic acid (Zalipsky, (1995), Bioconjugate Chem., 6, 150-165). Epoxides may also been used for creating amine bonds but are much less reactive than the abovementioned groups.
  • Converting PEG into a chloroformate with phosgene gives rise to carbamate linkages to Lysines. Essentially the same reaction can be carried out in many variants substituting the chlorine with N-hydroxy succinimide (U.S. Pat. No. 5,122,614, (1992); Zalipsky et al., (1992), Biotechnol. Appl. Biochem., 15, p. 100-114; Monfardini et al., (1995), Bioconjugate Chem., 6, 62-69, with imidazole (Allen et al., (1991), Carbohydr. Res., 213, pp 309-319), with para-nitrophenol, DMAP (EP 632 082 A1, (1993), Looze, Y.) etc. The derivatives are usually made by reacting the chloroformate with the desired leaving group. All these groups give rise to carbamate linkages to the peptide.
  • Furthermore, isocyanates and isothiocyanates may be employed, yielding ureas and thioureas, respectively.
  • Amides may be obtained from PEG acids using the same leaving groups as mentioned above and cyclic imid thrones (U.S. Pat. No. 5,349,001, (1994), Greenwald et al.). The reactivity of these compounds are very high but may make the hydrolysis to fast.
  • PEG succinate made from reaction with succinic anhydride can also be used. The hereby comprised ester group make the conjugate much more susceptible to hydrolysis (U.S. Pat. No. 5,122,614, (1992), Zalipsky). This group may be activated with N-hydroxy succinimide.
  • Furthermore, a special linker can be introduced. The most well studied being cyanuric chloride (Abuchowski et al., (1977), J. Biol. Chem., 252, 3578-3581; U.S. Pat. No. 4,179,337, (1979), Davis et al.; Shafer et al., (1986), J. Polym. Sci. Polym. Chem. Ed., 24, 375-378.
  • Coupling of PEG to an aromatic amine followed by diazotation yields a very reactive diazonium salt, which can be reacted with a peptide in situ. An amide linkage may also be obtained by reacting an azlactone derivative of PEG (U.S. Pat. No. 5,321,095, (1994), Greenwald, R. B.) thus introducing an additional amide linkage.
  • As some peptides do not comprise many Lysines it may be advantageous to attach more than one PEG to the same Lysine. This can be done e.g. by the use of 1,3-diamino-2-propanol.
  • PEGs may also be attached to the amino-groups of the enzyme with carbamate linkages (WO 95/11924, Greenwald et al.). Lysine residues may also be used as the backbone.
  • The coupling technique used in the examples is the N-succinimidyl carbonate conjugation technique descried in WO 90/13590 (Enzon).
  • In a preferred embodiment, the activated polymer is methyl-PEG which has been activated by N-succinimidyl carbonate as described WO 90/13590. The coupling can be carried out at alkaline conditions in high yields.
  • For coupling of polymers to the protein variants, it is preferred to use conditions similar to those described in WO 96/17929 and WO 99/00489 (Novo Nordisk A/S) e.g. mono or bis activated PEG's of molecular weight ranging from 100 to 5000 Da. For instance, a methyl-PEG 350 could be activated with N-succinimidyl carbonate and incubated with protein variant at a molar ratio of more than 5 calculated as equivalents of activated PEG divided by moles of lysines in the protein of interest. For coupling to immobilized protein variant, the PEG:protein ratio should be optimized such that the PEG concentration is low enough for the buffer capacity to maintain alkaline pH throughout the reaction; while the PEG concentration is still high enough to ensure sufficient degree of modification of the protein. Further, it is important that the activated PEG is kept at conditions that prevent hydrolysis (i.e. dissolved in acid or solvents) and diluted directly into the alkaline reaction buffer. It is essential that primary amines are not present other than those occurring in the lysine residues of the protein. This can be secured by washing thoroughly in borate buffer. The reaction is stopped by separating the fluid phase containing unreacted PEG from the solid phase containing protein and derivatized protein. Optionally, the solid phase can then be washed with tris buffer, to block any unreacted sites on PEG chains that might still be present.
  • Introduction of Consensus Sequences for Post-Translational Modifications in the Epitope Areas In another embodiment, the mutations are designed, such that recognition sites for post-translational modifications are introduced in the epitope areas, and the protein variant is expressed in a suitable host organism capable of the corresponding post-translational modification. These post-translational modifications may serve to shield the epitope and hence lower the immunogenicity of the protein variant relative to the protein backbone. Post-translational modifications include glycosylation, phosphorylation, N-terminal processing, acylation, ribosylation and sulfatation. A good example is N-glycosylation. N-glycosylation is found at sites of the sequence Asn-Xaa-Ser, Asn-Xaa-Thr, or Asn-Xaa-Cys, in which neither the Xaa residue nor the amino acid following the tri-peptide consensus sequence is a proline (T. E. Creighton, ‘Proteins—Structures and Molecular Properties, 2nd edition, W. H. Freeman and Co., New York, 1993, pp. 91-93). It is thus desirable to introduce such recognition sites in the sequence of the backbone protein. The specific nature of the glycosyl chain of the glycosylated protein variant may be linear or branched depending on the protein and the host cells. Another example is phosphorylation: The protein sequence can be modified so as to introduce serine phophorylation sites with the recognition sequence arg-arg-(xaa)n-ser (where n=0, 1, or 2) (SEQ ID NOS: 38 and 39), which can be phosphorylated by the cAMP-dependent kinase or tyrosine phosphorylation sites with the recognition sequence -lys/arg-(xaa)3-asp/glu- (xaa)3-tyr (SEQ ID NO: 40), which can usually be phophorylated by tyrosine-specific kinases (T. E. Creighton, “Proteins—Structures and molecular properties”, 2nd ed., Freeman, N.Y., 1993).
  • Randomized Approaches to Introduce Modifications in Epitope Areas
  • In order to generate protein variants, more than one amino acid residue may be substituted, added or deleted, these amino acids preferably being located in different epitope areas. In that case, it may be difficult to assess a priori how well the functionality of the protein is maintained while antigenicity is reduced, especially since the possible number of mutation-combinations becomes very large, even for a small number of mutations. In that case, it will be an advantage, to establish a library of diversified mutants each having one or more changed amino acids introduced and selecting those variants, which show good retention of function and at the same time a significant reduction in antigenicity.
  • A diversified library can be established by a range of techniques known to the person skilled in the art (Reetz M T; Jaeger K E, in ‘Biocatalysis—from Discovery to Application’ edited by Fessner W D, Vol. 200, pp. 31-57 (1999); Stemmer, Nature, vol. 370, p.389-391, 1994; Zhao and Arnold, Proc. Natl. Acad. Sci., USA, vol. 94, pp. 7997-8000, 1997; or Yano et al., Proc. Natl. Acad. Sci., USA, vol. 95, pp 5511-5515, 1998). These include, but are not limited to, ‘spiked mutagenesis’, in which certain positions of the protein sequence are randomized by carring out PCR mutagenesis using one or more oligonucleotide primers which are synthesized using a mixture of nucleotides for certain positions (Lanio T, Jeltsch A, Biotechniques, Vol. 25(6), 958,962,964-965 (1998)). The mixtures of oligonucleotides used within each triplet can be designed such that the corresponding amino acid of the mutated gene product is randomized within some predetermined distribution function. Algorithms have been disclosed, which facilitate this design (Jensen L J et al., Nucleic Acids Research, Vol. 26(3), 697-702 (1998)).
  • In an embodiment substitutions are found by a method comprising the following steps: 1) a range of substitutions, additions, and/or deletions are listed encompassing several epitope areas (preferably in the corresponding epitope sequences, anchor amino aids, and/or hot spots), 2) a library is designed which introduces a randomized subset of these changes in the amino acid sequence into the target gene, e.g. by spiked mutagenesis, 3) the library is expressed, and preferred variants are selected. In another embodiment, this method is supplemented with additional rounds of screening and/or family shuffling of hits from the first round of screening (J. E. Ness, et al, Nature Biotechnology, vol. 17, pp. 893-896, 1999) and/or combination with other methods of reducing immunogenicity by genetic means (such as that disclosed in WO 92/10755).
  • The library may be designed, such that at least one amino acid of the epitope area is substituted. In a preferred embodiment at least one amino acid of the epitope sequence itself is changed, and in an even more preferred embodiment, one or more hot spot amino acids are changed. The library may be biased such that towards introducing an amino acid of different size, hydrophilicity, and/or polarity relative to the original one of the ‘protein backbone’. For example changing a small amino acid to a large amino acid, a hydrophilic amino acid to a hydrophobic amino acid, a polar amino acid to a non-polar amino acid or a basic to an acidic amino acid. Other changes may be the addition or deletion of at least one amino acid of the epitope area, preferably deleting an anchor amino acid. Furthermore, substituting some amino acids and deleting or adding others may change an epitope.
  • Diversity in the protein variant library can be generated at the DNA triplet level, such that individual codons are variegated e.g. by using primers of partially randomized sequence for a PCR reaction. Further, several techniques have been described, by which one can create a library with such diversity at several locations in the gene, which are too far apart to be covered by a single (spiked) oligonucleotide primer. These techniques include the use of in vivo recombination of the individually diversified gene segments as described in WO 97/07205 on page 3, line 8 to 29 or by using DNA shuffling techniques to create a library of full length genes that combine several gene segments each of which are diversified e.g. by spiked mutagenesis (Stemmer, Nature 370, pp. 389-391, 1994 and U.S. Pat. Nos. 5,605,793 and 5,830,721). In the latter case, one can use the gene encoding the “protein backbone” as a template double-stranded polynucleotide and combining this with one or more single or double-stranded oligonucleotides as described in claim 1 of U.S. Pat. No. 5,830,721. The single-stranded oligonucleotides could be partially randomized during synthesis. The double-stranded oligonucleotides could be PCR products incorporating diversity in a specific region. In both cases, one can dilute the diversity with corresponding segments containing the sequence of the backbone protein in order to limit the number of changes that are on average introduced. As mentioned above, methods have been established for designing the ratios of nucleotides (A; C; T; G) used at a particular codon during primer synthesis, so as to approximate a desired frequency distribution among a set of desired amino acids at that particular codon. This allows one to bias the partially randomized mutagenesis towards e.g. introduction of post-translational modification sites, chemical modification sites, or simply amino acids that are different from those that define the epitope or the epitope area. One could also approximate a sequence in a given location or epitope area to the corresponding location on a homologous, human protein.
  • Occasionally, one would be interested in testing a library that combines a number of known mutations in different locations in the primary sequence of the ‘protein backbone’. These could be introduced post-translational or chemical modification sites, or they could be mutations, which by themselves had proven beneficial for one reason or another (e.g. decreasing antigenicity, or improving specific activity, performance, stability, or other characteristics). In such cases, it may be desirable to create a library of diverse combinations of known sequences. For example if 12 individual mutations are known, one could combine (at least) 12 segments of the ‘protein backbone’ gene in which each segment is present in two forms: one with and one without the desired mutation. By varying the relative amounts of those segments, one could design a library (of size 212) for which the average number of mutations per gene can be predicted. This can be a useful way of combining elements that by themselves give some, but not sufficient effect, without resorting to very large libraries, as is often the case when using ‘spiked mutagenesis’. Another way to combine these ‘known mutations’ could be by using family shuffling of oligomeric DNA encoding the known changes with fragments of the full length wild type sequence.
  • Assays for Reduced Allergenicity
  • When protein variants have been constructed based on the methods described in this invention, it is desirable to confirm their antibody binding capacity, functionality, immunogenicity and/or allergenicity using a purified preparation. For that use, the protein variant of interest can be expressed in larger scale, purified by conventional techniques, and the antibody binding and functionality should be examined in detail using dose-response curves and e.g. direct or competitive ELISA (C-ELISA).
  • The potentially reduced allergenicity (which is likely, but not necessarily true for a variant w. low antibody binding) should be tested in in vivo or in vitro model systems: e.g. an in vitro assays for immunogenicity such as assays based on cytokine expression profiles or other proliferation or differentiation responses of epithelial and other cells inc. B-cells and T-cells. Further, animal models for testing allergenicity should be set up to test a limited number of protein variants that show desired characteristics in vitro. Useful animal models include the guinea pig intratracheal model (GPIT) (Ritz, et al. Fund. Appl. Toxicol., 21, pp. 31-37, 1993), mouse subcutaneous (mouse-SC) (WO 98/30682, Novo Nordisk), the rat intratracheal (rat-IT) (WO 96/17929, Novo Nordisk), and the mouse intranasal (MINT) (Robinson et al., Fund. Appl. Toxicol. 34, pp. 15-24, 1996) models.
  • The immunogenicity of the protein variant is measured in animal tests, wherein the animals are immunised with the protein variant and the immune response is measured. Specifically, it is of interest to determine the allergenicity of the protein variants by repeatedly exposing the animals to the protein variant by the intratracheal route and following the specific IgG and IgE titers. Alternatively, the mouse intranasal (MINT) test can be used to assess the allergenicity of protein variants. By the present invention the allergenicity is reduced at least 3 times as compared to the allergenicity of the parent protein, preferably 10 times reduced, more preferably 50 times.
  • However, the present inventors have demonstrated that the performance in ELISA correlates closely to the immunogenic responses measured in animal tests. To obtain a useful reduction of the allergenicity of a protein, the IgE binding capacity of the protein variant must be reduced to at least below 75%, preferably below 50%, more preferably below 25% of the IgE binding capacity of the parent protein as measured by the performance in IgE ELISA, given the value for the IgE binding capacity of the parent protein is set to 100%.
  • Thus a first asessment of the immunogenicity and/or allergenicity of a protein can be made by measuring the antibody binding capacity or antigenicity of the protein variant using appropriate antibodies. This approach has also been used in the literature (WO 99/47680).
  • Assays for Altered Immunotherapeutic Effect
  • The immunotherapeutic effect of allergen vaccines can be assessed a number of different ways. One is to measure the specific IgE binding, the reduction of which indicates a better allergen vaccine potential (WO 99/47680, ALK-ABELLÓ). Also, several cellular assays could be employed to show the modified immuneresponse indicative of good allergen vaccine potential as shown in several publications, all of which are hereby incorporated by reference (van Neerven et al, “T lymphocyte responses to allergens: Epitope-specificity and clinical relevance”, Immunol Today, 1996, vol. 17, pp. 526-532; Hoffmann et al., Allergy, 1999, vol. 54, pp. 446-454, WO 99/07880).
  • Eventually, clinical trials with allergic patients could be employed using cellular or clinical end-point measurements. (Ebner et al., Clin. Exp. All., 1997, vol. 27, pp. 107-1015; Int. Arch. Allergy Immunol., 1999, vol. 119, pp 1-5).
  • Determining Functionality
  • A wide variety of protein functionality assays are available in the literature. Especially, those suitable for automated analysis are useful for this invention. Several have been published in the literature such as protease assays (WO 99/34011, Genencor International; J. E. Ness, et al, Nature Biotechn., 17, pp. 893-896, 1999), oxidoreductase assays (Cherry et al., Nature Biotechn., 17, pp. 379-384, 1999, and assays for several other enzymes (WO 99/45143, Novo Nordisk). Those assays that employ soluble substrates can be employed for direct analysis of functionality of immobilized protein variants.
  • Cross-Reactivity
  • A related objective is to reduce cross-reactivity between ‘commercial allergens’ and ‘environmental allergens’. Cross-reactivities between food allergens of different origin are well-known (Akkerdaas et al, Allergy 50, pp 215-220, 1995). Similarly, cross-reactivities between other environmental allergens (like pollen, dust mites etc.) and commercial allergens (like enzyme proteins) have been established in the literature (J. All. Clin. Immunol., 1998, vol. 102, pp. 679-686 and by the present inventors. The molecular reason for this cross-reactivity can be explored using epitope mapping. By finding epitope patterns using antibodies raised against environmental allergen (donor protein) and mapping this information on a commercial allergen (the acceptor protein), one may find the epitopes that are common to both proteins, and hence responsible for the cross-reactivity. Obviously, one can also use the commercial allergen as donor and the environmental allergen as acceptor. By modifying the commercial allergen using protein engineering in the epitope areas identified as described above, one can reduce the cross-reactivity of the commercial allergen variant towards the environmental allergens (and vice versa). Hence, the use of the modified commercial allergens would be safer than using the unmodified commercial allergen.
  • Testing of this approach would be done using an antibody-binding assay with the protein variant (and its parent protein as control) and antibodies raised against the protein that cross-reacts with the parent protein. The method is otherwise identical to those described in the Methods section for characterization of allergencitiy and antigenicity.
  • Wash Performance etc.
  • The modifications of the enzymes in the epitope areas as disclosed the present application may cause other effects to the enzyme than modified immunogenicity. A modification may also change the performance of the enzyme, such as the wash performance, thermo stability, storage stability and increased catalytical activity of the enzyme.
  • The ability of an enzyme to catalyze the degradation of various naturally occurring substrates present on the objects to be cleaned during e.g. wash is often referred to as its washing ability, wash-ability, detergency, or wash performance. Throughout this application the term wash performance will be used to encompass this property.
  • Commercial Enzyme Applications
  • Industrial Applications
  • Another aspect of the invention is a composition comprising at least one protein (polypeptide) or enzyme of the invention. The composition may comprise other polypeptides, proteins or enzymes and/or ingredients normally used in personal care products, such as shampoo, soap bars, skin lotion, skin creme, hair dye, toothpaste, household articles, agro chemicals, personal care products, such as cleaning preparations e.g. for contact lenses, cosmetics, toiletries, oral and dermal pharmaceuticals, compositions used for treating textiles, compositions used for manufacturing food, e.g. baking, and feed etc.
  • Examples of said proteins(polypeptides)/enzymes include enzymes exhibiting protease, lipolytic enzyme, oxidoreductase, carbohydrase, transferase, such as transglutaminase, phytase and/or anti-microbial polypeptide activity. These enzymes may be present as conjugates with reduced activity.
  • The protein of the invention may furthermore typically be used in detergent composition. It may be included in the detergent composition in the form of a non-dusting granulate, a stabilized liquid, or a protected enzyme. Non-dusting granulates may be produced, e.g., as disclosed in U.S. Pat. Nos. 4,106,991 and 4,661,452 (both to Novo Industri A/S) and may optionally be coated by methods known in the art. Examples of waxy coating materials are poly(ethylene oxide) products (polyethylene glycol, PEG) with mean molecular weights of 1000 to 20000; ethoxylated nonylphenols having from 16 to 50 ethylene oxide units; ethoxylated fatty alcohols in which the alcohol contains from 12 to 20 carbon atoms and in which there are 15 to 80 ethylene oxide units; fatty alcohols; fatty acids; and mono- and di- and triglycerides of fatty acids. Examples of film-forming coating materials suitable for application by fluid bed techniques are given in patent GB 1483591. Liquid enzyme preparations may, for instance, be stabilized by adding a polyol such as propylene glycol, a sugar or sugar alcohol, lactic acid or boric acid according to established methods. Other enzyme stabilizers are well known in the art. Protected enzymes may be prepared according to the method disclosed in EP 238,216.
  • The detergent composition may be in any convenient form, e.g. as powder, granules, paste or liquid. A liquid detergent may be aqueous, typically containing up to 70% water and 0-30% organic solvent, or non-aqueous.
  • The detergent composition comprises one or more surfactants, each of which may be anionic, nonionic, cationic, or zwitterionic. The detergent will usually contain 0-50% of anionic surfactant such as linear alkylbenzenesulfonate (LAS), alpha-olefinsulfonate (AOS), alkyl sulfate (fatty alcohol sulfate) (AS), alcohol ethoxysulfate (AEOS or AES), secondary alkanesulfonates (SAS), alpha-sulfo fatty acid methyl esters, alkyl- or alkenylsuccinic acid, or soap. It may also contain 0-40% of nonionic surfactant such as alcohol ethoxylate (AEO or AE), carboxylated alcohol ethoxylates, nonylphenol ethoxylate, alkylpolyglycoside, alkyldimethylamine oxide, ethoxylated fatty acid monoethanolamide, fatty acid monoethanolamide, or polyhydroxy alkyl fatty acid amide (e.g. as described in WO 92/06154).
  • The detergent composition may additionally comprise one or more other enzymes, such as e.g. proteases, amylases, lipolytic enzymes, cutinases, cellulases, peroxidases, oxidases, and further anti-microbial polypeptides.
  • The detergent may contain 1-65% of a detergent builder or complexing agent such as zeolite, diphosphate, triphosphate, phosphonate, citrate, nitrilotriacetic acid (NTA), ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTMPA), alkyl- or alkenylsuccinic acid, soluble silicates or layered silicates (e.g. SKS-6 from Hoechst). The detergent may also be unbuilt, i.e. essentially free of detergent builder.
  • The detergent may comprise one or more polymers. Examples are carboxymethylcellulose (CMC), poly(vinylpyrrolidone) (PVP), polyethyleneglycol (PEG), poly(vinyl alcohol) (PVA), polycarboxylates such as polyacrylates, maleiclacrylic acid copolymers and lauryl methacrylate/acrylic acid copolymers.
  • The detergent may contain a bleaching system which may comprise a H 202 source such as perborate or percarbonate which may be combined with a peracid-forming bleach activator such as tetraacetylethylenediamine (TAED) or nonanoyloxybenzenesulfon-ate (NOBS). Alternatively, the bleaching system may comprise peroxyacids of, e.g., the amide, imide, or sulfone type.
  • The detergent composition of the invention comprising the polypeptide of the invention may be stabilized using conventional stabilizing agents, e.g. a polyol such as propylene glycol or glycerol, a sugar or sugar alcohol, lactic acid, boric acid, or a boric acid derivative such as, e.g., an aromatic borate ester, and the composition may be formulated as described in, e.g., WO 92/19709 and WO 92/19708.
  • The detergent may also contain other conventional detergent ingredients such as, e.g., fabric conditioners including clays, foam boosters, suds suppressors, anti-corrosion agents, soil-suspending agents, anti-soil-redeposition agents, dyes, bactericides, optical brighteners, or perfume.
  • The pH (measured in aqueous solution at use concentration) will usually be neutral or alkaline, e.g. in the range of 7-11.
  • Dishwashing Composition
  • Further, a modified enzyme according to the invention may also be used in dishwashing detergents.
  • Dishwashing detergent compositions comprise a surfactant which may be anionic, non-ionic, cationic, amphoteric or a mixture of these types. The detergent will contain 0-90% of non-ionic surfactant such as low- to non-foaming ethoxylated propoxylated straight-chain alcohols.
  • The detergent composition may contain detergent builder salts of inorganic and/or organic types. The detergent builders may be subdivided into phosphorus-containing and non-phosphorus-containing types. The detergent composition usually contains 1-90% of detergent builders.
  • Examples of phosphorus-containing inorganic alkaline detergent builders, when present, include the water-soluble salts especially alkali metal pyrophosphates, orthophosphates, and polyphosphates. An example of phosphorus-containing organic alkaline detergent builder, when present, includes the water-soluble salts of phosphonates. Examples of non-phosphorus-containing inorganic builders, when present, include water-soluble alkali metal carbonates, borates and silicates as well as the various types of water-insoluble crystalline or amorphous alumino silicates of which zeolites are the best-known representatives.
  • Examples of suitable organic builders include the alkali metal, ammonium and substituted ammonium, citrates, succinates, malonates, fatty acid sulphonates, carboxymetoxy succinates, ammonium polyacetates, carboxylates, polycarboxylates, aminopolycarboxylates, polyacetyl carboxylates and polyhydroxsulphonates.
  • Other suitable organic builders include the higher molecular weight polymers and co-polymers known to have builder properties, for example appropriate polyacrylic acid, polymaleic and polyacrylic/polymaleic acid copolymers and their salts.
  • The dishwashing detergent composition may contain bleaching agents of the chlorine/bromine-type or the oxygen-type. Examples of inorganic chlorine/bromine-type bleaches are lithium, sodium or calcium hypochlorite and hypobromite as well as chlorinated trisodium phosphate. Examples of organic chlorine/bromine-type bleaches are heterocyclic N-bromo and N-chloro imides such as trichloroisocyanuric, tribromoisocyanuric, dibromoisocyanuric and dichloroisocyanuric acids, and salts thereof with water-solubilizing cations such as potassium and sodium. Hydantoin compounds are also suitable.
  • The oxygen bleaches are preferred, for example in the form of an inorganic persalt, preferably with a bleach precursor or as a peroxy acid compound. Typical examples of suitable peroxy bleach compounds are alkali metal perborates, both tetrahydrates and monohydrates, alkali metal percarbonates, persilicates and perphosphates. Preferred activator materials are TAED and glycerol triacetate.
  • The dishwashing detergent composition of the invention may be stabilized using conventional stabilizing agents for the enzyme(s), e.g. a polyol such as e.g. propylene glycol, a sugar or a sugar alcohol, lactic acid, boric acid, or a boric acid derivative, e.g. an aromatic borate ester.
  • The dishwashing detergent composition of the invention may also contain other conventional detergent ingredients, e.g. deflocculant material, filler material, foam depressors, anti-corrosion agents, soil-suspending agents, sequestering agents, anti-soil redeposition agents, dehydrating agents, dyes, bactericides, fluorescers, thickeners and perfumes.
  • Finally, the enzyme of the invention may be used in conventional dishwashing-detergents, e.g. in any of the detergents described in any of the following patent publications: EP 518719, EP 518720, EP 518721, EP 516553, EP 516554, EP 516555, GB 2200132, DE 3741617, DE 3727911, DE 4212166, DE 4137470, DE 3833047, WO 93/17089, DE 4205071, WO 52/09680, WO 93/18129, WO 93/04153, WO 92/06157, WO 92/08777, EP 429124, WO 93/21299, U.S. Pat. No. 5,141,664, EP 561452, EP 561446, GB 2234980, WO 93/03129, EP 481547, EP 530870, EP 533239, EP 554943, EP 346137, U.S. Pat. No. 5,112,518, EP 318204, EP 318279, EP 271155, EP 271156, EP 346136, GB 2228945, CA 2006687, WO 93/25651, EP 530635, EP 414197, and U.S. Pat. No. 5,240,632.
  • Personal Care Applications
  • A particularly useful application area for low allergenic proteins or of proteins with low cross-reactivity to environmental allergens would be in personal care products where the end-user is in close contact with the protein, and where certain problems with allergenicity has been encountered in experimental set-ups (Kelling et al., J. All. Clin. Imm., 1998, Vol.101, pp. 179-187 and Johnston et al., Hum. Exp. Toxicol., 1999, Vol. 18, p. 527).
  • First of all the conjugate or compositions of the invention can advantageously be used for personal care products, such as hair care and hair treatment products. This include products such as shampoo, balsam, hair conditioners, hair waving compositions, hair dyeing compositions, hair tonic, hair liquid, hair cream, shampoo, hair rinse, hair spray.
  • Further contemplated are oral care products such as dentifrice, oral washes, chewing gum.
  • Also contemplated are skin care products and cosmetics, such as skin cream, skin milk, cleansing cream, cleansing lotion, cleansing milk, cold cream, cream soap, nourishing essence, skin lotion, milky lotion, calamine lotion, hand cream, powder soap, transparent soap, sun oil, sun screen, shaving foam, shaving cream, baby oil lipstick, lip cream, creamy foundation, face powder, powder eye-shadow, powder, foundation, make-up base, essence powder, whitening powder.
  • Also for contact lenses hygiene products the conjugate of the invention can be used advantageously. Such products include cleaning and disinfection products for contact lenses.
  • Proteases
  • Proteases are well-known active ingredients for cleaning of contact lenses. They hydrolyse the proteinaceous soil on the lens and thereby makes it soluble. Removal of the protein soil is essential for the wearing comfort.
  • Proteases are also effective ingredients in skin cleaning products, where they remove the upper layer of dead keratinaseous skin cells and thereby make the skin look brighter and fresher.
  • Proteases are also used in oral care products, especially for cleaning of dentures, but also in dentifrices.
  • Further, proteases are used in toiletries, bath and shower products, including shampoos, conditioners, lotions, creams, soap bars, toilet soaps, and liquid soaps.
  • Lipolytic Enzymes
  • Lipolytic enzymes can be applied for cosmetic use as active ingredients in skin cleaning products and anti-acne products for removal of excessive skin lipids, and in bath and shower products such as creams and lotions as active ingredients for skin care.
  • Lipolytic enzymes can also be used in hair cleaning products (e.g. shampoos) for effective removal of sebum and other fatty material from the surface of hair.
  • Lipolytic enzymes are also effective ingredients in products for cleaning of contact lenses, where they remove lipid deposits from the lens surface.
  • Oxidoreductases
  • The most common oxidoreductase for personal care purposes is an oxidase (usually glucose oxidase) with substrate (e.g. glucose) that ensures production of H2O2, which then will initiate the oxidation of for instance SCN or I into antimicrobial reagents (SCNO or I2) by a peroxidase (usually lactoperoxidase). This enzymatic complex is known in nature from e.g. milk and saliva.
  • It is being utilised commercially as anti-microbial system in oral care products (mouth rinse, dentifrice, chewing gum) where it also can be combined with an amyloglucosidase to produce the glucose. These systems are also known in cosmetic products for preservation.
  • Anti-microbial systems comprising the combination of an oxidase and a peroxidase are know in the cleaning of contact lenses.
  • Another application of oxidoreductases is oxidative hair dyeing using oxidases, peroxidases and laccases.
  • Free radicals formed on the surface of the skin (and hair) known to be associated with the ageing process of the skin (spoilage of the hair). The free radicals activate chain reactions that lead to destruction of fatty membranes, collagen, and cells. The application of free radical scavengers such as Superoxide dismutase into cosmetics is well known (R. L. Goldemberg, DCI, Nov. 93, p. 48-52).
  • Protein disulfide isomerase (PDI) is also an oxidoreductase. It can be utilised for waving of hair (reduction and reoxidation of disulfide bonds in hair) and repair of spoiled hair (where the damage is mainly reduction of existing disulfide bonds).
  • Carbohydrases
  • Plaque formed on the surface of teeth is composed mainly of polysaccharides. They stick to the surface of the teeth and the microorganisms. The polysaccharides are mainly α-1,6 bound glucose (dextran) and α-1,3 bound glucose (mutan). The application of different types of glucanases such as mutanase and dextranase helps hydrolysing the sticky matrix of plaque, making it easier to remove by mechanical action.
  • Also other kinds of biofilm for instance the biofilm formed in lens cases can be removed by the action of glucanases.
  • Food and Feed
  • Further conjugated enzymes or polypeptides with reduced immunogenicity according to the invention may advantageously be used in the manufacturing of food and feed.
  • Proteases
  • The gluten in wheat flour is the essential ingredient responsible for the ability of flour to be used in baked foodstuffs. Proteolytic enzymes are sometimes needed to modify the gluten phase of the dough, e.g. a hard wheat flour can be softened with a protease.
  • Neutrase® is a commercially available neutral metallo protease that can be used to ensure a uniform dough quality and bread texture, and to improve flavour. The gluten proteins are degraded either moderately or more extensively to peptides, whereby close control is necessary in order to avoid excessive softening of the dough.
  • Proteases are also used for modifying milk protein.
  • To coagulate casein in milk when producing cheese proteases such as rennet or chymosin may be used.
  • In the brewery industry proteases are used for brewing with unmalted cereals and for controlling the nitrogen content.
  • In animal feed products proteases are used so to speak to expand the animals digestion system.
  • Lipolytic Enzymes
  • Addition of lipolytic enzyme results in improved dough properties and an improved breadmaking quality in terms of larger volume, improved crumb structure and whiter crumb colour. The observed effect can be explained by a mechanism where the lipolytic enzyme changes the interaction between gluten and some lipids fragment during dough mixing. This results in an improved gluten network.
  • The flavour development of blue roan cheese (e.g. Danablue), certain Italian type cheese, and other dairy products containing butter-fat, are dependent on the degradation of milk fat into free fatty acids. Lipolytic enzymes may be used for developing flavour in such products.
  • In the oil- and fat producing industry lipases are used e.g. to minimize the amount of undesirable side-products, to modify fats by interesterification, and to synthesis of esters.
  • Oxidoreductases
  • Further oxidoreductases with reduced immunogenicity according to the invention may advantageously be used in the manufacturing of food and feed.
  • Several oxidoreductases are used for baking, glucose oxidase, lipoxygenase, peroxidase, catalase and combinations hereof. Traditionally, bakers strengthen gluten by adding ascorbic acid and potassium bromate. Some oxidoreductases can be used to replace bromate in dough systems by oxidation of free sulfydryl units in gluten proteins. Hereby disulphide linkages are formed resulting in stronger, more elastic doughs with greater resistance.
  • Gluzyme™ (Novozymes A/S) is a glucose oxidase preparation with catalase activity that can be used to replace bromate. The dough strengthen is measured as greater resistance to mechanical shock, better oven spring and larger loaf volume.
  • Carbohydrases
  • Flour has varying content of amylases leading to differences in the baking quality. Addition of amylases can be necessary in order to standardize the flour. Amylases and pentosanases generally provide sugar for the yeast fermentation, improve the bread volume, retard retrogradation, and decrease the staling rate and stickiness that results from pentosan gums.
  • Examples of Carbohydrases Are Given Below
  • Certain maltogenic amylases can be used for prolonging the shelf life of bread for two or more days without causing gumminess in the product. Selectively modifies the gelatinized starch by cleaving from the non-reducing end of the starch molecules, low molecular wight sugars and dextrins. The starch is modified in such a way that retrogradation is less likely to occur. The produced low-molecular-weight sugars improve the baked goods water retention capacity without creating the intermediate-length dextrins that result in gumminess in the finished product. The enzyme is inactivated during bread baking, so it can be considered a processing aid that does not have to be declared on the label. Overdosing of Novamyl can almost be excluded. is The bread volume can be improved by fungal α-amylases which further provide good and uniform structure of the bread crumb. Said α-amylases are endoenzymes that produce maltose, dextrins and glucose. Cereal and some bacterial α-amylases are inactivated at temperatures above the gelatinization temperature of starch, therefore when added to wheat dough it results in a low bread volume and a sticky bread interior. Fungamyl has the advantage of being thermolabile and is inactivated just below the gelatinization temperature.
  • Enzyme preparations containing a number of pentosanase and hemi-cellulase activities can improve the handling and stability of the dough, and improves the freshness, the crumb structure and the volume of the bread.
  • By hydrolysing the pentosans fraction in flour, it will lose a great deal of its water-binding capacity, and the water will then be available for starch and gluten. The gluten becomes more pliable and extensible, and the starch gelatinizes more easily. Pentosanases can be used in combination with or as an alternative to emulsifiers.
  • Further carbohydrases are user for producing syrups from starch, which are widely used in soft drinks, sweets, meat products, dairy products, bread products, ice cream, baby food, jam etc.
  • The conversion of starch is normally carried out three steps. First the starch is liquefied, by the use of alpha-amylases. Maltodextrins, primary consisting of oligosaccharides and dextrins, are obtained.
  • The mixture is then treated with an amyloglucosidase for hydrolysing the oligosaccharides and dextrins into glucose. This way a sweeter product is obtained. If high maltose syrups are desired beta-amylases alone or in combination with a pullulanase (de-branching enzyme) may be used.
  • The glucose mixture can be made even sweeter by isomerization to fructose. For this an immobilized glucose isomerase can be used.
  • In the sugar industry, it is common practice to speed up the break down of present starch in cane juices. Thereby the starch content in the raw sugar is reduced and filtration at the refinery facilitated.
  • Furthermore dextranases are used to break down dextran in raw sugar juices and syrups.
  • In the alcohol industry alpha-amylases is advantageously being used for thinning of starch in distilling mashes.
  • In the brewing industry alpha-amylases is used for adjunct liquefaction.
  • In the dairy industry beta-galactosidases (lactase) is used when producing low lactose milk for persons suffering from lactose malabsorption.
  • When flavoured milk drinks are produced from lactase-treated milk, the addition of sugar can be reduced without reducing the sweetness of the product.
  • In the production of condensed milk, lactose crystallization can be avoided by lactase treatment, and the risk of thickening caused by casein coagulation in lactose crystals is thus reduced.
  • When producing ice cream made from lactase-treated milk (or whey) no lactose crystals will be formed and the defect, sandiness, will not occur.
  • Further, xylanases are known to be used within a number of food/feed industrial applications as described in WO 94/21785 (Novo Nordisk A/S).
  • Alpha-amylases are used in the animal feed industry to be added to cereal-containing feed to improve the digestibility of starch.
  • Anti-Microbial Polypeptides
  • Certain bacteriolytic enzymes may be used e.g. to wash carcasses in the meat packing industry (see U.S. Pat. No. 5,354,681 from Novo Industri A/S)
  • Transferases
  • Transglutaminases with reduced immunogenicity according to the invention may advantageously be used in the manufacturing of food and feed.
  • Transglutaminases has the ability to crosslinking protein.
  • This property can be used for gelling of aqueous phases containing proteins. This may be used for when producing of spreads (DK patent application no. 1071/84 from Novo Nordisk A/S).
  • Transglutaminases are being used for improvement of baking quality of flour e.g. by modifying wheat flour to be used in the preparation of cakes with improved properties, such as improved taste, dent, mouth-feel and a higher volume (see JP 1-110147).
  • Further producing paste type food material e.g. used as fat substitution in foods as ice cream, toppings, frozen desserts, mayonnaises and low fat spreads (see WO 93/22930 from Novo Nordisk A/S).
  • Furthermore for preparation of gels for yoghurt, mousses, cheese, puddings, orange juice, from milk and milk-like products, and binding of chopped meat product, improvement of taste and texture of food proteins (see WO 94/21120 and WO 94/21129 from Novo Nordisk A/S).
  • Phytases
  • Phytases of the invention may advantageously be used in the manufacturing of food, such as breakfast cereal, cake, sweets, drinks, bread or soup etc., and animal feed.
  • Phytases may be used either for exploiting the phosphorus bound in the phytate/phytic acid present in vegetable protein sources or for exploiting the nutritionally important minerals bound in phytic acid complexes.
  • Microbial phytase may be added to feedstuff of monogastric animals in order to avoid supplementing the feed with inorganic phosphorus (see U.S. Pat. No. 3,297,548).
  • Further phytases may be used in soy processing. Soyabean meal may contain high levels of the anti-nutritional factor phytate which renders this protein source unsuitable for application in baby food and feed for fish, calves and other non-ruminants, since the phytate chelates essential minerals present therein (see EP 0 420 358).
  • Also for baking purposes phytases may be used. Bread with better quality can be prepared by baking divided pieces of a dough containing wheat flour etc. and phytase (see JP-0-3076529-A).
  • A high phytase activity as in koji mold are known to be used for producing refined sake (see JP-0-6070749-A).
  • Textile Applications
  • Proteases
  • Proteases are used for degumming and sand washing of silk.
  • Lipolytic Enzymes
  • Lipolytic enzymes are used for removing fatty matter containing hydrophobic esters (e.g. triglycerides) during the finishing of textiles (see e.g. WO 93/13256 from Novo Nordisk A/S).
  • Oxidoreductases
  • In bleach clean up of textiles catalases may serve to remove excess hydrogen peroxide.
  • Carbohydrases
  • Cellulolytic enzymes are widely used in the finishing of denim garments in order to provide a localized variation in the colour density of the fabric (Enzyme facilitated “stone wash”).
  • Also cellulolytic enzymes find use in the bio-polishing process. Bio-Polishing is a specific treatment of the yarn surface which improves fabric quality with respect to handle and appearance without loss of fabric wettability. Bio-polishing may be obtained by applying the method described e.g. in WO 93/20278.
  • During the weaving of textiles, the threads are exposed to considerable mechanical strain. In order to prevent breaking, the threads are usually reinforced by the coating (sizing) with a gelatinous substance (size). The most common sizing agent is starch in native or modified form. A uniform and durable finish can thus be obtained only after removal of the size from the fabric, the so-called desizing. Desizing of fabrics sized with a size containing starch or modified starch is preferably facilitated by use of amylolytic enzymes.
  • Oral and Dermal Pharmaceuticals
  • Proteases
  • Different combinations of highly purified proteases (e.g. Trypsin and Chymotrypsin) are used in pharmaceuticals to be taken orally, and dermal pharmaceuticals for combating e.g inflammations, edemata and injuries.
  • Leather Production
  • Transferase
  • Transglutaminase is known to be used to casein-finishing leather by acting as a hardening agent (see WO 94/13839 from Novo Nordisk).
  • Hard Surface Cleaning
  • Cleaning of hard surfaces e.g. in the food industry is often difficult, as equipment used for producing dairies, meat, sea food products, beverages etc. often have a complicated shape. The use of surfactant compositions in the form gels and foams comprising enzymes have shown to facilitate and improve hard surface cleaning. Enzymes, which advantageously may be added in such surfactant compositions, are in particular proteases, lipolytic enzymes, amylases and cellulases.
  • Such hard surface cleaning compositions comprising enzymes may also advantageously be used in the transport sector, for instance for washing cars and for general vessel wash.
  • Furthermore this invention relates to the method by which the protein variants are being synthesised and expressed in host cells. This is achieved by culturing host cells capable of expressing a polypeptide in a suitable culture medium to obtain expression and secretion of the polypeptide into the medium, followed by isolation of the polypeptide from the culture medium. The host cell may be any cell suitable for the large-scale production of proteins, capable of expressing a protein and being transformed by an expression vector.
  • The host cell comprises a DNA construct as defined above, optionally the cells may be transformed with an expression vector comprising a DNA construct as defined above. The host cell is selected from any suitable cell, such as a bacterial cell, a fungal cell, an animal cell, such as an insect cell or a mammalian cell, or a plant cell.
  • Immunotherapy
  • A number of vaccination approaches have been described to for infective diseases as well as for non-infective diseases (such as cancers). In a number of cases, the antigen provided is an isolated protein or protein-adjuvant mixture and more and more often, the protein is recombinant (e.g. the hepatitits B vaccine from Merck & Co). In these cases, it could be desirable to modify the immunogenicity of the antigen vaccine, such that it offers a stronger or more specific protection. This can be achieved by protein engineering of the amino acid sequence of the antigen, and would be greatly facilitated by the use of the methods of this invention for identification of epitopes on the antigen vaccine to be the favored sites for modification.
  • There are several examples of vaccine molecules that have been engineered to achieve a specific immune protection against virus, parasites or cancer (Ryu and Nam, Biotechnol. Prog., 2000, vol. 16 pp. 2-16; and references cited therein). “The goal is often to vaccinate with a minimal strucutre consisting of a well-defined antigen, to stimulate an effective specific immune response, while avoiding potentially hazardous risks” (Ryu and Nam, Biotechnol. Prog., 2000, vol. 16 pp. 2-16). Thus, the methods of this invention can be used to identify such minimal structures that define an antigen (or epitope thereof) whether in the form of the parent protein scaffold with a number of mutations introduced in it, or whether it is in the form of the antibody binding peptides themselves.
  • Allergen Vaccines
  • Today, a patient suffering allergic disease may be subjected to allergy vaccine therapy using allergens selected on the basis of testing the specificity of the patient's serum IgE against a bank of allergen extracts (or similar specificity tests of the patient's sensibilization such as skin prick test.
  • One could improve the quality of characterization by using antibody binding peptides corresponding to various epitope sequences on the protein allergens of interest. This would require a kit comprising reagents for such specificity characterization, e.g. the antibody binding is peptides of desired specificity. It would be preferred to use antibody binding sequences in the kit, which correspond to defined epitope sequences known to be specific for the allergen under investigation (i.e. not identified on other allergens and/or not cross-reacting with sera raised against other allergens). This kit would be useful to specifying which allergy the patient is suffering from. This kit will lead to a more specific answer than those kits used today, and hence to a better selection of allergen vaccine therapy for the individual patient.
  • Further, the knowledge about cross-reacting epitopes may improve vaccine development.
  • In an extension of this approach, one could also characterize the patient's serum by identifying the corresponding antibody binding peptides among a random display library using the aforementioned methods. This again may lead to a better selection of allergen vaccine therapy.
  • Further, one could use the individual antibody binding sequences as allergen vaccines leading to more specific allergen vaccine. These antibody binding sequences could be administered in an isolated form or fused to a membrane protein of the phage display system, or to another protein, which may have beneficial effect for the immunoprotective effect of the antibody binding peptide (Dalum et al., Nature Biotechnology, 1999, Vol. 17, pp. 666-669).
  • D) Variations Possible
  • Parent Protein
  • The “parent protein” can in principle be any protein molecule of biological origin, non-limiting examples of which are peptides, polypeptides, proteins, enzymes, post-translationally modified polypeptides such as lipopeptides or glycosylated peptides, anti-microbial peptides or molecules, and proteins having pharmaceutical properties etc.
  • Accordingly the invention relates to a method, wherein the “parent protein” is chosen from the group consisting of polypeptides, small peptides, lipopeptides, antimicrobials, and pharmaceutical polypeptides.
  • The term “pharmaceutical polypeptides” is defined as polypeptides, including peptides, such as peptide hormones, proteins and/or enzymes, being physiologically active when introduced into the circulatory system of the body of humans and/or animals.
  • Pharmaceutical polypeptides are potentially immunogenic as they are introduced into the circulatory system.
  • Examples of “pharmaceutical polypeptides” contemplated according to the invention include insulin, ACTH, glucagon, somatostatin, somatotropin, thymosin, parathyroid hormone, pigmentary hormones, somatomedin, erythropoietin, luteinizing hormone, chorionic gonadotropin, hypothalmic releasing factors, antidiuretic hormones, thyroid stimulating hormone, relaxin, interferon, thrombopoietin (TPO) and prolactin.
  • However, the proteins are preferably to be used in industry, housekeeping and/or medicine, such as proteins used in personal care products (for example shampoo; soap; skin, hand and face lotions; skin, hand and face cremes; hair dyes; toothpaste), food (for example in the baking industry), detergents and pharmaceuticals.
  • Antimicrobial Peptides
  • The antimicrobial peptide (AMP) may be, e.g., a membrane-active antimicrobial peptide, or an antimicrobial peptide affecting/interacting with intracellular targets, e.g. binding to cell DNA. The AMP is generally a relatively short peptide, consisting of less than 100 amino acid residues, typically 20-80 residues. The antimicrobial peptide has bactericidal and/or fungicidal effect, and it may also have antiviral or antitumour effects. It generally has low cytotoxicity against normal mammalian cells.
  • The antimicrobial peptide is generally highly cationic and hydrophobic. It typically contains several arginine and lysine residues, and it may not contain a single glutamate or asparatate. It usually contains a large proportion of hydrophobic residues. The peptide generally has an amphiphilic structure, with one surface being highly positive and the other hydrophobic.
  • The bioactive peptide and the encoding nucleotide sequence may be derived from plants, invertebrates, insects, amphibians and mammals, or from microorganisms such as bacteria and fungi.
  • The antimicrobial peptide may act on cell membranes of target microorganisms, e.g. through nonspecific binding to the membrane, usually in a membrane-parallel orientation, interacting only with one face of the bilayer.
  • The antimicrobial peptide typically has a structure belonging to one of five major classes: a helical, cystine-rich (defensin-like), b-sheet, peptides with an unusual composition of regular amino acids, and peptides containing uncommon modified amino acids.
  • Examples of alpha-helical peptides are Magainin 1 and 2; Cecropin A, B and P1; CAP18; Andropin; Clavanin A or AK; Styelin D and C; and Buforin II. Examples of cystine-rich peptides are a-Defensin HNP-1 (human neutrophil peptide) HNP-2 and HNP-3; b-Defensin-12, Drosomycin, g1-purothionin, and Insect defensin A. Examples of b-sheet peptides are Lactoferricin B, Tachyplesin I, and Protegrin PG1-5. Examples of peptides with an unusual composition are Indolicidin; PR-39; Bactenicin Bac5 and Bac7; and Histatin 5. Examples of peptides with unusual amino acids are Nisin, Gramicidin A, and Alamethicin.
  • Another example is the antifungal peptide (AFP) from Aspergillus giganteus. As explained in detail in WO 94/01459, which is hereby incorporated by reference, the antifungal polypeptide having the amino acid sequence shown in FIG. 1 has been found in several strains of the fungal species A. giganteus, an example of which is the A. giganteus strain deposited with the Centraallbureau voor Schimmelcultures (CBS) under the deposition number CBS 526.65.
  • However, the antifungal polypeptide, or variants thereof, suitable for the use according to the invention are expected to be derivable from other fungal species, especially other Aspergillus species such as A. pallidus, A. clavatus, A. longivesica, A. rhizopodus and A. clavatonanicus, because of the close relationship which exists between these species and A. giganteus.
  • In one embodiment of the invention the protein is an enzyme, such as glycosyl hydrolases, carbohydrases, peroxidases, proteases, lipolytic enzymes, phytases, polysaccharide lyases, oxidoreductases, transglutaminases and glycoseisomerases, in particular the following.
  • Parent Proteases
  • Parent proteases (i.e. enzymes classified under the Enzyme Classification number E.C. 3.4 in accordance with the Recommendations (1992) of the International Union of Biochemistry and Molecular Biology (IUBMB)) include proteases within this group.
  • Examples include proteases selected from those classified under the Enzyme Classification (E.C.) numbers:
  • 3.4.11 (i.e. so-called aminopeptidases), including 3.4.11.5 (Prolyl aminopeptidase), 3.4.11.9 (X-pro aminopeptidase), 3.4.11.10 (Bacterial leucyl aminopeptidase), 3.4.11.12 (Thermophilic aminopeptidase), 3.4.11.15 (Lysyl aminopeptidase), 3.4.11.17 (Tryptophanyl aminopeptidase), 3.4.11.18 (Methionyl aminopeptidase).
  • 3.4.21 (i.e. so-called serine endopeptidases), including 3.4.21.1 (Chymotrypsin), 3.4.21.4 (Trypsin), 3.4.21.25 (Cucumisin), 3.4.21.32 (Brachyurin), 3.4.21.48 (Cerevisin) and 3.4.21.62 (Subtilisin);
  • 3.4.22 (i.e. so-called cysteine endopeptidases), including 3.4.22.2 (Papain), 3.4.22.3 (Ficain), 3.4.22.6 (Chymopapain), 3.4.22.7 (Asclepain), 3.4.22.14 (Actinidain), 3.4.22.30 (Caricain) and 3.4.22.31 (Ananain);
  • 3.4.23 (i.e. so-called aspartic endopeptidases), including 3.4.23.1 (Pepsin A), 3.4.23.18 (Aspergillopepsin I), 3.4.23.20 (Penicillopepsin) and 3.4.23.25 (Saccharopepsin); and
  • 3.4.24 (i.e. so-called metalloendopeptidases), including 3.4.24.28 (Bacillolysin).
  • Serine Proteases
  • A serine protease is an enzyme which catalyzes the hydrolysis of peptide bonds, and in which there is an essential serine residue at the active site (White, Handler and Smith, 1973 “Principles of Biochemistry,” Fifth Edition, McGraw-Hill Book Company, N.Y., pp. 271-272).
  • The bacterial serine proteases have molecular weights in the 20,000 to 45,000 Dalton range. They are inhibited by diisopropylfluorophosphate. They hydrolyze simple terminal esters and are similar in activity to eukaryotic chymotrypsin, also a serine protease. A more narrow term, alkaline protease, covering a sub-group, reflects the high pH optimum of some of the serine proteases, from pH 9.0 to 11.0 (for review, see Priest (1977) Bacteriological Rev. 41 711 -753).
  • Subtilases
  • A sub-group of the serine proteases tentatively designated subtilases has been proposed by Siezen et al., Protein Engng. 4 (1991) 719-737 and Siezen et al. Protein Science 6 (1997) 501-523. They are defined by homology analysis of more than 170 amino acid sequences of serine proteases previously referred to as subtilisin-like proteases. A subtilisin was previously often defined as a serine protease produced by Gram-positive bacteria or fungi, and according to Siezen et al. now is a subgroup of the subtilases. A wide variety of subtilases have been identified, and the amino acid sequence of a number of subtilases has been determined. For a more detailed description of such subtilases and their amino acid sequences reference is made to Siezen et al.(1997).
  • Savinase-Like Subtilisin
  • One subgroup of the subtilases may be classified as savinase-like subtilisins, having at least 81% homology to Savinase, preferably at least 85% homology, more preferably at least 90% homology, even more preferably at least 96% homology, most preferably at least 98% homology to Savinase.
  • Parent Subtilase
  • The term “parent subtilase” describes a subtilase defined according to Siezen et al. (1991 and 1997). For further details see description of “SUBTILASES” immediately above. A parent subtilase may also be a subtilase isolated from a natural source, wherein subsequent modifications have been made while retaining the characteristic of a subtilase. Furthermore, a parent subtilase may also be a subtilase which has been prepared by the DNA shuffling technique, such as described by J. E. Ness et al., Nature Biotechnology, 17, 893-896 (1999).
  • Alternatively the term “parent subtilase” may be termed “wild type subtilase”.
  • Modification(s) of a Subtilase Variant
  • The term “modification(s)” used herein is defined to include chemical modification of a subtilase as well as genetic manipulation of the DNA encoding a subtilase. The modification(s) can be replacement(s) of the amino acid side chain(s), substitution(s), deletion(s) and/or insertions in or at the amino acid(s) of interest.
  • Subtilase Variant
  • In the context of this invention, the term subtilase variant or mutated subtilase means a subtilase that has been produced by an organism which is expressing a mutant gene derived from a parent microorganism which possessed an original or parent gene and which produced a corresponding parent enzyme, the parent gene having been mutated in order to produce the mutant gene from which said mutated subtilase protease is produced when expressed in a suitable host.
  • Examples of relevant subtilisins comprise subtilisin BPN′, subtilisin amylosacchariticus, subtilisin 168, subtilisin mesentericopeptidase, subtilisin Carlsberg, subtilisin DY, subtilisin 309, subtilisin 147, PD498 (WO 93/24623), thermitase, aqualysin, Bacillus PB92 protease, proteinase K, Protease TW7, and Protease TW3.
  • Preferred commercially available protease enzymes include Alcalase™, Savinase™, Primase™, Duralase™, Neutrase®, Dyrazym®, Esperase™, Pyrase®, Pancreatic Trypsin NOVO (PTN), Bio-Feed™ Pro, Clear-Lens Pro, and Relase® (Novozymes A/S), Maxatase™, Maxacal™, Maxapem™, Properase™M, Purafect™, Purafect OXP™ (Genencor International Inc.).
  • It is to be understood that also protease variants are contemplated as the parent protease. Examples of such protease variants are disclosed in EP 130.756 (Genentech), EP 214.435 (Henkel), WO 87/04461 (Amgen), WO 87/05050 (Genex), EP 251.446 (Genencor), EP 260.105 (Genencor), Thomas et al., (1985), Nature. 318, p. 375-376, Thomas et al., (1987), J. Mol. Biol., 193, pp. 803-813, Russel et al., (1987), Nature, 328, p. 496-500, WO 88108028 (Genex), WO 88/08033 (Amgen), WO 89/06279 (Novo Nordisk A/S), WO 91/00345 (Novo Nordisk AIS), EP 525 610 (Solvay) and WO 94/02618 (Gist-Brocades N. V.).
  • The activity of proteases can be determined as described in “Methods of Enzymatic Analysis”, third edition, 1984, Verlag Chemie, Weinheim, vol. 5.
  • Parent Lipolytic Enzymes
  • Lipolytic enzymes are classified in EC 3.1.1 Carboxylic Ester Hydrolases according to Enzyme Nomenclature (available at http://www.chem.qmw.ac.uk/iubmb/enzyme). The lipolytic enzyme may have a substrate specificity with an activity such as EC 3.1.1.3 triacylglycerol lipase, EC 3.1.1.4 phospholipase A2, EC 3.1.1.5 lysophospholipase, EC 3.1.1.26 galactolipase, EC 3.1.1.32 phospholipase A1, EC 3.1.1.73 feruloyl esterase or EC 3.1.1.74 cutinase.
  • The parent lipolytic enzyme may be prokaryotic, particularly a bacterial enzyme, e.g. from Pseudomonas. Examples are Pseudomonas lipases, e.g. from P. cepacia (U.S. Pat. No. 5,290,694, pdb file 1OIL), P. glumae (N Frenken et al. (1992), Appl. Envir. Microbiol. 58 3787-3791, pdb files 1TAH and 1QGE), P. pseudoalcaligenes (EP 334 462) and Pseudomonas sp. strain SD 705 (FERM BP-4772) (WO 95/06720, EP 721 981, WO 96/27002, EP 812 910). The P. glumae lipase sequence is identical to the amino acid sequence of Chromobacterium viscosum (DE 3908131 A1). Other examples are bacterial cutinases, e.g. from Pseudomonas such as P. mendocina (U.S. Pat. No. 5,389,536) or P. putida (WO 88/09367).
  • Alternatively, the parent lipolytic enzyme may be eukaryotic, e.g. a fungal lipolytic enzyme such as lipolytic enzymes of the Humicola family and the Zygomycetes family and fungal cutinases.
  • Examples of fungal cutinases are the cutinases of Fusarium solani pisi (S. Longhi et al., Journal of Molecular Biology, 268 (4), 779-799 (1997)) and Humicola insolens (U.S. Pat. No. 5,827,719).
  • The parent lipolytic enzyme may be fungal and may have an amino acid sequence that can be aligned with SEQ ID NO: 1 which is the amino acid sequence shown in positions 1-269 of SEQ ID NO: 2 of U.S. Pat. No. 5,869,438 for the lipase from Thermomyces lanuginosus (synonym Humicola lanuginosa), described in EP 258 068 and EP 305 216 (trade name LIPOLASE). The parent lipolytic enzyme may particularly have an amino acid sequence with at least 50% homology with SEQ ID NO: 1. In addition to the lipase from T. lanuginosus, other examples are a lipase from Penicillium camembertii (P25234), a lipase from Fusasrium, lipase/phospholipase from Fusarium oxysporum (EP 130064, WO 98/26057), lipase from F. heterosporum (R87979), lysophospholipase from Aspergillus foetidus (W33009), phospholipase A1 from A. oryzae (JP-A 10-155493), lipase from A. oryzae (D85895), lipase/ferulic acid esterase from A. niger (Y09330), lipase/ferulic acid esterase from A. tubingensis (Y09331), lipase from A. tubingensis (WO 98/45453), lysophospholipase from A. niger (WO 98/31790), lipase from F. solanii having an isoelectric point of 6.9 and an apparent molecular weight of 30 kDa (WO 96/18729).
  • Other examples are the Zygomycetes family of lipases comprising lipases having at least 50% homology with the lipase of Rhizomucor miehei (P19515. This family also includes the lipases from Absidia reflexa, A. sporophora, A. corymbifera, A. blakesleeana, A. griseola (all described in WO 96/13578 and WO 97/27276) and Rhizopus oryzae (P21811). Numbers in parentheses indicate publication or accession to the EMBL, GenBank, GeneSeqp or Swiss-Prot databases.
  • Examples of lipases include lipases derived from the following microorganisms. The indicated patent publications are incorporated herein by reference:
  • Humicola, e.g. H. brevispora, H. brevis var. thermoidea.
  • Pseudomonas, e.g. Ps. fragi, Ps. stutzeri, Ps. cepacia and Ps. fluorescens (WO 89/04361), or Ps. plantarii or Ps. gladioli (U.S. Pat. No. 4,950,417 (Solvay enzymes)) or Ps. alcaligenes and Ps. pseudoalcaligenes (EP 218272) or.
  • Candida, e.g. C. cylindracea (also called C. rugosa) or C. antarctica (WO 88/02775) or C. antarctica lipase A or B (WO 94/01541 and WO 89/02916).
  • Geotricum, e.g. G. candidum (Schimada et al., (1989), J. Biochem., 106, 383-388).
  • Rhizopus, e.g. R. delemar (Hass et al., (1991), Gene 109, 107-113) or R. niveus (Kugimiya et al., (1992) Biosci. Biotech. Biochem 56, 716-719) or R. oryzae.
  • Bacillus, e.g. B. subtilis (Dartois et al., (1993) Biochemica et Biophysica acta 1131, 253-260) or B. stearothermophilus (JP 64/7744992) or B. pumilus (WO 91/16422).
  • Specific examples of readily available commercial lipases include Lipolase® (WO 98/35026) Lipolase™ Ultra, Lipozyme®, Palatase®, Novozym® 435, Lecitase® (all available from Novozymes A/S).
  • Examples of other lipases are Lumafast™, Ps. mendocian lipase from Genencor Int. Inc.; Lipomax™, Ps. pseudoalcaligenes lipase from Gist Brocades/Genencor Int. Inc.; Fusarium solani lipase (cutinase) from Unilever; Bacillus sp. lipase from Solvay enzymes. Other lipases are available from other companies.
  • It is to be understood that also lipase variants are contemplated as the parent enzyme. Examples of such are described in e.g. WO 93/01285 and WO 95/22615.
  • The activity of the lipase can be determined as described in “Methods of Enzymatic Analysis”, Third Edition, 1984, Verlag Chemie, Weinhein, vol. 4, or as described in AF 95/5 GB (available on request from Novozymes A/S).
  • Parent Oxidoreductases
  • Parent oxidoreductases (i.e. enzymes classified under the Enzyme Classification number E.C. 1 (Oxidoreductases) in accordance with the Recommendations (1992) of the International Union of Biochemistry and Molecular Biology (IUBMB)) include oxidoreductases within this group.
  • Examples include oxidoreductases selected from those classified under the Enzyme Classification (E.C.) numbers:
  • Glycerol-3-phosphate dehydrogenase (NAD) (1.1.1.8), Glycerol-3-phosphate dehydrogenase [NAD(P)] (1.1.1.94), Glycerol-3-phosphate 1-dehydrogenase [NADP] (1.1.1.94), Glucose oxidase (1.1.3.4), Hexose oxidase (1.1.3.5), Catechol oxidase (1.1.3.14), Bilirubin oxidase (1.3.3.5), Alanine dehydrogenase (1.4.1.1), Glutamate dehydrogenase (1.4.1.2), Glutamate dehydrogenase [AND(P)] (1.4.1.3), Glutamate dehydrogenase (NADP) (1.4.1.4), L-Amino acid dehydrogenase (1.4.1.5), Serine dehydrogenase (1.4.1.7), Valine dehydrogenase (NADP) (1.4.1.8), Leucine dehydrogenase (1.4.1.9), Glycine dehydrogenase (1.4.1.10), L-Amino-acid oxidase (1.4.3.2.), D-Amino-acid oxidase(1.4.3.3), L-Glutamate oxidase (1.4.3.11), Protein-lysine 6-oxidase (1.4.3.13), L-lysine oxidase (1.4.3.14), L-Aspartate oxidase (1.4.3.16), D-amino-acid dehydrogenase (1.4.99.1), Protein disulfide reductase (1.6.4.4), Thioredoxin reductase (1.6.4.5), Protein disulfide reductase (glutathione) (1.8.4.2), Laccase (1.10.3.2), Catalase (1.11.1.6), Peroxidase (1.11.1.7), Lipoxygenase (1.13.11.12), Superoxide dismutase (1.15.1.1).
  • Said glucose oxidases may be derived from Aspergillus niger.
  • Said laccases may be derived from Polyporus pinsitus, Myceliophthora thermophila, Coprinus cinereus, Rhizoctonia solani, Rhizoctonia praticola, Scytalidium thermophilum and Rhus vernicifera. Because of the homology found between the above mentioned laccases (see WO 98/38287), they are considered to belong to the same class of laccases, namely the class of “Coprinus-like laccases”. Accordingly, in the present context, the term “Coptinus-like laccase” is intended to indicate a laccase which, on the amino acid level, displays a homology of at least 50% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 55% and less than 100% to the Copdinus cinereus laccase SEQ ID NO: 3, or at least 60% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 65% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 70% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 75% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 80% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 85% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, or at least 90% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3, at least 95% and less than 100% or at least 98% and less than 100% to the Coprinus cinereus laccase SEQ ID NO: 3.
  • Bilirubin oxidases may be derived from Myrothechecium verrucaria.
  • The peroxidase may be derived from e.g. Soy bean, Horseradish or Coprinus cinereus.
  • The protein disulfide reductase may be any of the mentioned in Danish application nos. 768/93, 265/94 and 264/94 (Novo Nordisk A/S), which are hereby incorporated as references, including Protein Disulfide reductases of bovine origin, Protein Disulfide reductases derived from Aspergillus oryzae or Aspergillus niger, and DsbA or DsbC derived from Escherichia coli.
  • Specific examples of readily available commercial oxidoreductases include Gluzyme™ (enzyme available from Novozymes A/S). However, other oxidoreductases are available from others.
  • It is to be understood that also variants of oxidoreductases are contemplated as the parent enzyme.
  • The activity of oxidoreductases can be determined as described in “Methods of Enzymatic Analysis”, third edition, 1984, Verlag Chemie, Weinheim, vol. 3.
  • Parent Carbohydrases
  • Parent carbohydrases may be defined as all enzymes capable of breaking down carbohydrate chains (e.g. starches) of especially five and six member ring structures (i.e. enzymes classified under the Enzyme Classification number E.C. 3.2 (glycosidases) in accordance with the Recommendations (1992) of the International Union of Biochemistry and Molecular Biology (IUBMB)). Also included in the group of carbohydrases according to the invention are enzymes capable of isomerizing carbohydrates e.g. six member ring structures, such as D-glucose to e.g. five member ring structures like D-fructose.
  • Examples include carbohydrases selected from those classified under the Enzyme Classification (E.C.) numbers: alpha-amylase (3.2.1.1), beta-amylase (3.2.1.2), glucan 1,4-alpha-glucosidase (3.2.1.3), cellulase (3.2.1.4), endo-1,3(4)-beta-glucanase (3.2.1.6), endo-1,4-beta-xylanase (3.2.1.8), dextranase (3.2.1.11), chitinase (3.2.1.14), polygalacturonase (3.2.1.15), lysozyme (3.2.1.17), beta-glucosidase (3.2.1.21), alpha-galactosidase (3.2.1.22), beta-galactosidase (3.2.1.23), amylo-1,6-glucosidase (3.2.1.33), xylan 1,4-beta-xylosidase (3.2.1.37), glucan endo-1,3-beta-D-glucosidase (3.2.1.39), alpha-dextrin endo-1,6-glucosidase (3.2.1.41), sucrose alpha-glucosidase (3.2.1.48), iglucan endo-1,3-alpha-glucosidase (3.2.1.59), glucan 1,4-beta-glucosidase (3.2.1.74), glucan endo-1,6-beta-glucosidase (3.2.1.75), arabinan endo-1,5-alpha-arabinosidase (3.2.1.99), lactase (3.2.1.108), chitonanase (3.2.1.132) and xylose isomerase (5.3.1.5).
  • Examples of relevant carbohydrases include alpha-1,3-glucanases derived from Trichoderma harzfanum; alpha-1,6-glucanases derived from a strain of Paecilomyces; beta-glucanases derived from Bacillus subtilis; beta-glucanases derived from Humicola insolens; beta-glucanases derived from Aspergillus niger, beta-glucanases derived from a strain of Trichoderma; beta-glucanases derived from a strain of Oerskovia xanthineolytica; exo-1,4-alpha-D-glucosidases (glucoamylases) derived from Aspergillus niger, alpha-amylases derived from Bacillus subtilis; alpha-amylases derived from Bacillus amyloliquefaciens; alpha-amylases derived from Bacillus stearothermophilus; alpha-amylases derived from Aspergillus oryzae; alpha-amylases derived from non-pathogenic microorganisms; alpha-galactosidases derived from Aspergillus niger, Pentosanases, xylanases, cellobiases, cellulases, hemi-cellulases derived from Humicola insolens; cellulases derived from Trichoderma reesei; cellulases derived from non-pathogenic mold; pectinases, cellulases, arabinases, hemi-celluloses derived from Aspergillus niger, dextranases derived from Penicillium lilacinum; endo-glucanase derived from non-pathogenic mold; pullulanases derived from Bacillus acidopullyticus; beta-galactosidases derived from Kluyveromyces fragilis; xylanases derived from Trichoderma reesei.
  • Specific examples of readily available commercial carbohydrases include Alpha-Gal™, Bio-Feed™ Alpha, Bio-Feed™ Beta, Bio-Feed™ Plus, Bio-Feed™ Plus, Novozyme® 188, Carezyme® (SEQ ID NO: 5), Celluclast®, Cellusoft®, Ceremyl®, Citrozym™, Denimax™, Dezyme™, Dextrozyme™, Finizym®, Fungamyl™, Gamanase™, Glucanex®, Lactozym®, Maltogenase™, Pentopan™, Pectinex™, Promozyme®, Pulpzyme™, Novamyl™, Termamyl®, AMG (Amyloglucosidase Novo), Maltogenase®, Sweetzyme®, Aquazym®, Natalase® (SEQ ID NO: 4), SP722, AA560 (all enzymes available from Novozymes A/S). Other carbohydrases are available from other companies.
  • The parent cellulase is preferably a microbial cellulase. As such, the cellulase may be selected from bacterial cellulases, e.g. Pseudomonas cellulases or Bacillus, such as the Bacillus strains described in U.S. Pat. No. 4,822,516, U.S. Pat. No. 5,045,464 or EP 468 464, or B. lautus (cf. WO 91/10732), cellulases. More preferably, the parent cellulases may be a fungal cellulase, in particular Humicola, Trichoderma, Irpex, Aspergillus, Penicillium, Myceliophthora or Fusarium cellulases. Examples of suitable parent cellulases are described in, e.g. WO 91/17244. Examples of suitable Trichoderma cellulases are those described in T. T. Teeri, Gene 51, 1987, pp. 43-52. Preferably, the parent cellulase is selected from the cellulases classified in family 45, e.g. the enzymes EG B (Pseudomonas fluorescens) and EG V (Humicola insolens), as described in Henrissat, B. et al.: Biochem. J. (1993), 293, p. 781-788.
  • The Termamyl-Like Alpha-Amylase
  • It is well known that a number of alpha-amylases produced by Bacillus spp. are highly homologous on the amino acid level. For instance, the B. licheniformis alpha-amylase comprising the amino acid sequence shown in SEQ ID NO: 4 of WO 00/29560 (commercially available as Termamyl® has been found to be about 89% homologous with the B. amyloliquefaciens alpha-amylase comprising the amino acid sequence shown in SEQ ID NO: 5 of WO 00/29560 and about 79% homologous with the B. stearothermophilus alpha-amylase comprising the amino acid sequence shown in SEQ ID NO: 3 of WO 00/29560. Further homologous alpha-amylases include an alpha-amylase derived from a strain of the Bacillus sp. NCIB 12289, NCIB 12512, NCIB 12513 or DSM 9375, all of which are described in detail in WO 95/26397, and the alpha-amylase described by Tsukamoto et al., Biochemical and Biophysical Research Communications, 151 (1988), pp. 25-31.
  • Still further homologous alpha-amylases include the alpha-amylase produced by the B. licheniformis strain described in EP 0252666 (ATCC 27811), and the alpha-amylases identified in WO 91/00353 and WO 94/18314. Other commercial Termamyl-like B. licheniformis alpha-amylases are Optitherm® and Takatherm® (available from Solvay), Maxamyl® (available from Gist-brocades/Genencor), Spezym AA® and Spezyme Delta AA™ (available from Genencor), and Keistase® (available from Daiwa).
  • Because of the substantial homology found between these alpha-amylases, they are considered to belong to the same class of alpha-amylases, namely the class of “Termamyl-like alpha-amylases”.
  • Accordingly, in the present context, the term “Termamyl-like alpha-amylase” is intended to indicate an alpha-amylase which, at the amino acid level, exhibits a substantial homology to Termamyl®, i.e., the B. licheniformis alpha-amylase having the amino acid sequence shown in SEQ ID NO: 4 (WO 00/29560). In other words, a Termamyl-like alpha-amylase is an alpha-amylase which has the amino acid sequence shown in SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7 or 8 of WO 00/29560, and the amino acid sequence shown in SEQ ID NO: 1 of WO 95/26397 (the same as the amino acid sequence shown as SEQ ID NO: 7 of WO 00/29560) or in SEQ ID NO: 2 of WO 95/26397 (the same as the amino acid sequence shown as SEQ ID NO: 8 of WO 00/29560) or in Tsukamoto et al., 1988, (which amino acid sequence is shown in SEQ ID NO: 6 of WO 00/29560) or i) which displays at least 60% homology (identity), preferred at least 70%, more preferred at least 75%, even more preferred at least 80%, especially at least 85%, especially preferred at least 90%, especially at least 95%, even especially more preferred at least 97%, especially at least 99% homology with at least one of said amino acid sequences shown in SEQ ID NOS: 1, 2, 3, 4, 5, 6, 7 or 8 of WO 00/29560 and/or ii) displays immunological cross-reactivity with an antibody raised against one or more of said alpha-amylases, and/or iii) is encoded by a DNA sequence which hybridizes, under the low to very high stringency conditions (said conditions described below) to the DNA sequences encoding the above-specified alpha-amylases which are apparent from SEQ ID NOS: 9, 10, 11, 12, and 32, respectively, of the present application (which encodes the amino acid sequences shown in SEQ ID NOS: 1, 2, 3, 4, and 5 herein, respectively), from SEQ ID NO: 4 of WO 95/26397 (which DNA sequence, together with the stop codon TAA, is shown in SEQ ID NO: 13 herein and encodes the amino acid sequence shown in SEQ ID NO: 8 herein) and from SEQ ID NO: 5 of WO 95/26397 (shown in SEQ ID NO: 14 herein), respectively.
  • In connection with property i), the “homology” (identity) may be determined by use of any conventional algorithm, preferably by use of the gap progamme from the GCG package version 8 (August 1994) using default values for gap penalties, i.e., a gap creation penalty of 3.0 and gap extension penalty of 0.1 (Genetic Computer Group (1991) Programme Manual for the GCG Package, version 8, 575 Science Drive, Madison, Wis., USA 53711).
  • The parent Termamyl-like alpha-amylase backbone may in an embodiment have an amino acid sequence which has a degree of identity to SEQ ID NO: 4 (WO 00/29560) of at least 65%, preferably at least 70%, preferably at least 75%, more preferably at least 80%, more preferably at least 85%, even more preferably at least about 90%, even more preferably at least 95%, even more preferably at least 97%, and even more preferably at least 99% identity determined as described above.
  • A structural alignment between Termamyl® (SEQ ID NO: 4) and a Termamyl-like alpha-amylase may be used to identify equivalent/corresponding positions in other Termamyl-like alpha-amylases. One method of obtaining said structural alignment is to use the Pile Up programme from the GCG package using default values of gap penelties, i.e., a gap creation penalty of 3.0 and gap extension penalty of 0.1. Other structural alignment methods include the hydrophobic cluster analysis (Gaboriaud et al., (1987), FEBS LETTERS 224, pp. 149-155) and reverse threading (Huber, T; Torda, AE, PROTEIN SCIENCE Vol. 7, No. 1 pp. 142-149 (1998).
  • Parent Glucoamylases
  • Parent glucoamylase contemplated according to the present invention include fungal glucoamylases, in particular fungal glucoamylases obtainable from an Aspergillus strain, such as an Aspergillus niger or Aspergillus awamori glucoamylases and variants or mutants thereof, homologous glucoamylases, and further glucoamylases being structurally and/or functionally similar to SEQ ID NO: 2 (WO 00/04136). Specifically contemplated are the Aspergillus niger glucoamylases G1 and G2 disclosed in Boel et al. (1984), “Glucoamylases G1 and G2 from Aspergillus niger are synthesized from two different but closely related mRNAs”, EMBO J. 3 (5), p. 1097-1102. The G2 glucoamylase is disclosed in SEQ ID NO: 2 (WO 00/04136). The G1 glucoamylase is disclosed in SEQ ID NO: 13 (WO 00/04136). Another AMG backbone contemplated is Talaromyces emersonii, especially Talaromyces emersonii DSM disclosed in WO 99/28448 (Novo Nordisk).
  • The homology referred to above of the parent glucoamylase is determined as the degree of identity between two protein sequences indicating a derivation of the first sequence from the second. The homology may suitably be determined by means of computer programs known in the art such as GAP provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wis., USA 53711) (Needleman, S. B. and Wunsch, C. D., (1970), Journal of Molecular Biology, 48, p. 443-453). Using Gap with the following settings for polypeptide sequence comparison: Gap creation penalty of 3.0 and Gap extension penalty of 0.1, the mature part of a polypeptide encoded by an analogous DNA sequence of the invention exhibits a degree of identity preferably of at least 60%, such as 70%, at least 80%, at least 90%, more preferably at least 95%, more preferably at least 97%, and most preferably at least 99% with the mature part of the amino acid sequence shown in SEQ ID NO: 2 (WO 00/04136).
  • Preferably, the parent glucoamylase comprise the amino acid sequences of SEQ ID NO: 2(WO 00/04136); or allelic variants thereof; or fragments thereof that has glucoamylase activity.
  • A fragment of SEQ ID NO: 2 is a polypeptide which have one or more amino acids deleted from the amino and/or carboxyl terminus of this amino acid sequence. For instance, the AMG G2 (SEQ ID NO: 2) is a fragment of the Aspergillus niger G1 glucoamylase (Boel et al. (1984), EMBO J. 3 (5), p. 1097-1102) having glucoamylase activity. An allelic variant denotes any of two or more alternative forms of a gene occupying the same chromosomal locus. Allelic variation arises naturally through mutation, and may result in polymorphism within populations. Gene mutations can be silent (no change in the encoded polypeptide) or may encode polypeptides having altered amino acid sequences. An allelic variant of a polypeptide is a polypeptide encoded by an allelic variant of a gene.
  • It is to be understood that also carbohydrase variants are contemplated as the parent enzyme.
  • The activity of carbohydrases can be determined as described in “Methods of Enzymatic Analysis”, third edition, 1984, Verlag Chemie, Weinheim, vol. 4.
  • Parent Transferases
  • Parent transferases (i.e. enzymes classified under the Enzyme Classification number E.C. 2 in accordance with the Recommendations (1992) of the International Union of Biochemistry and Molecular Biology (IUBMB)) include transferases within this group.
  • The parent transferases may be any transferase in the subgroups of transferases: transferases transferring one-carbon groups (E.C. 2.1); transferases transferring aldehyde or residues (E.C 2.2); acyltransferases (E.C. 2.3); glucosyltransferases (E.C. 2.4); transferases transferring alkyl or aryl groups, other that methyl groups (E.C. 2.5); transferases transferring nitrogeneous groups (2.6).
  • In a preferred embodiment the parent transferase is a transglutaminase E.C 2.3.2.13 (Protein-glutamine μ-glutamyltransferase).
  • Transglutaminases are enzymes capable of catalyzing an acyl transfer reaction in which a gamma-carboxyamide group of a peptide-bound glutamine residue is the acyl donor. Primary amino groups in a variety of compounds may function as acyl acceptors with the subsequent formation of monosubstituted gamma-amides of peptide-bound glutamic acid. When the epsilon-amino group of a lysine residue in a peptide-chain serves as the acyl acceptor, the transferases form intramolecular or intermolecular gamma-glutamyl-epsilon-lysyl crosslinks.
  • Examples of transglutaminases are described in the pending DK patent application no. 990/94 (Novo Nordisk ANS).
  • The parent transglutaminase may be of human, animal (e.g. bovine) or microbial origin.
  • Examples of such parent transglutaminases are animal derived Transglutaminase, FXIIIa; microbial transglutaminases derived from Physarum polycephalum (Klein et al., Journal of Bacteriology, Vol. 174, p. 2599-2605); transglutaminases derived from Streptomyces sp., including Streptomyces lavendulae, Streptomyces lydicus (former Streptomyces libani) and Streptoverticillium sp., including Streptoverticillium mobaraense, Streptoverticillium cinnamoneum, and Streptoverticillium griseocarneum (Motoki et al., U.S. Pat. No. 5,156,956; Andou et al., U.S. Pat. No. 5,252,469; Kaempfer et al., Journal of General Microbiology, Vol. 137, p. 1831-1892; Ochi et al., International Journal of Sytematic Bacteriology, Vol. 44, p. 285-292; Andou et al., U.S. Pat. No. 5,252,469; Williams et al., Journal of General Microbiology, Vol. 129, p. 1743-1813).
  • It is to be understood that also transferase variants are contemplated as the parent enzyme.
  • The activity of transglutaminases can be determined as described in “Methods of Enzymatic Analysis”, third edition, 1984, Verlag Chemie, Weinheim, vol. 1-10.
  • Parent Phytases
  • Parent phytases are included in the group of enzymes classified under the Enzyme Classification number E.C. 3.1.3 (Phosphoric Monoester Hydrolases) in accordance with the Recommendations (1992) of the International Union of Biochemistry and Molecular Biology (IUBMB)).
  • Phytases are enzymes produced by microorganisms which catalyse the conversion of phytate to inositol and inorganic phosphorus
  • Phytase producing microorganisms comprise bacteria such as Bacillus subtilis, Bacillus natto and Pseudomonas; yeasts such as Saccharomyces cerevisiae; and fungi such as Aspergillus niger, Aspergillus ficuum, Aspergillus awamori, Aspergillus oryzae, Aspergillus terreus or Aspergillus nidulans, and various other Aspergillus species).
  • Examples of parent phytases include phytases selected from those classified under the Enzyme Classification (E.C.) numbers: 3-phytase (3.1.3.8) and 6-phytase (3.1.3.26).
  • The activity of phytases can be determined as described in “Methods of Enzymatic Analysis”, third edition, 1984, Verlag Chemie, Weinheim, vol. 1-10, or may be measured according to the method described in EP-A1-0 420 358, Example 2 A.
  • Lyases
  • Suitable lyases include Polysaccharide lyases: Pectate lyases (4.2.2.2) and pectin lyases (4.2.2.10), such as those from Bacillus licheniformis disclosed in WO 99/27083.
  • Isomerases
  • Protein Disulfide Isomerase
  • Without being limited thereto suitable protein disulfide isomerases include PDls described in WO 95/01425 (Novo Nordisk A/S) and suitable glucose isomerases include those described in Biotechnology Letter, Vol. 20, No 6, June 1998, pp. 553-56.
  • Contemplated isomerases include xylose/glucose Isomerase (5.3.1.5) including Sweetzyme®.
  • Environmental Allergens
  • The environmental allergens that are of interest for epitope mapping include allergens from pollen, dust mites, mammals, venoms, fungi, food items, and other plants.
  • Pollen, allergens include but are not limited to those of the order Fagales, Oleales, Pinales, Poales, Asterales, and Urticales; including those from Betula, Alnus, Corylus, Carpinus, Olea, Phleum pratense and Artemisia vulgaris, such as Aln g1, Cor a1, Car b1, Cry j1, Amb a1 and a2, Art v1, Par j1, Ole e1, Ave v1, and Bet v1 (WO 99/47680).
  • Mite allergens include but are not limited to those from Derm. farinae and Derm. pteronys., such as Der f1 and f2, and Der p1 and p2.
  • From mammals, relevant environmental allergens include but are not limited to those from cat, dog, and horse as well as from dandruff from the hair of those animals, such as Fel d1; Can f1; Equ c1; Equ c2; Equ c3.
  • Venum allergens include but are not limited to PLA2 from bee venom as well as Apis m1 and m2, Ves g1, g2 and g5, Ves v5 and te Pol and Sol allergens.
  • Fungal allergens include those from Alternaria alt. and Cladospo. herb. such as Alt a1 and Cla h1.
  • Food allergens include but are not limited to those from milk (lactoglobulin), egg (ovalbumin), peanuts, hazelnuts, wheat (alpha-amylase inhibitor),
  • Other plant allergens include latex (hevea brasiliensis).
  • In addition, a number of proteins of interest for expression in transgenic plants could be useful objects for epitope engineering. If for instance a heterologous enzyme is introduced into a transgenic plant e.g. to increase the nutritional value of food or feed derived from that plant, that enzyme may lead to allergenicity problems in humans or animals ingesting the plant-derived material. Epitope mapping and engineering of such heterologous enzymes or other proteins of transgenic plants may lead to reduction or elimination of this problem. Hence, the methods of this patent are also useful for potentially modifying proteins for heterologous expression in plants and plant cells.
  • Materials and Methods
  • Materials
  • ELISA reagents:
    • Horse Radish Peroxidase labelled pig anti-rabbit-Ig (Dako, DK, P217, dilution 1:1000)
    • Rat anti-mouse IgE (Serotec MCA419; dilution 1:100)
    • Mouse anti-rat IgE (Serotec MCA193; dilution 1:200)
    • Biotin-labelled mouse anti-rat IgGl monoclonal antibody (Zymed 03-9140; dilution 1:1000)
    • Biotin-labelled rat anti-mouse IgGl monoclonal antibody (Serotec MCA336B; dilution 1:2000)
    • Streptavidin-horse radish peroxidase (Kirkegard & Perry 14-30-00; dilution 1:1000).
  • Buffers and Solutions:
    PBS (pH 7.2 (1 liter))
    NaCl 8.00 g
    KCl 0.20 g
    K2HPO4 1.04 g
    KH2PO4 0.32 g
      • Washing buffer PBS, 0.05% (v/v) Tween 20
      • Blocking buffer PBS, 2% (wt/v) Skim Milk powder
      • Dilution buffer PBS, 0.05% (v/v) Tween 20, 0.5% (wt/v) Skim Milk powder
      • Citrate buffer 0.1 M, pH 5.0-5.2
      • Stop-solution (DMG-buffer)
      • Sodium Borate, borax (Sigma)
      • 3,3-Dimethyl glutaric acid (Sigma)
      • Tween 20: Poly oxyethylene sorbitan mono laurate (Merck cat no. 822184)
      • PMSF (phenyl methyl sulfonyl flouride) from Sigma
      • Succinyl-Alanine-Alanine-Proline-Phenylalanine-paranitro-anilide (Suc-MPF-pNP) Sigma no. S-7388, Mw 624.6 g/mol.
      • mPEG (Fluka)
        Coloring substrate:
  • OPD: o-phenylene-diamine, (Kementec cat no. 4260)
  • Methods
  • Automatic epitope mapping
  • Implementation
  • The implementation consists of 3 pieces of code:
    • 1. The core program (see above), written in C (see Appendix A).
    • 2. A “wrapping” cgi-script run by the web server, written in Python (see Appendix B).
    • 3. A HTML page defining the input/submission form (see Appendix C).
  • The wrapper receives the input and calls the core program and several other utilities. Apart from the standard Unix utility programs (mv, rm, awk, etc..) the following must be installed:
      • A web server capable of running cgi-scripts, eg. Apache
      • Python 1.5 or later
      • Gnuplot 3.7 or later
      • DSSP, version July 1995
        The core program
        Inputs
    • 1. A Brookhaven PDB file with the structure of the protein
    • 2. The output of DSSP called with the above PDB file.
    • 3. Maximum distance between adjacent residues
    • 4. Minimum solvent accessible surface area for each residue
    • 5. Maximum epitope size (max distance between any two residues in epitope)
    • 6. Maximum number of non-redundant epitopes to include (0=all)
    • 7. The shortest acceptable epitope (as a fraction of the length of the epitope consensus sequence).
    • 8. Epitope consensus sequence describing which residues are possible at the different positions. An example is shown below:
      • KR (Lys or Arg allowed)
      • AILV- (Ala, lie, Leu, Val or missing residue allowed)
      • * (All residues allowed, but there must be a residue)
      • ? (All or missing residue allowed)
      • DE (Asp or Glu allowed)
      • (*, ? or −in first or last position is allowed but obsolete. (−in first position is ignored.))
  • Examples of matching epitopes: KAAKD (SEQ ID NO: 41), KLASD (SEQ ID NO: 42), KLYSD (SEQ ID NO: 43), KLY-D (SEQ ID NO: 44), R-M-D.
  • The Epitope Searching Algorithm
  • The “core” of the program is the algorithm that scans the protein surface for the epitope patterns. The principle is that several “trees” are built, where each of their branches describes one epitope:
      • 1. All residues in the protein are checked according to: a) Does the residue type match the first residue of the epitope consensus sequence. b) Is the surface accessibility greater than or equal to the given threshold. If both requirements are fulfilled, the protein residue is considered as one root in the epitope tree. Remark that there are usually many roots.
      • 2. For each of the residues defined as roots, all residues within the the given threshold distance between adjacent residues (e.g. 7 Angstroms) are checked for the same as above: a) Does the residue type match the second residue of the epitope consensus sequence. b) Is the surface accessibility greater than or equal to the given threshold. If yes, the protein residue is considered as a “child” of the root. The spatial position of a residue is defined as the coordinates of its C-alpha atom.
      • 3. The procedure from step 2 is repeated for the next residue in the epitope consensus sequence, where each of the “childs” found in step 2 are now “roots” of new childs. If a gap is defined in the epitope consensus sequence, a “missing” residue is allowed, and the coordinates of the root (also called “parent”) is used.
      • 4. This procedure is repeated for all residues in the epitope consensus sequence.
      • 5. In this way a number of trees (corresponding to the number of roots found in step 1) are found. Notice that the same protein residue can be present many places in the trees.
      • 6. If no epitopes that matches the length of the epitope consensus sequence are found, the longest shorter epitopes that matches the first n residues of the epitope consensus sequence are used, where n is an integer smaller than the length of the epitope consensus sequence. If n is smaller than the length of the epitope consensus sequence multiplied by the fraction value defining the shortest acceptable epitope length, no epitopes are written to the output, and steps 7, 8 and 9 are skipped.
      • 7. The epitopes are extracted from the trees by traversing down from each of the “childs” in the last level. The algorithm also finds epitopes which have the same protein residue present more than once. This is, of course, an artifact and such epitopes are discarded. Every epitope is then checked for its size, that is, the maximum distance between any two residues which are members of the epitope. If this exceeds the threshold, the epitope is discarded.
      • 8. Redundant epitopes are removed. Epitopes containing one or more gaps are redundant if they are subsets of other epitopes without or with fewer gaps. For example: A82-gap-F45-G44-K43 is a subset of A82-L46-F45-G44-K43, and is therefore discarded.
      • 9. For every epitope, the total solvent accessible surface area is calculated (by adding the contributions from each residue as found by the DSSP program). The epitopes are sorted according to this area in descending order. If a maximum number of n non-redundant epitopes has been specified, the n epitopes with largest solvent accessible surface area are selected.
      • 10. The output consists of a list of the found epitopes, along with information of the epitope consensus sequence used and other internal parameters. A separate file containing the number of epitopes that each of the protein residues is a member of is also written.
        The wrapper
        Inputs
      • 1. One PDB file, describing one structure, or one ZIP file, containing a number of PDB files, each describing one structure. The ZIP file must not contain subfolders.
      • 2. An epitope consensus sequence or which part of the current epitope library to use (full library or IgE part or IgG part).
      • 3. Maximum distance between adjacent residues
      • 4. Minimum solvent accessible surface area for each residue
      • 5. Maximum epitope size (max distance between any two residues in epitope)
      • 6. Maximum number of non-redundant epitopes to include (0=all)
      • 7. Whether to use sequential numbering (1,2,3,4 . . . etc) or PDB-file numbering.
        Description
  • The core program accepts only one structure and one epitope consensus sequence. It is usually desirable to use a library of epitope consensus sequences and sometimes several protein structures. The wrapper reads the user input and calls the utility programs and the core program the necessary number of times. The output is collected and presented on the web page returned to the user.
  • Depending on the type of input, the wrapper works in different modes:
      • Epitope consensus can be given directly or taken from a library
      • Input type can be a single PDB file or a collection of PDB file given as a ZIP-file.
  • Any of the four possible combinations are allowed.
  • The epitope library consists of a number of text files, each containing one epitope consensus sequence as specified above.
  • The layout of the wrapper is like this:
      • 1. Check if the program is already in use from somewhere else (this is done by checking for a lock file when the wrapper starts. If it does not exist, it is created and removed again when the program is finished).
      • 2. If the epitope consensus sequences are to be read from the library, make an internal list of the desired library entries.
      • 3. If the input type is a ZIP file, unzip the file and create one new directory for each of the conatined PDB files. Move each PDB file to its corresponding directory.
      • 4. Do a loop over the structures and/or epitope consensus sequences. For each astructure/epitope consensus sequence pair, DSSP and the core program is called with the required parameters. If the input type is a ZIP file, the outputs are put in the appropriate directories.
      • 5. If the epitope library is used, a sum file containing the total number of epitopes each residue is a member of. (Such a file is generated by the core program for each epitope consensus sequence—here a sum of these files is calculated). If input type is a ZIP file, a sum file is generated for each structure and put in the appropriate directory.
      • 6. If the epitope library is used, a file containing the total number of epitopes found from each entry in the epitope library. If the input type is a PDB file, the file contains only one line (with a number of data corresponding to the library size). If the input type is a ZIP file, there is one line for each structure.
      • 7. Depending on the combination of input type (ZIP or single PDB) and epitope consensus sequence source (typed-in or epitope library), different information is returned to the user: Single PDB+typed in epitope: Graph of numbers of epitopes that each residue is a member of. List of found epitopes.
        • ZIP file+typed in epitope: Graphs (one for each structure) of numbers of epitopes that each residue is a member of. Lists (one for each structure) of found epitopes.
        • Single PDB+epitope library: Graph of numbers of epitopes that each residue is a member of (total for the complete library).
        • ZIP file+epitope library: Graphs (one for each structure) of numbers of epitopes that each residue is a member of (total for the complete library).
        • Data flow sheets for the four different are shown in the FIG.
        • 8. For all modes except Single PDB +typed in epitope, a ZIP file containing all output files is created and returned to the user.
          Immunisation of Brown Norway Rats
  • Twenty intratracheal (IT) immunisations were performed weekly with 0.100 ml 0.9% (wt/vol) NaCl (control group), or 0.100 ml of a protein dilution (˜0.1−1 mg/ml). Each group contained 10 rats. Blood samples (2 ml) were collected from the eye one week after every second immunisation. Serum was obtained by blood clothing and centrifugation and analysed as indicated below.
  • Immunisation of Balb/C Mice
  • Twenty subcutaneous (SC) immunisations were performed weekly with 0.05 ml 0.9% (wt/vol) NaCl (control group), or 0,050 ml of a protein dilution (˜0.01−0.1 mg/ml). Each group contained 10 female Balb/C mice (about 20 grams) purchased from Bomholdtgaard, Ry, Denmark. Blood samples (0.100 ml) were collected from the eye one week after every second immunisation. Serum was obtained by blood clothing and centrifugation and analysed as indicated below.
  • ELISA Procedure for Detecting Serum Levels of IgE and IqG
  • Specific IgG1 and IgE levels were determined using the ELISA specific for mouse or rat IgG1 or IgE. Differences between data sets were analysed by using appropriate statistical methods.
  • Activation of CovaLink Plates
  • A fresh stock solution of cyanuric chloride in acetone (10 mg/ml) is diluted into PBS, while stirring, to a final concentration of 1 mg/ml and immediately aliquoted into CovaLink NH2 plates (100 microliter per well) and incubated for 5 minutes at room temperature. After three washes with PBS, the plates are dryed at 50° C. for 30 minutes, sealed with sealing tape, and stored in plastic bags at room temperature for up to 3 weeks.
  • Mouse anti-Rat IgE was diluted 200× in PBS (5 microgram/ml). 100 microliter was added to each well. The plates were coated overnight at 4° C.
  • Unspecific adsorption was blocked by incubating each well for 1 hour at room temperature with 200 microliter blocking buffer. The plates were washed 3× with 300 microliter washing buffer.
  • Unknown rat sera and a known rat IgE solution were diluted in dilution buffer: Typically 10×, 20× and 40× for the unknown sera, and ½ dilutions for the standard IgE starting from 1 μg/ml. 100 microliter was added to each well. Incubation was for 1 hour at room temperature.
  • Unbound material was removed by washing 3× with washing buffer. The anti-rat IgE (biotin) was diluted 2000× in dilution buffer. 100 microliter was added to each well. Incubation was for 1 hour at room temperature. Unbound material was removed by washing 3× with washing buffer.
  • Streptavidin was diluted 1000× in dilution buffer. 100 microliter was added to each well. Incubation was for 1 hour at room temperature. Unbound material was removed by washing 3× with 300 microliter washing buffer. OPD (0.6 mg/ml) and H2O2 (0.4 microliter/ml) were dissolved in citrate buffer. 100 microliter was added to each well. Incubation was for 30 minutes at room temperature. The reaction was stopped by addition of 100 microliter H2SO4. The plates were read at 492 nm with 620 nm as reference.
  • Similar determination of IgG can be performed using anti Rat-lgG and standard rat lgG reagents.
  • Similar determinations of IgG and IgE in mouse serum can be performed using the corresponding species-specific reagents.
  • Direct IgE Assay
  • To determine the IgE binding capacity of protein variants one can use an assay, essentially as described above, but using sequential addition of the follwing reagents:
      • 1) Mouse anti-rat IgE antibodies coated in wells;
      • 2) Known amounts of rat antiserum containing igE against the parent protein;
      • 3) Dilution series of the protein variant in question (or parent protein as positive control);
      • 4) Rabbit anti-parent antibodies
      • 5) HRPO-labelled anti-rabbit Ig antibodies for detection using OPD as described.
  • The relative IgE binding capacity (end-point and/or affinity) of the protein variants relative to that of the parent protein are determined from the dilution-response curves. The IgE-positive serum can be of other animals (including humans that inadvertently have been senstitized to the parent protein) provided that the species-specific anti-IgE capture antibodies are changed accordingly.
  • Competitive ELISA (C-ELISA)
  • C-ELISA was performed according to established procedures. In short, a 96 well ELISA plate was coated with the parent protein. After proper blocking and washing, the coated antigen was incubated with rabbit anti-enzyme polyclonal antiserum in the presence of various amounts of modified protein (the competitior). The residual amount of rabbit antiserum was detected by horseraddish peroxidase-labelled pig anti-rabbit immunoglobulin.
  • Protein Sequences and Alignments
  • For purposes of the present invention, the degree of homology may be suitably determined by means of computer programs known in the art, such as GAP provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wis., USA 53711) (Needleman, S. B. and Wunsch, C. D., (1970), Journal of Molecular Biology, 48, 443-45).
  • Subtilisin Proteases
  • In the present invention, corresponding (or homologous) positions in subtilisin protease sequences are defined by alignment with Subtilisin Novo (BPN′) from B. amyloliquefaciens, as shown in Table 1A for Alcalase, Protease B, Esperase, Protease C, Protease D, Protease E, Protease A, PD498, Properase, Relase, Savinase. Table 1A: Alignment of different proteases to the sequence of BPN′
  • Alcalase
  • 69.5% identity in 275 residues overlap; Score: 953.0; Gap frequency: 0.4%
    Alcalase, 1 AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYN-TD (SEQ ID NO: 45)
    BPN′, 1 AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQD (SEQ ID NO: 46)
    ** ****   ***     **  * ****** * **  ***** * **** *  *  *  *
    Alcalase, 60 GNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMD
    BPN′, 61 DNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMD
     * ************ *  ********  *******   *** ** *  *****  * **
    Alcalase, 120 VINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAV
    BPN′, 121 VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAV
    ******** *** * * *** * * ********** ** *   * *** ** ********
    Alcalase, 180 DSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPN
    BPN′, 181 DSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPN
    **   ******** ** *****    ** * * *  ***********************
    Alcalase, 240 LSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
    BPN′, 241 WTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
        ***  *  * * ** *********** ****

    Protease B
  • 59.6% identity in 275 residues overlap; Score: 820.0; Gap frequency: 2.2%
    PROTEASE B, 1 AQTIPWGISRVQAPAAHNRGLTGSGVKVAVLDTGI-STHPDLNIRGGASFVPGE-PSTQD (SEQ ID NO: 47)
    BPN′, 1 AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQD (SEQ ID NO: 46)
    **  * * *   *** *  * *** ***** * ** * ****   **** ** * *  **
    PROTEASE B, 59 GNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMH
    BPN′, 61 DNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMD
     * ******** ***************  ********  ***  * *  * ***  * *
    PROTEASE B, 119 VANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGA----GSISYPARYANAMAVGAT
    BPN′, 121 VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAV
    * * *** ** ** *  **  *   ** **** ** *         **  *    ****
    PROTEASE B, 175 DQNNNRASFSQYGAGLDIMAPGVNIQSTYPGSTYASDNGTSMATPHVAGAAALVKQKNPS
    BPN′, 181 DSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPN
    *  * *****  *  ** ***** **** **  *   ****** *********   * *
    PROTEASE B, 235 WSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
    BPN′, 241 WTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
    * * * *  * ** * **    ** ** *  **

    Esperase
  • 54.7% identity in 274 residues overlap; Score: 745.0; Gap frequency: 2.2%
    Esperase, 1 QTVPWGISFINTQQAHNRGIFGNGARVAVLDTGI-ASHPDLRIAGGASFISSE-PSYHDN (SEQ ID NO: 48)
    BPN′, 2 QSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDD (SEQ ID NO: 46)
    * ** * * *     *  *  *    *** * **  *****  *****   ** *   *
    Esperase, 59 NGHGTHVAGTIAALNNSIGVLGVAPSADLYAVKVLDRNGSGSLASVAQGIEWAINNNMHI
    BPN′, 62 NSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDV
    * ******** ***************  *******   ***       ****** ***
    Esperase, 119 INMSLGSTSGSSTLELAVNRANNAGILLVGAAGNTGRQG----VNYPARYSGVMAVAAVD
    BPN′, 122 INMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVD
    ******  ***  *  **  *   *   * **** *  *    * **  *  * ** ***
    Esperase, 175 QNGQRASFSTYGPEIEISAPGVNVNSTYTGNRYVSLSGTSMATPHVAGVAALVKSRYPSY
    BPN′, 182 SSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNW
       ******  ***    ****   **  ** *    ***** ***** ***  *  *
    Esperase, 235 TNNQIRQRINQTATYLGSPSLYGNGLVHAGRATQ
    BPN′, 242 TNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
    ** * *     * * **    ** **     * *

    Protease C
  • 59.6% identity in 275 residues overlap; Score: 825.0; Gap frequency: 2.2%
    Protease C, 1 AQSVPWGISRVQAPAAHNRGLTGSGVRVAVLDTGI-STHPDLNIRGGASFVPGE-PSTQD (SEQ ID NO: 49)
    BPN′, 1 AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQD (SEQ ID NO: 46)
    ***** * *  *** *  * *** * *** * ** * ****   **** ** * *  **
    Protease C, 59 GNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSYSSIAQGLEWAGNNGMH
    BPN′, 61 DNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMD
     * ******** ***************  ********  *** ** *  * ***  * *
    Protease C, 119 VASLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGA----GSISYPARYANAMAVGAT
    BPN′, 121 VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAV
    *   *** ** ** *  **  *   ** **** ** *         **  *    ****
    Protease C, 175 DQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPS
    BPN′, 181 DSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPN
    *  * *****  *  **  ****  *** **  *   ****** *********   * *
    Protease C, 235 WSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAAAR
    BPN′, 241 WTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
    * * * *  * ** * **    ** ** *  ***

    Protease D
  • 59.3% identity in 275 residues overlap; Score: 815.0; Gap frequency: 2.2%
    Protease D, 1 AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGI-STHPDLNIRGGASFVPGE-PSTQD (SEQ ID NO: 50)
    BPN′, 1 AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQD (SEQ ID NO: 46)
    ***** * *   *** *  * *** ***** * ** * ****   **** ** * *  **
    Protease D, 59 GNGHGTHVAGTIAALDNSIGVLGVAPSAELYAVKVLGASGSGAISSIAQGLEWAGNNGMH
    BPN′, 61 DNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMD
     * ******** *** ***********  ********  ***  * *  * ***  * *
    Protease D, 119 VANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGA----GSISYPARYANAMAVGAT
    BPN′, 121 VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAV
    * * *** ** ** *  **  *   ** **** ** *         **  *    ****
    Protease D, 175 DQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPS
    BPN′, 181 DSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPN
    *  * *****  *  **  ****  *** **  *   ****** *********   * *
    Protease D, 235 WSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
    BPN′, 241 WTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
    * * * *  * ** * **    ** ** *  **

    Protease E
  • 58.2% identity in 275 residues overlap; Score: 800.0; Gap frequency: 2.2%
    Protease E, 1 AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGI-STHPDLNIRGGASFVPGE-PSTQD (SEQ ID NO: 51)
    BPN′, 1 AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQD (SEQ ID NO: 46)
    ***** * *   *** *  * *** ***** * ** * ****   **** ** * *  **
    Protease E, 59 GNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGGGAISSIAQGLEWAGNNGMH
    BPN′, 61 DNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMD
     * ******** ***************  ********  * *  * *  * ***  * *
    Protease E, 119 VANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGA----DSISYPARYANAMAVGAT
    BPN′, 121 VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAV
    * * *** ** ** *  **  *   ** **** ** *         **  *    ****
    Protease E, 175 DQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAVLVKHKNPS
    BPN′, 181 DSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPN
    *  * *****  *  **  ****  *** **  *   ****** ******* *   * *
    Protease E, 235 WSNVRIRDHLKKTATSLGSTNLYGSGLVNAEAATR
    BPN′, 241 WTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
    * *   *  *  * * **    ** ** *  **

    Protease A
  • 58.9% identity in 275 residues overlap; Score: 812.0; Gap frequency: 2.2%
    Protease A, 1 AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGI-STHPDLNIRGGASFVPGE-PSTQD (SEQ ID NO: 52)
    BPN′, 1 AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQD (SEQ ID NO: 46)
    ***** * *   *** *  * *** ***** * ** * ****   **** ** * *  **
    Protease A, 59 GNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMH
    BPN′, 61 DNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMD
     * ******** ***************  ********  ***  * *  * ***  * *
    Protease A, 119 VANLSLGSPSAGGTLEQAVNSATSRGVLVVAASGNSGA----GSISAPASYANAMAVGAT
    BPN′, 121 VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAV
    * * *** **    *  **  *   ** **** ** *          *  *    ****
    Protease A, 175 DQNNNRASFSQYGPGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPS
    BPN′, 181 DSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPN
    *  * *****  ** **  ****  *** **  *   ****** *********   * *
    Protease A, 235 WSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
    BPN′, 241 WTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
    * * * *  * ** * **    ** ** *  **

    PD498
  • 47.7% identity in 266 residues overlap; Score: 487.0; Gap frequency: 4.9%
    PD498, 13 YGPQNTSTPAAWDVTRGSSTQTVAVLDSGVDYNHPDLARKVIKGYDFIDRDN-NPMDLNG (SEQ ID NO: 53)
    BPN′, 6 YGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASMVPSETPNFQDDNS (SEQ ID NO: 46)
    **      **        *   *** *** *  ****  **  *         *  * *
    PD498, 72 HGTHVAGTVAADTNNGIGVAGMAPDTKILAVRVLDANGSGSLDSIASGIRYAADQGAKVL
    BPN′, 64 HGTHVAGTVAA-LNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVI
    ***********  ** *** * **     ** **   ***    *  **  *      *
    PD498, 132 NLSLGCECNSTTLKSAVDYAWNKGAVVVAAAGND----NVSRTFQPASYPNAIAVGAIDS
    BPN′, 123 NMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDS
    * ***    *  ** *** *   * ********       *    *  **  ***** **
    PD498, 188 NDRKASFSNYGTWVDVTAPGVNIASTVPNNGYSYMSGTSMASPHVAGLAALLASQGKN--
    BPN′, 183 SNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWT
        ****  *   ** **** * ** * * *    *********** ***  *   *
    PD498, 246 NVQIRQAIEQTADKISGTGTNFKYGK
    BPN′, 243 NTQVRSSLQNTTTKL---GDSFYYGK
    * * *     *  *    *  * ***

    Properase
  • 58.9% identity in 275 residues overlap; Score: 813.0; Gap frequency: 2.2%
    Properase, 1 AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGI-STHPDLNIRGGASFVPGE-PSTQD (SEQ ID NO: 54)
    BPN′, 1 AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQD (SEQ ID NO: 46)
    ***** * *   *** *  * *** ***** * ** * ****   **** ** * *  **
    Properase, 59 GNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGGGSNSSIAQGLEWAGNNGMH
    BPN′, 61 DNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMD
     * ******** **************   ********  * *  * *  * ***  * *
    Properase, 119 VANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGA----GSISYPARYANAMAVGAT
    BPN′, 121 VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAV
    * * *** ** ** *  **  *   ** **** ** *         **  *    ****
    Properase, 175 DQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPS
    BPN′, 181 DSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPN
    *  * *****  *  **  ****  *** **  *   ****** *********   * *
    Properase, 235 WSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
    BPN′, 241 WTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
    * * * *  * ** * **    ** ** *  **

    Relase
  • 60.7% identity in 275 residues overlap; Score: 858.0; Gap frequency: 1.8%
    Relase, 1 AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGIDSTHPDLNIRGGASFVPGE-PSTQD (SEQ ID NO: 55)
    BPN′, 1 AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQD (SEQ ID NO: 46)
    ***** * *   *** *  * *** ***** * **** ****   **** ** * *  **
    Relase, 60 GNGHGTHVAGTIAALDNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMD
    BPN′, 61 DNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMD
     * ******** *** ***********  ********  ***  * *  * ***  * **
    Relase, 120 VANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGA----GSISYPARYANAMAVGAT
    BPN′, 121 VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAV
    * * *** ** ** *  **  *   ** **** ** *         **  *    ****
    Relase, 176 DQNNNRASFSQYGAELDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVLQKNPS
    BPN′, 181 DSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPN
    *  * *****  * ***  ****  *** **  *   ****** ********* * * *
    Relase, 236 WSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
    BPN′, 241 WTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
    * * * *  * ** * **    ** ** *  **

    Savinase
  • 59.6% identity in 275 residues overlap; Score: 821.0; Gap frequency: 2.2%
    Savinase, 1 AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGI-STHPDLNIRGGASFVPGE-PSTQD (SEQ ID NO: 56)
    BPN′, 1 AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQD (SEQ ID NO: 46)
    ***** * *   *** *  * *** ***** * ** * ****   **** ** * *  **
    Savinase, 59 GNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMH
    BPN′, 61 DNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMD
     * ******** ***************  ********  ***  * *  * ***  * *
    Savinase, 119 VANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGA----GSISYPARYANAMAVGAT
    BPN′, 121 VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAV
    * * *** ** ** *  **  *   ** **** ** *         **  *    ****
    Savinase, 175 DQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPS
    BPN′, 181 DSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPN
    *  * *****  *  **  ****  *** **  *   ****** *********   * *
    Savinase, 235 WSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
    BPN′, 241 WTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
    * * * *  * ** * **    ** ** *  **
  • To find the homologous positions in subtilisin protease sequences not shown in the alignment of Table 1A, the sequence of interest is aligned to the sequence of BPN′ as shown in Table 1B for YaB protease and Subtilisin sendai. The new sequence is aligned to the BPN′ sequence by using the GAP alignment to the most homologous sequence found by the GAP program. GAP is provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wis., USA 53711) (Needleman, S. B. and Wunsch, C. D., (1970), Journal of Molecular Biology, 48, 443-45).
  • The sequence of the YaB protease is disclosed by Kaneko, R.; Koyama, N.; Tsai,Y. -C.; Juang,R. -Y.; Yoda, K.; Yamasaki, M.; Molecular cloning of the structural gene for alkaline elastase YaB, a new subtilisin produced by an alkalophilic Bacillus strain. J. Bacteriol. 171:5232 (1989), it has Swissprot number P20724, and is shown in SEQ ID NO: 35.
  • The sequence of the Subtilisin sendai is disclosed by Yamagata, Y.; Isshiki, K.; lchishima, E.; Subtilisin Sendai from alkalophilic Bacillus sp.: molecular and enzymatic properties of the enzyme and molecular cloning and characterization of the gene, aprS. Enzyme Microb. Technol. 17:653 (1995), it has SPTREMBL accession number Q45522, and is shown in SEQ ID NO: 34.
      • Identity to savinase: 81,7%
      • identity to savinase: 82,09%
  • Swissprot: P20724
    TABLE 1B
    Alignment of YAB protease to BPN′: 55.3% identity
    CLUSTAL W (1.7) multiple sequence alignment
    YAB -QTVPWGINRVQAPIAQSRGFTGTGVRVAVLDTGISN-HADLRIRGGASFVPGE-PNISD (SEQ ID NO: 57)
    BPN′ AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQD (SEQ ID NO: 46)
     *:**:*:.:::**  :*:*:**:.*:***:*:**.. *.**:: ****:**.* **:.*
    YAB GNGHGTQVAGTIAALNNSIGVLGVAPNVDLYGVKVLGASGSGSISGIAQGLQWAANNGMH
    BPN′ DNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMD
    .*.***:****:**************.  **.***** :***. * * :*::**  *.*.
    YAB IANMSLGSSAGSATMEQAVNQATASGVLVVAASGNSG----AGNVGFPARYANAMAVGAT
    BPN′ VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAV
    : *****..:***::: **::*.****:****:**.*    :..**:*.:*...:****.
    YAB DQNNNRATFSQYGAGLDIVAPGVGVQSTVPGNGYASFNGTSMATPHVAGVAALVKQKNPS
    BPN′ DSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPN
    *..*:**:**. *. **::****.:***:*** *.::******:*****.***: .*:*.
    YAB WSNVQIRNHLKNTATNLGNTTQFGSGLVNAEAATR
    BPN′ WTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
    *:*.*:*. *:**:*:**::  :*.**:*.:**::
    Alignment of Subtilisin sendai to BPN′: 55.6% identity.
    CLUSTAL W (1.7) multiple sequence alignment
    sendai NQVTPWGITRVQAPTAWTRGYTGTGVRVAVLDTGIS-THPDLNIRGGVSFVPGE-PSYQD (SEQ ID NO: 58)
    BPN′ AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQD (SEQ ID NO: 46)
     * .*:*:::::**:  ::****:.*:***:*:**. :****:: **.*:**.* *.:**
    sendai GNGHGTHVAGTIAALNNSIGVVGVAPNAELYAVKVLGANGSGSVSSIAQGLQWTAQNNIH
    BPN′ DNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMD
    .*.********:*********:****.: ********  ***. * * :*::*:  **:.
    sendai VANLSLGSPVGSQTLELAVNQATNAGVLVVAATGNNG----SGTVSYPARYANALAVGAT
    BPN′ VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAV
    * *:***.* ** :*: **::*. :**:****:**:*    *.**.**.:*...:****.
    sendai DQNNNRASFSQYGTGLNIVAPGVGIQSTYPGNRYASLSGTSMATPHVAGVAALVKQKNPS
    BPN′ DSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPN
    *..*:*****. *. *:::****.**** ***:*.: .*****:*****.***: .*:*.
    sendai WSNTQIRQHLTSTATSLGNSNQFGSGLVNAEAATR
    BPN′ WTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
    *:***:*. * .*:*.**:*  :*.**:*.:**::
  • These alignements reveal that that homology between various subtilisin proteases ranges between 100% and 40%.
  • Unless specified, subtilisin sequences and positions mentioned in the present invention, are given in the BPN′ numeration, and can be converted by alignement as described above (Tables 1A and 1B).
  • Sequence identities between different pairs of proteases are given below: Sequence identity to BPN′:
    Savinase 60.4%
    Alcalase 69.5%
    BLAPR 60.4%
    ProteaseC  0.4%
    ProteaseD  0.0%
    ProteaseE  8.2%
    Protease A  0.0%
    Properase  9.6%
    Relase 61.5%
    PD498 44.8%
    sendai 55.6%
    YAB 55.3%
  • Sequence Identity to Savinase
    Alcalase 60.9%
    BLAPR 98.1%
    ProteaseC  8.5%
    ProteaseD  8.9%
    ProteaseE  6.7%
    Protease A  7.8%
    Properase  8.9%
    Relase 98.1%
    PD498 44.3%
    sendai 81.4%
    YAB 81.8%

    Structures
  • The protein structure of PD498 is disclosed in WO 98/35026 (Novo Nordisk). The structure of Savinase can be found in BETZEL et al, J. MOL. BIOL., Vol. 223, p. 427, 1992 (1svn.pdb).
  • Homology Modelling
  • Three dimensional structural models of the subtilisins properase, relase, ProteaseC, ProteaseD, ProteaseE, and PROTEASE B were constructed based on three dimensional structure of Savinase (Protein Data Bank entry 1SVN; Betzel, C., Klupsch, S., Papendorf, G., Hastrup, S., Branner, S., Wilson, K. S.: Crystal structure of the alkaline proteinase Savinase from Bacillus lentus at 1.4 A resolution. J Mol Biol 223 pp. 427 (1992)) using the Modeller 5o ({overscore (S)} ali, A.; T. L. Blundell, “Definition of general topological equivalence in protein structures: A procedure involving comparison of properties and relationships through simulated annealing and dynamic programming,” J. Mol. Biol., 212 403-428 (1990)) module of the Insight 2000 molecular modelling package (Biosym inc.). Default parameters were used with the alignments shown in FIG. 1A as input, e.g. alignment between the columns labelled Savinase and PROTEASE B served as input alignment in construction of a PROTEASE B structural model. The Modeller module by default output ten structural models, of these the model with lowest ‘modeller objective function’ score was chosen as representing PROTEASE B structure.
  • Lipase
  • The sequence of the T. lanuginosus lipase (trade name Lipolase) is provided in SEQ ID NO: 1 and the structure is disclosed in WO 98/35026 and as “1tib”, available in Structural Classification of Proteins (SCOP) on the Internet.
  • Amylase
  • The amylase used in the examples is the alpha-amylase of Bacillus halmapalus (WO 96/23873), which is called amylase SP722 (the wild-type). Its sequence is shown in SEQ ID NO: 2 and the corresponding protein structure was built from the BA2 structure, as described in WO 96/23874. The first four amino acids of the structural model are not defined, hence the sequence used for numeration of amino acid residues in the examples of this invention is four amino acids shorter than the one of the full length protein SP722.
  • Several variants of this amylase are available (WO 96/23873). One particularly useful variant has deleted two amino acid residues at D-G at positions 183 and 184 of the SEQ ID NO: 2 (corresponding to residues 179 and 180 of the modelled structure). This variant is called JE-1 or Natalase.
  • Another amylase that is particularly useful is the amylase AA560: This alkaline alpha-amylase may be derived from a strain of Bacillus sp. DSM 12649. The strain was deposited on 25th Jan. 1999 by the assignee under the terms of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at Deutshe Sammmlung von Microorganismen und Zellkulturen GmbH (DSMZ), Mascheroder Weg 1b, D-38124 Braunschweig DE.
  • Laccase
  • The laccase used in this invention is that from Coprinus cinereus (WO 98/38287), the sequence of which is shown as SEQ ID NO: 3. The structure of the Myceliophthora thermophila laccase can be built by homology modeling to the Coprinus cinereus laccase as shown in WO 98/38287.
  • Cellulase
  • The cellulase sequence and structure used in the present invention is that of the core fragment of endoglucanase V from Humicola insolens (aka Cel45 or Carezyme). The core fragment structure is available as 3eng.pdb (G. J.DAVIES et al. ACTA CRYSTALLOGR.,SECT.D, Vol. 52, p. 7 1996; G. J.DAVIES et al. BIOCHEMISTRY, V. 34, p. 16210, 1995); SwissProt accession number P43316, and the sequences shown in SEQ ID 4. The corresponding full-length sequence is disclosed in WO 91/17243 and shown here in SEQ ID NO: 5. The numeration of all description and claims of this invention pertain to the core fragment, however, it is contemplated that all claims are also valid for the corresponding positions in the full-lengthprotein.
    TABLE 1
    Alignment and numeration scheme for subtilisins (SEQ ID NOS: 46, 45, 47, 48, 49, 50, 51, 52, 54, 55, 56, 53, respectively)
    BPN′ Alcalase ProteaseB Esperase ProteaseC ProteaseD ProteaseE ProteaseA Properase Relase Savinase PD498
     −6 W
     −5 S
     −4 P
     −3 N
     −2 D
     −1 P
     1 A A A A A A A A A A Y
     2 Q Q Q Q Q Q Q Q Q Q Q Y
     3 S T T T S S S S S S S S
     3a A
     4 V V I V V V V V V V V Y
     5 P P P P P P P P P P P Q
     6 Y Y W W W W W W W W W Y
     7 G G G G G G G G G G G G
     8 V I I I I I I I I I I P
     9 S P S S S S S S S S S Q
     10 Q L R F R R R R R R R N
     11 I I V I V V V V V V V T
     12 K K Q N Q Q Q Q Q Q Q S
     13 A A A T A A A A A A A T
     14 P D P Q P P P P P P P P
     15 A K A Q A A A A A A A A
     16 L V A A A A A A A A A A
     17 H Q H H H H H H H H H W
     18 S A N N N N N N N N N D
     19 Q Q R R R R R R R R R V
     20 G G G G G G G G G G G
     21 Y F L I L L L L L L L T
     22 T K T F T T T T T T T R
     23 G G G G G G G G G G G G
     24 S A S N S S S S S S S S
     25 N N G G G G G G G G G S
     26 V V V A V V V V V V V T
     27 K K K R R K K K K K K Q
     28 V V V V V V V V V V V T
     28a V
     29 A A A A A A A A A A A A
     30 V V V V V V V V V V V V
     31 I L L L L L L L L L L L
     32 D D D D D D D D D D D D
     33 S T T T T T T T T T T S
     34 G G G G G G G G G G G G
     35 I I I I I I I I I I I V
     36 D Q D D
     37 S A S A S S S S S S S Y
     38 S S T S T T T T T T T N
     39 H H H H H H H H H H H H
     40 P P P P P P P P P P P P
     41 D D D D D D D D D D D D
     42 L L L L L L L L L L L L
     43 K N N R N N N N N N N A
     44 V V I I I I I I I I I R
     44a K
     44b V
     45 A V R A R R R R R R R I
     46 G G G G G G G G G G G K
     47 G G G G G G G G G G G G
     48 A A A A A A A A A A A Y
     49 S S S S S S S S S S S D
     50 M F F F F F F F F F F F
     51 V V V I V V V V V V V I
     52 P A P S P P P P P P P D
     53 S G G S G G G G G G G R
     54 E E E E E E E E E E E D
     55 T A P P P P P P P P N
     56 P Y P N
     57 N N S S S S S S S S S P
     58 F T Y T T T T T T T M
     59 Q T Q H Q Q Q Q Q Q Q
     60 D D D D D D D D D D D D
     61 D G G N G G G G G G G L
     62 N N N N N N N N N N N N
     63 S G G G G G G G G G G G
     64 H H H H H H H H H H H H
     65 G G G G G G G G G G G G
     66 T T T T T T T T T T T T
     67 H H H H H H H H H H H H
     68 V V V V V V V V V V V V
     69 A A A A A A A A A A A A
     70 G G G G G G G G G G G G
     71 T T T T T T T T T T T T
     72 V V I I I I I I I I I V
     73 A A A A A A A A A A A A
     74 A A A A A A A A A A A A
     75 L L L L L L L L L L L D
     75a T
     76 N D N N N D N N N D N N
     77 N N N N N N N N N N N N
     78 S T S S S S S S S S S G
     79 I T I I I I I I I I I I
     80 G G G G G G G G G G G G
     81 V V V V V V V V V V V V
     82 L L L L L L L L L L L A
     83 G G G G G G G G G G G G
     84 V V V V V V V V V V V M
     85 A A A A A A A A A A A A
     86 P P P P P P P P P P P P
     87 S S S S S S S S N S S D
     88 S V A A A A A A A A A T
     89 A S E D E E E E E E E K
     90 L L L L L L L L L L L I
     91 Y Y Y Y Y Y Y Y Y Y Y L
     92 A A A A A A A A A A A A
     93 V V V V V V V V V V V V
     94 K K K K K K K K K K K R
     95 V V V V V V V V V V V V
     96 L L L L L L L L L L L L
     97 G N G D G G G G G G G D
     98 D S A R A A A A A A A A
     99 A S S N S S S S S S S N
    100 G G G G G G G G G G G G
    101 S S S S S S G S G S S S
    102 G G G G G G G G G G G G
    103 Q S S S S A A S S S S S
    104 Y Y V L Y I I V N V V L
    105 S S S A S S S S S S S D
    106 W G S S S S S S S S S S
    107 I I I V I I I I I I I I
    108 I V A A A A A A A A A A
    109 N S Q Q Q Q Q Q Q Q Q S
    110 G G G G G G G G G G G G
    111 I I L I L L L L L L L I
    112 E E E E E E E E E E E R
    113 W W W W W W W W W W W Y
    114 A A A A A A A A A A A A
    115 I T G I G G G G G G G A
    116 A T N N N N N N N N N D
    117 N N N N N N N N N N N Q
    118 N G G N G G G G G G G G
    119 M M M M M M M M M M M A
    120 D D H H H H H H H D H K
    121 V V V I V V V V V V V V
    122 I I A I A A A A A A A L
    123 N N N N S N N N N N N N
    124 M M L M L L L L L L L L
    125 S S S S S S S S S S S S
    126 L L L L L L L L L L L L
    127 G G G G G G G G G G G G
    128 G G S S S S S S S S S C
    129 P A P T P P P P P P P E
    130 S S S S S S S S S S S C
    131 G G P G P P P A P P P N
    132 S S S S S S S G S S S S
    133 A T A S A A A G A A A T
    134 A A T T T T T T T T T T
    135 L M L L L L L L L L L L
    136 K K E E E E E E E E E K
    137 A Q Q L Q Q Q Q Q Q Q S
    138 A A A A A A A A A A A A
    139 V V V V V V V V V V V V
    140 D D N N N N N N N N N D
    141 K N S R S S S S S S S Y
    142 A A A A A A A A A A A A
    143 V Y T N T T T T T T T W
    144 A A S N S S S S S S S N
    145 S R R A R R R R R R R K
    146 G G G G G G G G G G G G
    147 V V V I V V V V V V V A
    148 V V L L L L L L L L L V
    149 V V V L V V V V V V V V
    150 V V V V V V V V V V V V
    151 A A A G A A A A A A A A
    152 A A A A A A A A A A A A
    153 A A S A S S S S S S S A
    154 G G G G G G G G G G G G
    155 N N N N N N N N N N N N
    156 E S S T S S S S S S S D
    157 G G G G G G G G G G G N
    158 S S A R A A A A A A A V
    159 T S Q
    160 G G G G G G D G G G G S
    161 S N S S S S S S S S R
    162 S T I I I I I I I I T
    163 S N S S S S S S S S F
    164 T T
    165 V I V
    166 G G N
    167 Y Y Y Y Y Y Y A Y Y Y Q
    168 P P P P P P P P P P P P
    169 G A A A A A A A A A A A
    170 K K R R R R R S R R R S
    171 Y Y Y Y Y Y Y Y Y Y Y Y
    172 P D A S A A A A A A A P
    173 S S N G N N N N N N N N
    174 V V A V A A A A A A A A
    175 I I M M M M M M M M M I
    176 A A A A A A A A A A A A
    177 V V V V V V V V V V V V
    178 G G G A G G G G G G G G
    179 A A A A A A A A A A A A
    180 V V T V T T T T T T T I
    181 D D D D D D D D D D D D
    182 S S Q Q Q Q Q Q Q Q Q S
    183 S N N N N N N N N N N N
    184 N S N G N N N N N N N D
    185 Q N N Q N N N N N N N R
    186 R R R R R R R R R R R
    187 A A A A A A A A A A A A
    188 S S S S S S S S S S S S
    189 F F F F F F F F F F F F
    190 S S S S S S S S S S S S
    191 S S Q T Q Q Q Q Q Q Q N
    192 V V Y Y Y Y Y Y Y Y Y Y
    193 G G G G G G G G G G G G
    194 P A A P A A A P A A A T
    195 E E G E G G G G G E G W
    196 L L L I L L L L L L L V
    197 D E D E D D D D D D D D
    198 V V I I I I I I I I I V
    199 M M M S V V V V V V V T
    200 A A A A A A A A A A A A
    201 P P P P P P P P P P P P
    202 G G G G G G G G G G G G
    203 V A V V V V V V V V V V
    204 S G N N N N N N N N N N
    205 I V I V V V V V V V V I
    206 Q Y Q N Q Q Q Q Q Q Q A
    207 S S S S S S S S S S S S
    208 T T T T T T T T T T T T
    209 L Y Y Y Y Y Y Y Y Y Y V
    210 P P P T P P P P P P P P
    211 G T G G G G G G G G G N
    212 N N S N S S S S S S S N
    213 K T T R T T T T T T T G
    214 Y Y Y Y Y Y Y Y Y Y Y Y
    215 G A A V A A A A A A A S
    216 A T S S S S S S S S S Y
    217 Y L D L L L L L L L L M
    218 N N N S N N N N N N N S
    219 G G G G G G G G G G G G
    220 T T T T T T T T T T T T
    221 S S S S S S S S S S S S
    222 M M M M M M M M M M M M
    223 A A A A A A A A A A A A
    224 S S T T T T T T T T T S
    225 P P P P P P P P P P P P
    226 H H H H H H H H H H H H
    227 V V V V V V V V V V V V
    228 A A A A A A A A A A A A
    229 G G G G G G G G G G G G
    230 A A A V A A A A A A A L
    231 A A A A A A A A A A A A
    232 A A A A A A V A A A A A
    233 L L L L L L L L L L L L
    234 I I V V V V V V V V V L
    235 L L K K K K K K K L K A
    236 S S Q S Q Q H Q Q Q Q S
    237 K K K R K K K K K K K Q
    238 H H N Y N N N N N N N G
    239 P P P P P P P P P P P K
    240 N N S S S S S S S S S N
    241 W L W Y W W W W W W W
    242 T S S T S S S S S S S
    243 N A N N N N N N N N N N
    244 T S V N V V V V V V V V
    245 Q Q Q Q Q Q R Q Q Q Q Q
    246 V V I I I I I I I I I I
    247 R R R R R R R R R R R R
    248 S N N Q N N D N N N N Q
    249 S R H R H H H H H H H A
    250 L L L I L L L L L L L I
    251 Q S K N K K K K K K K E
    252 N S N Q N N K N N N N Q
    253 T T T T T T T T T T T T
    254 T A A A A A A A A A A A
    255 T T T T T T T T T T T D
    256 K Y S Y S S S S S S S K
    257 L L L L L L L L L L L I
    258 G G G G G G G G G G G S
    259 D S S S S S S S S S S G
    260 S S T P T T T T T T T T
    261 F F N S N N N N N N N G
    262 Y Y L L L L L L L L L T
    263 Y Y Y Y Y Y Y Y Y Y Y N
    264 G G G G G G G G G G G F
    264a K
    265 K K S N S S S S S S S Y
    266 G G G G G G G G G G G G
    267 L L L L L L L L L L L K
    268 I I V V V V V V V V V I
    269 N N N H N N N N N N N N
    270 V V A A A A A A A A A S
    271 Q E E G E E E E E E E N
    272 A A A R A A A A A A A K
    273 A A A A A A A A A A A A
    274 A A T T A T T T T T T V
    275 Q Q R Q R R R R R R R R
    276 Y
  • EXAMPLES Example 1 Identification of Epitope Sequences and Epitope Patterns
  • High diversity libraries (1012) of phages expressing random hexa-, nona- or dodecapetides as part of their membrane proteins, were screened for their capacity to bind purified specific rabbit lgG, and purified rat and mouse IgGl and IgE antibodies. The phage libraries were obtained according to prior art (se WO 9215679 hereby incorporated by reference).
  • The antibodies were raised in the respective animals by subcutaneous, intradermal, or intratracheal injection of relevant proteins (e.g. proteases, lipolytic enzymes, amylases, oxidoreductases) dissolved in phosphate buffered saline (PBS). The respective antibodies were purified from the serum of immunised animals by affinity chromatography using paramagnetic immunobeads (Dynal AS) loaded with pig anti-rabbit lgG, mouse anti-rat IgG1 or IgE, or rat anti-mouse IgGl or IgE antibodies.
  • The respective phage libraries were incubated with the IgG, IgG1 and IgE antibody coated beads. Phages, which express oligopeptides with affinity for rabbit IgG, or rat or mouse IgG1 or IgE antibodies, were collected by exposing these paramagnetic beads to a magnetic field. The collected phages were eluted from the immobilised antibodies by mild acid treatment, or by elution with intact enzyme. The isolated phages were amplified as know to the specialist. Alternatively, immobilised phages were directly incubated with E. coli for infection. In short, F-factor positive E. coli (e.g. XL-1 Blue, JM101, TG1) were infected with M13-derived vector in the presence of a helper-phage (e.g. M13K07), and incubated, typically in 2×YT containing glucose or IPTG, and appropriate antibiotics for selection. Finally, cells were removed by centrifugation. This cycle of events was repeated 2-5 times on the respective cell supernatants. After selection round 2, 3, 4, and 5, a fraction of the infected E. coli was incubated on selective 2×YT agar plates, and the specificity of the emerging phages was assessed immunologically. Thus, phages were transferred to a nitrocellulase (NC) membrane. For each plate, 2 NC-replicas were made. One replica was incubated with the selection antibodies, the other replica was incubated with the selection antibodies and the immunogen used to obtain the antibodies as competitor. Those plaques that were absent in the presence of immunogen, were considered specific, and were amplified according to the procedure described above.
  • The specific phage-clones were isolated from the cell supernatant by centrifugation in the presence of polyethylenglycol. DNA was isolated, the DNA sequence coding for the oligopeptide was amplified by PCR, and the DNA sequence was determined, all according to standard procedures. The amino acid sequence of the corresponding oligopeptide was deduced from the DNA sequence.
  • Thus, a number of peptide sequences with specificity for the protein specific antibodies, described above, were obtained. These sequences were collected in a database, and analysed by sequence alignment to identify epitope patterns. For this sequence alignment, conservative substitutions (e.g. aspartate for glutamate, lysine for arginine, serine for threonine) were considered as one. This showed that most sequences were specific for the protein the antibodies were raised against. However, several cross-reacting sequences were obtained from phages that went through 2 selection rounds only. In the first round 22 epitope patterns were identified.
  • In further rounds of phage display, more antibody binding sequences were obtained leading to more epitope patterns. Further, the literature was searched for peptide sequences that have been found to bind environmental allergen-specific antibodies (J All Clin Immunol 93 (1994) pp. 34-43; Int Arch Appl Immunol 103 (1994) pp. 357-364; Clin Exp Allergy 24 (1994) pp. 250-256; Mol Immunol 29 (1992) pp. 1383-1389; J Immunol 121 (1989) pp. 275-280; J. Immunol 147 (1991) pp. 205-211; Mol Immunol 29 (1992) pp. 739-749; Mol Immunol 30 (1993) pp. 1511-1518; Mol Immunol 28 (1991) pp. 1225-1232; J. Immunol 151 (1993) pp. 7206-7213). These antibody binding peptide sequences were included in the database.
  • A first generation database of antibody binding peptides identified and their corresponding epitope patterns are shown in Table 2-7 below.
  • Tables 2-7: Overview of the antibody binding peptide sequences, epitope patterns and epitope sequences. The type of antibody used for identifying the antibody binding sequences is indicated as IgG or IgE and the species from which the antibodies were derived are indicated as mo (mouse), ra (rat) and hu (human).
    TABLE 2
    Savinase antibody binding peptide sequences, epitope
    patterns and epitope sequences.
    Antibody Method of
    binding identifi- Epitope
    peptide cation pattern Donor Acceptor Epitope Sequence (BPN′) Epitope # IgG IgE
    VQVYGDTSA Phage Q>Y>D> Savinase savinase Q206 V81 Y214 G80 D41 sav1.1 Ra
    (SEQ ID NO: 59) display T208
    LQCVGS Protein a-amylase savinase L21 Q236 V26 G25 S24 sav19.1 Hu
    (SEQ ID NO: 60) fragments inhibitor
    KRFANTELA Phage R/K RF>N Savinase savinase K251 R247 A174 N173 sav6.1 Ra- Mo
    (SEQ ID NO: 61) display Mo
    LDQIFFTRW Phage D/E QIFFT Savinase savinase L42/L75 D41 Q2 I79 sav5.1 Ra
    (SEQ ID NO: 62) display
    FNDAFFVKM Phage Savinase savinase N185 D181 A187 F189 sav11.0 Ra
    (SEQ ID NO: 63) display V203
    ANIPIWSRSA Phage >RSA Savinase savinase R145 S144 A142 sav3.2-lac1.0- Ra
    (SEQ ID NO: 64) display lip4.0-pd5.0
    ANIPIWSRSA Phage >RSA Savinase savinase S188 R186 S190 A179 sav3.1-lac1.0- Ra
    (SEQ ID NO: 64) display lip4.0-pd5.0
    RQSTDFGTT Phage RQ>>D/E Savinase savinase R186 Q191 S156 sav2.2 Ra
    (SEQ ID NO: 65) display Q191 Y192
    VQVYGDTSA Phage Q>Y>D> Savinase savinase G193/A194/G195 D197 sav1.2 Ra
    (SEQ ID NO: 66) display S265
    RRFSNATRA Phage R/K RF>N Savinase savinase K251 R247 A174 N173 sav6.1 Ra- Mo
    (SEQ ID NO: 67) display Mo
    CTARLRAGNACG Phage AR>A Savinase savinase A172/A169 R170 A194 sav10.4 Ra
    (SEQ ID NO: 68) display G193 N261
    LDQIFFTRW Phage D/E QIFFT Savinase savinase D60 Q59 I44/I35 sav5.2 Ra
    (SEQ ID NO: 69) display
    LDQIFFTRW Phage D/E QIFFT Savinase savinase L42/L75 D41 Q2179 sav5.1 Ra
    (SEQ ID NO: 69) display
    EQIFFTSGL Phage D/E QIFFT Savinase savinase E112 Q109 I79 sav5.4 Ra
    (SEQ ID NO: 70) display
    GRFSNSKFK Phage L>GRS Savinase savinase L196 G195 R170 S163 sav9.2-je4.0- Ra
    (SEQ ID NO: 71) display lip5.1-5.2
    AVLRDC Protein a-amylase savinase A254 V268 L267 R10 D181 sav18.1-pd18.1- Hu
    (SEQ ID NO: 72) fragments inhibitor 18.2
    LQCVGS Protein a-amylase savinase L217 Q206 V81 G80 S3 sav19.2 Hu
    (SEQ ID NO: 73) fragments inhibitor
    LRQCNERCV Phage RQ>>D/E Savinase savinase L267 R10 Q12 N269 E271 sav2.1 Ra
    (SEQ ID NO: 74) display R275
    SPVTKRASLKIDSKK Protein Der p II savinase A88 S87/T22 L233 K235 sav16.0-pd7.0 Hu
    (SEQ ID NO: 75) fragments I246
    RQSTDFGTT Phage RQ>>D/E Savinase savinase R247 Q245 S240/S242 sav2.3 Ra
    (SEQ ID NO: 76) display
    FCTNNCELS Phage N>>EL Savinase savinase T143 N173 N140 E136 L135 sav7.2 Ra
    (SEQ ID NO: 77) display
    FCTNNCELS Phage N>>EL Savinase savinase N117 N116 E112 L111 sav7.1 Ra
    (SEQ ID NO: 77) display
    DFHVKYAAQ Phage Savinase savinase sav8.0 Ra
    (SEQ ID NO: 78) display
    VAQYKALPVVLENA Protein Fel d I savinase L135 P168 V139 L111 E112 sav12.0-pd8.0 Hu
    (SEQ ID NO: 79) fragments N116
    AAYPDV Protein A>>>>YP> a-amylase savinase A215 Y214 P40 D41 V81 sav13.0-pd13.1- Hu
    (SEQ ID NO: 80) fragments inhibitor 13.2
    EQIFFTSGL Phage D/E QIFFT Savinase savinase E271 Q12 I8 sav5.3 Ra
    (SEQ ID NO: 81) display
    VDAAF Protein Poa p IX savinase V203 D181 A179 A187 F189 sav15.0-pd12.0 Hu
    (SEQ ID NO: 82) fragments
    AVLRDC Protein a-amylase savinase A232 V234 L250 R247 D197 sav18.2-pd18.1- Hu
    (SEQ ID NO: 83) fragments inhibitor 18.2
    RAFRRNANW Phage AR>A Savinase savinase A272/A273 R275 R19 N18 sav10.1 Ra
    (SEQ ID NO: 84) display A15/A16
    CTARLRAGNACG Phage AR>A Savinase savinase A15/A16 R19 L21 R275 sav10.2 Ra
    (SEQ ID NO: 85) display A272 A273 N269
    TFHDAPALQ Phage Savinase savinase H39 D41 A74/A73 P86 A88 sav4.0 Ra
    (SEQ ID NO: 86) display L90
    CTARVVALGVCG Phage AR>A Savinase savinase R145 V147 V149 A151 sav10.3 Ra
    (SEQ ID NO: 87) display L124/L126 G127
    GRFSNSKFK Phage L>GRS Savinase savinase L148 G146 R145 sav9.1-je4.0- Ra
    (SEQ ID NO: 88) display S144/S141 N140 lip5.1-5.2
    RRFANDHTR Phage R/K RF>N savinase savinase K27 R45 N43 D41 H39 sav6.2 Ra
    (SEQ ID NO: 89) display T38/T213
    KRFANTEPA Phage R/K RF>N savinase savinase K251 R247 A174 N173 sav6.1 Ra- Mo
    (SEQ ID NO: 90) display Mo
    YKVSAL Protein a-amylase savinase Y91 K27 V26 S24 G23 L21 sav14.0-pd14.0 Hu
    (SEQ ID NO: 91) fragments inhibitor
    TGKYVS Protein a-amylase savinase S24 G25 K27 Y91 V93 sav17.0-pd17.1- Hu
    (SEQ ID NO: 92) fragments inhibitor 17.2
  • TABLE 3
    PD498 antibody binding peptide sequences, epitope patterns and epitope sequences.
    Epitope pattern Donor Acceptor Epitope Sequence (BPN′) Epitope # IgG IgE
    Fel d I pd498 V198 A254 Q252 Y276 K239 A235 L233 P86 pd8.0 Hu
    A>>>>YP> a-amylase pd498 *3aA Y1/Y2 P-4/P-1 D-2 V81 pd13.2 Hu
    inhibitor
    Poa p IX pd498 S182 Y6 G7 P8 T13 P14 A15 A16 pd11.0 Hu
    >KL>> Poa p IX pd498 Y171 K136 L135 A108 Y113 pd4.4 Hu
    a-amylase pd498 Y48/Y37 K46 *44aaV A43 L42 pd14.0 Hu
    inhibitor
    Poa p IX pd498 V196/V198 D197 A174/A176 A169 F163 pd12.0 Hu
    KQS Poa p IX pd498 A142 A147 V148 K120 Q27 S24/S25 pd2.3 Hu
    KQS pd498 pd498 R44 K89 Q27 S236 K120 G146 pd2.2 Ra
    Der p II pd498 *28aV T88 *44a K R44 A43 L42 pd7.0 Hu
    >KL>> pd498 pd498 N56/N55 K46 L91 A29/A119 T28 pd4.3 Ra
    >KL>> pd498 pd498 N240/N243 K239 L233/L234 A16 T21 R22 pd4.1 Ra
    >KL>> Poa p IX pd498 Y37 K46 L91 A114 Y113 pd4.5 Hu
    >KL>> pd498 pd498 N240/N243 K239 L233/L234 A16 T21 R22 pd4.1 Ra
    YI>KL pd498 pd498 Y113 I111 A108/A138 K136 L135 pd3.1 Ra
    KQS pd498 pd498 A115 K145 N243 N240 K239 Q237 S236 pd2.1 Ra
    >RY>K/R pd498 pd498 R94 R53 Y48 Q117 R112 S109/S137 pd1.5-lac2.0 Ra
    PhI p V pd498 A169 Q167 F163 T162 S160 G193 pd10.0 Hu
    YI>KL pd498 pd498 Y276 I246 K239 L234 S236 pd3.2 Ra
    >KL>> pd498 pd498 N240/N243 K239 L233/L234 R22 P86 pd4.2 Ra
    A>>>>YP> a-amylase pd498 *3aA Y2 P14 D18 V19 pd13.1 Hu
    inhibitor
    KQS Poa p IX pd498 A15 A16 V274 K239 Q237 S236 pd2.4 Hu
    a-amylase pd498 G146 K145 Y141 V139 S137 pd17.2 Hu
    inhibitor
    a-amylase pd498 A273 V274 L233 R22 D87 pd18.1 Hu
    inhibitor N10 S12 A15/A16 R275 A273/A249 R247
    AR>A Par j 1 + Par o 1 pd498 A174 D197 S170 pd9.0 Hu + Ra Hu
    pd498 pd498 R22 G23 L233 S236 pd6.2 Ra
    >RY>K/R pd498 pd498 R94 R53 Y48 P57 K46 L91 pd1.4-lac2.0 Ra
    >RY>K/R pd498 pd498 R94 R53 Y48 P57 K46 L91 pd1.4-lac2.0 Ra
    a-amylase pd498 L96 R94 S33 V35 Y37 pd15.0 Hu
    inhibitor
    >RY>K/R pd498 pd498 S109/S137 R112 Y141 N144 K145 pd1.3-lac2.0 Ra
    >RY>K/R pd498 pd498 T162 R161 Y192 N191 K186 pd1.2-lac2.0 Ra
    >RY>K/R pd498 pd498 T133/T134 R112 Y141 N144 K145 pd1.1-lac2.0 Ra
    a-amylase pd498 A92 *44aaV L42 R44 D75 pd18.2 Hu
    inhibitor
    a-amylase pd498 S236 G238 K239 Y276 V274 S270 pd17.1 Hu
    inhibitor
    a-amylase pd498 S12 P14 W17 S-5 W-6 pd16.0 Hu
    inhibitor
    >RSA pd498 pd498 S137 R112 S109 A108 pd5.0-lac1.0-lip4.0-
    sav3.1-3.2 Ra
    pd498 pd498 S215 M217 I205 M222 G219 pd6.1 Ra
  • TABLE 4
    Antibody binding peptide sequences, epitope patterns and epitope
    sequences for the T. lanuginosus lipase (Lipolase).
    Antibody Method of
    binding identifi- Epitope
    peptide cation pattern Donor Acceptor Epitope Sequence Epitope # IgG IgE
    QRPPRYELE Phage RPPR lipolase lipolase lip1.0 Ra
    (SEQ ID NO: 93) display
    ELEYRPPRQ Phage >EY lipolase lipolase L124 E129 Y164 lip2.1 Ra
    (SEQ ID NO: 94) display
    HEYDMRVAW Phage >EY lipolase lipolase H215 E219 Y220 lip2.2 Ra
    (SEQ ID NO: 95) display
    HEYPMDFHL Phage >EY lipolase lipolase H215 E219 Y220 lip2.2 Ra
    (SEQ ID NO: 96) display
    SEYSMSITP Phage >EY lipolase lipolase S217 E219 Y220 lip2.3 Ra
    (SEQ ID NO: 97) display
    CVWPAHAPLSCG Phage >P>>PAP>S lipolase lipolase P253 P250 A243 lip3.0 Ra
    (SEQ ID NO: 98) display P208/P207
    S214/S216/S217
    CSWPSPAPLSCG Phage >P>>PAP>S lipolase lipolase P253 P250 A243 lip3.0 Ra
    (SEQ ID NO: 99) display P208/P207
    S214/S216/S217
    CDFPLHAPLSCG Phage >P>>PAP>S lipoase lipolase P253 P250 A243 lip3.0 Ra
    (SEQ ID NO: 100) display P208/P207
    S214/S216/S217
    CLFPSPAPRSCG Phage >P>>PAP>S lipolase lipolase P253 P250 A243 lip3.0 Ra
    (SEQ ID NO: 101) display P208/P207
    S214/S216/S217
    CDGPAPAPWSCG Phage >P>>PAP>S lipolase lipolase P253 P250 A243 lip3.0 Ra
    (SEQ ID NO: 102) display P208/P207
    S214/S216/S217
    CSFPLPAPRSCG Phage >P>>PAP>S lipolase lipolase P253 P250 A243 lip3.0 Ra
    (SEQ ID NO: 103) display P208/P207
    S214/S216/S217
    CVYPSPAPWSCG Phage >P>>PAP>S lipolase lipolase P253 P250 A243 lip3.0 Ra
    (SEQ ID NO: 104) display P208/P207
    S214/S216/S217
    PEYTMNALS Phage >EY lipolase lipolase P218 E219 Y220 lip2.4 Ra
    (SEQ ID NO: 105) display
    CSRSAKGARLCG Phage >RSA lipolase lipolase R209 S214 A182 lip4.0-lac1.0- Ra
    (SEQ ID NO: 106) display pd5.0-sav3.1-
    3.2
    LEYPMSASQ Phage >EY lipolase lipolase L124 E129 Y164 lip2.1 Ra
    (SEQ ID NO: 107) display
    RKLTLSGRS Phage L>GRS lipolase lipolase L67 G65 R81 S83/S85 lip5.1-je4.0- Ra
    (SEQ ID NO: 108) display sav9.0
    RKLTLSGRS Phage L>GRS lipolase lipolase L96/L97 G212 R209/R179 lip5.2-je4.0- Ra
    (SEQ ID NO: 109) display S214 sav9.0
    SYGAPATPAA Protein Poa p IX lipolase S170 Y171 G172 A173 lip6.0 Hu
    (SEQ ID NO: 110) fragments P174 A150 T153
    PAAGYTPAAP Protein Poa p IX lipolase A18/A19/A20 G65 Y53 T123 lip7.0 Hu Hu
    (SEQ ID NO: 111) fragments
    YKLAY Protein Poa p IX lipolase Y138 K74 L75 A68 Y16 lip8.1 Hu
    (SEQ ID NO: 112) fragments
    YKLAY Protein Poa p IX lipolase Y53 K127 L67 A68 Y16 lip8.2 Hu
    (SEQ ID NO: 112) fragments
    KYDDYVATLS Protein Poa p IX lipolase Y194 D167 D165 Y164 lip9.0 Hu
    (SEQ ID NO: 113) fragments V132 A131 L52 S54
    EVKATPAGEL Protein Poa p IX lipolase E43 V44 K46 A47 T72 lip10.0 Hu
    (SEQ ID NO: 114) fragments
    CGYSNAQGVDYWI Protein Der p I lipolase Y53 S54 N25/N26 lip15.0 Hu Hu
    (SEQ ID NO: 115) fragments A18/A19/A20 Q15 V44
    VPGIDPNACHYMKC Protein Der p II lipolase P256 I255 D254 P253 N200 lip16.0 Hu
    (SEQ ID NO: 116) fragments H198 Y261
    SPVTKRASLKIDSKK Protein Der p II lipolase R179 A182 S216/S217 I238 lip17.0 Hu
    (SEQ ID NO: 117) fragments K237 I235 D234 S224 K223
    IMSALAMVYLGAK Protein Ovalbumin lipolase V140 Y138 L69 A49 A47 lip18.0 Hu
    (SEQ ID NO: 118) fragments K46
    ELGVRE Protein a-amylase lipolase E99 L97 G109/G177 V176 lip11.0 Hu
    (SEQ ID NO: 119) fragments inhibitor R175 D242
    GCRKEV Protein a-amylase lipolase G106 C107 R108 K98 E99 lip12.0 Hu
    (SEQ ID NO: 120) fragments inhibitor
    LRSVYQ Protein a-amylase lipolase L147 R81 S79 V77 Y16 Q15 lip13.0 Hu
    (SEQ ID NO: 121) fragments inhibitor
    SGPWSW Protein a-amylase lipolase S170 G172 P174 W89 S83 lip14.0 Hu
    (SEQ ID NO: 122) fragments inhibitor
  • TABLE 5
    Amylase (Natalase) antibody binding peptide sequences,
    epitope patterns and epitope sequences.
    Antibody Method of
    binding identifi- Epitope
    peptide cation pattern Donor Acceptor Epitope Sequence Epitope # IgG IgE
    ARIDPRGPS Phage A>IDP R/K amylase amylase A380 K381 I382 D383 P384 je1.1 Ra
    (SEQ ID NO: 123) display R389
    ARIDPRHGS Phage A>IDP R/K amylase amylase A380 K381 I382 D383 P384 je1.1 Ra
    (SEQ ID NO: 124) display R389
    CSVAKIDPRTCG Phage A>IDP R/K amylase amylase A109 K138 D140 P142 je1.2 Ra
    (SEQ ID NO: 125) display R144
    CSVAKIDPRTCG Phage A>IDP R/K amylase amylase A380 K381 I382 D383 P384 je1.1 Ra
    (SEQ ID NO: 125) display R389
    AKIDPKPDT Phage A>IDP R/K amylase amylase A109 K138 D140 P142 je1.2 Ra
    (SEQ ID NO: 126) display R144
    AKIDPKPDT Phage A>IDP R/K amylase amylase A380 K381 I382 D383 P384 je1.1 Ra
    (SEQ ID NO: 126) display R389
    ARIDPRHGS Phage A>IDP R/K amylase amylase A109 K138 D140 P142 je1.2 Ra
    (SEQ ID NO: 127) display R144
    QIYNDTGPT Phage Q>Y>D> amylase amylase Q390 L386 Y368/Y367 D366 je2.4 Ra
    (SEQ ID NO: 128) display
    QIYNDTGPT Phage Q>Y>D> amylase amylase Q170 I173 Y196 D195 je2.3 Ra
    (SEQ ID NO: 128) display
    QIYNDTGPT Phage Q>Y>D> amylase amylase Q357 I352 Y349 D366 je2.2 Ra
    (SEQ ID NO: 128) display
    QIYNDTGPT Phage Q>Y>D> amylase amylase Q331 I370 Y368/Y367 D366 je2.1 Ra
    (SEQ ID NO: 128) display
    CGSATIDPRQCG Phage A>IDP R/K amylase amylase A109 K138 D140 P142 je1.2 Ra
    (SEQ ID NO: 129) display R144
    CNADNQMYPQCG Phage A>>>>YP> amylase amylase N29 A27 D26/D25 Y8 je3.1 Ra
    (SEQ ID NO: 130) display P41/P42
    ARIDPRGPS Phage A>IDP R/K amylase amylase A109 K138 D140 P142 je1.2 Ra
    (SEQ ID NO: 131) display R144
    CGSATIDPRQCG Phage A>IDP R/K amylase amylase A380 K381 I382 D383 P384 je1.1 Ra
    (SEQ ID NO: 132) display R389
    CDADSSGYPLCG Phage A>>>>YP> amylase amylase A107/A109 D108 Y57 je3.3 Ra
    (SEQ ID NO: 133) display P41/42
    QLYGDEQLP Phage Q>Y>D> amylase amylase Q331 I370 Y368/Y367 D366 je2.1 Ra
    (SEQ ID NO: 134) display
    QLYGDEQLP Phage Q>Y>D> amylase amylase Q357 I352 Y349 D366 je2.2 Ra
    (SEQ ID NO: 134) display
    QLYGDEQLP Phage Q>Y>D> amylase amylase Q170 I173 Y196 D195 je2.3 Ra
    (SEQ ID NO: 134) display
    QLYGDEQLP Phage Q>Y>D> amylase amylase Q390 L386 Y368/Y367 D366 je2.4 Ra
    (SEQ ID NO: 134) display
    RYAQIDPRW Phage A>IDP R/K amylase amylase A380 K381 I382 D383 P384 je1.1 Ra
    (SEQ ID NO: 135) display R389
    RYAQIDPRW Phage A>IDP R/K amylase amylase A109 K138 D140 P142 je1.2 Ra
    (SEQ ID NO: 135) display R144
    GEFNLGRSS Phage L>GRS amylase amylase L88 G92 R31 S28 je4.1-sav9.0- Ra
    (SEQ ID NO: 136) display lip5.1-5.2
    CNADSWGYPRCG Phage A>>>>YP> amylase amylase N29 A27 D26/D25 Y8 je3.1 Ra
    (SEQ ID NO: 137) display P41/P42
    CNADNQMYPQCG Phage A>>>>YP> amylase amylase N102 A233 D232 Y54 je3.2 Ra
    (SEQ ID NO: 138) display P41/P42
    CNADSWGYPRCG Phage A>>>>YP> amylase amylase N102 A233 D232 Y54 je3.2 Ra
    (SEQ ID NO: 137) display P41/P42
    GEFNLGRSS Phage L>GRS amylase amylase L62 G63/G76 R78 S79 je4.2-sav9.0- Ra
    (SEQ ID NO: 139) display lip5.1-5.2
  • TABLE 6
    Cellulase (Carezyme; Cel45 from Humicola insolens) antibody binding
    peptide sequences, epitope patterns and epitope sequences.
    Antibody Method of
    binding identifi- Epitope
    peptide cation pattern Donor Acceptor Epitope Sequence Epitope # IgG IgE
    CVHAGPRAGTCG Phage >G>>AG carezyme carezyme P23 R201 A83 G84 car1.1 Ra
    (SEQ ID NO: 140) display
    CVHAGPRAGTCG Phage VH>G> carezyme carezyme car2.0 Ra
    (SEQ ID NO: 140) display
    CLSGPLAGRVCG Phage >G>>AG carezyme carezyme P23 R201 A83 G84 car1.1 Ra
    (SEQ ID NO: 141) display
    CRISPWYSVPCG Phage carezyme carezyme car3.0 Ra
    (SEQ ID NO: 142) display
    CLSGPAAGQSCG Phage >G>>AG carezyme carezyme P23 R201 A83 G84 car1.1 Ra
    (SEQ ID NO: 143) display
    Phage A>IDP R/K je-1 carezyme R146 I131 D133 P137 car11.2 Ra
    display
    CITRGTRAGWCG Phage >G>>AG carezyme carezyme P23 R201 A83 G84 car1.1 Ra
    (SEQ ID NO: 144) display
    Phage AR>A savinase carezyme A191 R200 R201 A83 N81 car6.2 Ra
    display
    CLSGPAAGQSCG Phage >G>>AG carezyme carezyme T95/S96 G27 P98 A100 G101 car1.2 Ra
    (SEQ ID NO: 143) display
    Phage A>IDP R/K je-1 carezyme A195 R37 I38 D40 L44 car11.1 Ra
    display
    Phage Q>Y>D> savinase, carezyme Q59 Y54 G134 D133 T136 car10.0 Ra
    display >P>>AP>S je-1 W62/W169 P61 P165 A162
    Phage lipoprime carezyme P160 car9.0 Ra
    display
    CITRGTRAGWCG Phage >G>>AG carezyme carezyme T95/S96 G27 P98 A100 G101 car1.2 Ra
    (SEQ ID NO: 144) display
    Phage R/K RF>N savinase carezyme R7 R170 F174 A177 car7.0 Ra
    display
    CLSGPLAGRVCG Phage >G>>AG carezyme carezyme T95/S96 G27 P98 A100 G101 car1.2 Ra
    (SEQ ID NO: 145) display
    Phage AR>A savinase carezyme A1 R4 R7 A177 N176 car6.1 Ra
    display
    Phage >P>RDTG laccase carezyme D178 P180 R4 D2 S183 car5.0 Ra
    display R170 R153 Y168 P165 K164
    Phage >RY>K/R pd498 carezyme L163 car4.0 Ra
    display
    Phage D/E QIFFT savinase carezyme Q36 I38 F41 F29 T197 car8.0 Ra
    display
    CLTAGPSAGYCG Phage >G>>AG carezyme carezyme T95/S96 G27 P98 A100 G101 car1.2 Ra
    (SEQ ID NO: 146) display
    CYTTGRLAGLCG Phage >G>>AG carezyme carezyme P23 R201 A83 G84 car1.1 Ra
    (SEQ ID NO: 147) display
    CYTTGRLAGLCG Phage >G>>AG carezyme carezyme T95/S96 G27 P98 A100 G101 car1.2 Ra
    (SEQ ID NO: 147) display
    CVHSGPRAGYCG Phage >G>>AG carezyme carezyme P23 R201 A83 G84 car1.1 Ra
    (SEQ ID NO: 148) display
    CVHSGPRAGYCG Phage VH>G> carezyme carezyme car2.0 Ra
    (SEQ ID NO: 148) display
    CVHAGPRAGTCG Phage >G>>AG carezyme carezyme T95/S96 G27 P98 A100 G101 car1.2 Ra
    (SEQ ID NO: 149) display
    CVHSGPRAGYCG Phage >G>>AG carezyme carezyme T95/S96 G27 P98 A100 G101 car1.2 Ra
    (SEQ ID NO: 148) display
    CVHSGLSRRLLR Phage VH>G> carezyme carezyme car2.0 Ra
    (SEQ ID NO: 150) display
    CVTRGPNAGSCG Phage >G>>AG carezyme carezyme T95/S96 G27 P98 A100 G101 car1.2 Ra
    (SEQ ID NO: 151) display
    CLTAGPSAGYCG Phage >G>>AG carezyme carezyme P23 R201 A83 G84 car1.1 Ra
    (SEQ ID NO: 152) display
    CVTRGPNAGSCG Phage >G>>AG carezyme carezyme P23 R201 A83 G84 car1.1 Ra
    (SEQ ID NO: 151) display
    CITSGPRAGNCG Phage >G>>AG carezyme carezyme T95/S96 G27 P98 A100 G101 car1.2 Ra
    (SEQ ID NO: 153) display
    CITSGPRAGNCG Phage >G>>AG carezyme carezyme P23 R201 A83 G84 car1.1 Ra
    (SEQ ID NO: 153) display
  • TABLE 7
    Laccase (Myceliophthora thermopila laccase) antibody binding
    peptide sequences, epitope patterns and epitope sequences.
    Antibody Method of
    binding identifi- Epitope
    peptide cation pattern Donor Acceptor Epitope Sequence Epitope # IgG IgE
    PQSD5PGESQ Phage P>S/T DPG laccase laccase P180 R175 T168 D166 P165 G265 lac3.2 Ra
    (SEQ ID NO: 154) display
    WPKSDAGDS Phage P>>DAG laccase laccase P241 R409 S410/S416 D434 A389 lac4.1 Ra
    (SEQ ID NO: 155) display G390
    PQSDAGVVM Phage P>>DAG laccase laccase P241 R409 S410/S416 D434 A389 lac4.1 Ra
    (SEQ ID NO: 156) display G390
    DPVRDTGAG Phage >P>RDTG laccase laccase P241 R409 D434 T432 G430/G390 lac5.1 Ra
    (SEQ ID NO: 157) display
    GPSRDAGLL Phage P>>DAG laccase laccase P241 R409 S410/S416 D434 A389 lac4.1 Ra
    (SEQ ID NO: 158) display G390
    PASDAGRGP Phage P>>DAG laccase laccase P241 R409 S410/S416 D434 A389 lac4.1 Ra
    (SEQ ID NO: 159) display G390
    PRDSTGLAL Phage P>S/T DPG laccase laccase P378 R379 T442 D443 P445 G446 lac3.1 Ra
    (SEQ ID NO: 160) display
    PQSDPGESQ Phage P>S/T DPG laccase laccase P378 R379 T442 D443 P445 G446 lac3.1 Ra
    (SEQ ID NO: 161) display
    RYPFLRATN Phage >RY>K/R laccase laccase lac2.0- Ra
    (SEQ ID NO: 162) display pd1.1-1.4
    lac1.0-
    lip4.0-
    pd5.0-
    GAARDARSA Phage >RSA laccase laccase sav3.1- Ra
    (SEQ ID NO: 163) display 3.2
    PRSDTGFGS Phage >P>RDTG laccase laccase P241 R409 D434 T432 G430/G390 lac5.1 Ra
    (SEQ ID NO: 164) display
    LPRSDPGGR Phage P>S/T DPG laccase laccase P180 R175 T168 D166 P165 G265 lac3.2 Ra
    (SEQ ID NO: 165) display
    DPARDTGDV Phage >P>RDTG laccase laccase P241 R409 D434 T432 G430/G390 lac5.1 Ra
    (SEQ ID NO: 166) display
    APKSDNGIT Phage P>>DAG laccase laccase P241 R409 S410/S416 D434 A389 lac4.1 Ra
    (SEQ ID NO: 167) display G390
    PKSDPGTNW Phage P>S/T DPG laccase laccase P378 R379 T442 D443 P445 G446 lac3.1 Ra
    (SEQ ID NO: 168) display
    PRTDPGWLA Phage P>S/T DPG laccase laccase P378 R379 T442 D443 P445 G446 lac3.1 Ra
    (SEQ ID NO: 169) display
    LPRSDPGGR Phage P>S/T DPG laccase laccase P378 R379 T442 D443 P445 G446 lac3.1 Ra
    (SEQ ID NO: 170) display
    PSSDPGARS Phage P>S/T DPG laccase laccase P180 R175 T168 D166 P165 G265 lac3.2 Ra
    (SEQ ID NO: 171) display
    HVFDKNVTR Phage laccase laccase lac6.0
    (SEQ ID NO: 172) display
    PRSDPGTPT Phage P>S/T DPG laccase laccase P378 R379 T442 D443 P445 G446 lac3.1 Ra
    (SEQ ID NO: 173) display
    PRSDPGTPT Phage P>S/T DPG laccase laccase P180 R175 T168 D166 P165 G265 lac3.2 Ra
    (SEQ ID NO: 173) display
    PRDSTGLAL Phage P>S/T DPG laccase laccase P180 R175 T168 D166 P165 G265 lac3.2 Ra
    (SEQ ID NO: 174) display
    PRTDPGWLA Phage P>S/T DPG laccase laccase P180 R175 T168 D166 P165 G265 lac3.2 Ra
    (SEQ ID NO: 175) display
    PSSDPGARS Phage P>S/T DPG laccase laccase P378 R379 T442 D443 P445 G446 lac3.1 Ra
    (SEQ ID NO: 176) display
    PKSDPGTNW Phage P>S/T DPG laccase laccase P180 R175 T168 D166 P165 G265 lac3.2 Ra
    (SEQ ID NO: 177) display
    WPKSDAGDS Phage P>>DAG laccase laccase P350 S349 D80 A79 G78 lac4.2 Ra
    (SEQ ID NO: 178) display
    PQSDAGVVM Phage P>>DAG laccase laccase P350 S349 D80 A79 G78 lac4.2 Ra
    (SEQ ID NO: 179) display
    GPSRDAGLL Phage P>>DAG laccase laccase P350 S349 D80 A79 G78 lac4.2 Ra
    (SEQ ID NO: 180) display
    PASDAGRGP Phage P>>DAG laccase laccase P350 S349 D80 A79 G78 lac4.2 Ra
    (SEQ ID NO: 181) display
    APKSDNGIT Phage P>>DAG laccase laccase P350 S349 D80 A79 G78 lac4.2 Ra
    (SEQ ID NO: 182) display
    WPKSDAGDS Phage P>>DAG laccase laccase P300 R234 S211 D213 A296 lac4.3 Ra
    (SEQ ID NO: 183) display
    PQSDAGVVM Phage P>>DAG laccase laccase P300 R234 S211 D213 A296 lac4.3 Ra
    (SEQ ID NO: 184) display
    GPSRDAGLL Phage P>>DAG laccase laccase P300 R234 S211 D213 A296 lac4.3 Ra
    (SEQ ID NO: 185) display
    PASDAGRGP Phage P>>DAG laccase laccase P300 R234 S211 D213 A296 lac4.3 Ra
    (SEQ ID NO: 186) display
    APKSDNGIT Phage P>>DAG laccase laccase P300 R234 S211 D213 A296 lac4.3 Ra
    (SEQ ID NO: 187) display
    DPVRDTGAG Phage >P>RDTG laccase laccase P378 R379 D469 T473 G446 lac5.2 Ra
    (SEQ ID NO: 188) display
    PRSDTGFGS Phage >P>RDTG laccase laccase P378 R379 D469 T473 G446 lac5.2 Ra
    (SEQ ID NO: 189) display
    DPARDTGDV Phage >P>RDTG laccase laccase P378 R379 D469 T473 G446 lac5.2 Ra
    (SEQ ID NO: 190) display
    DPVRDTGAG Phage >P>RDTG laccase laccase P60 R59 D51/D53 T10/T12 G30 lac5.3 Ra
    (SEQ ID NO: 191) display
    PRSDTGFGS Phage >P>RDTG laccase laccase P60 R59 D51/D53 T10/T12 G30 lac5.3 Ra
    (SEQ ID NO: 192) display
    DPARDTGDV Phage >P>RDTG laccase laccase P60 R59 D51/D53 T10/T12 G30 lac5.3 Ra
    (SEQ ID NO: 193) display
    DPVRDTGAG Phage >P>RDTG laccase laccase P157/P155 R23 D118 T114 G113 lac5.4 Ra
    (SEQ ID NO: 194) display
    PRSDTGFGS Phage >P>RDTG laccase laccase P157/P155 R23 D118 T114 G113 lac5.4 Ra
    (SEQ ID NO: 195) display
    DPARDTGDV Phage >P>RDTG laccase laccase P157/P155 R23 D118 T114 G113 lac5.4 Ra
    (SEQ ID NO: 196) display
  • Example 2 Localisation of Epitope Sequences and Epitope Areas on the 3D-Structure of Acceptor Proteins
  • Epitope sequences were assessed manually on the screen on the 3D-structure of the protein of interest, using apropriate software (e.g. SwissProt Pdb Viewer, WebLite Viewer).
  • In a first step, the identified epitope patterns were fitted with the 3D-structure of the enzymes. A sequence of at least 3 amino acids, defining a specific epitope pattern, was localised on the 3D-structure of the acceptor protein. Conservative mutations (e.g. aspartate for glutamate, lysine for arginine, serine for threonine) were considered as one for those patterns for which phage display had evidenced such exchanges to occur. Among the possible sequences provided by the protein structure, only those were retained where the sequence matched a primary sequence, or where it matched a structural sequence of amino acids, where each amino acid was situated within a distance of 5 Å from the next one. Occasionally, the mobility of the amino acid side chains, as provided by the software programme, had to be taken in to consideration for this criterium to be fulfilled.
  • Secondly, the remaining anchor amino acids as well as the variable amino acids, i.e. amino acids that were not defining a pattern but were present in the individual sequences identified by phage library screening, were assessed in the area around the various amino acid sequences localised in step 1. Only amino acids situated within a distance of 5 Å from the next one were included.
  • Finally, an accessibility criterium was introduced. The criterium was that at least half of the anchor amino acids had a surface that was >30% accessible. Typically, 0-2 epitopes were retained for each epitope pattern. In some cases, two different amino acids could with equal probability be part of the epitope (e.g. two leucines located close to each other in the protein 3D-structure). For example, in Savinase two epitopes actually fit to the antibody binding peptide LDQIFFTRW (SEQ ID NO:62): L75 D41 Q2 179 and L42 D41 Q2 179. A shorthand notation for such a situation is: L42/L75 D41 Q2 179.
  • Thus, a number of epitope sequences were identified and localised on the surface of various proteins. As suggested by sequence alignment of the antibody binding peptides, structural analysis confirmed most of the epitopes to be enzyme specific, with only few exceptions. Overall, most of the identified epitopes were at least partially structural. However, some proteins (e.g. amylase) expressed predominantly primary sequence epitopes. Typically, the epitopes were localised in very discrete areas of the enzymes, and different epitope sequences often shared some amino acids (hot-spots).
  • The identified epitope sequences are shown in Tables 2-7.
  • Birch Allergen
  • Bet v1 (WO 99/47680) was used as the parent protein for identification of epitope sequences that may cross react with enzyme epitopes. The structural coordinates from 1BV1.pdb (Gajhede et al., NAT.STRUCT.BIOL., Vol. 3, p. 1040, 1996) were used as well the corresponding sequence (Swissprot accession number P15494). The epitope pattern P>PAP>S (which had been identified from antibody binding peptides specific for anti-Lipolase antibodies) was found to match three (overlapping) epitope sequences on the surface of Bet v1: Bet v1 1.1: P31 A34 P35 A37 P59 S39/S40; Bet v1 1.2: P63 L62 P59 A37 P35 S39/S40; and Bet v1 1.3: P59 S39/S40 P31 A34 P35 S39/S40.
  • Example 3 Epitope Areas
  • It is common knowledge that amino acids that surround binding sequences can affect is binding of a ligand without participating actively in the binding process. Based on this knowledge, areas covered by amino acids with potential steric effects on the epitope-antibody interaction, were defined around the identified epitopes. Practically, all amino acids situated within 5 Å from the amino acids defining the epitope were included. The accessibility criterium was not included for defining epitope areas, as hidden amino acids can have an effect on the surrounding structures.
  • For Savinase, the following amino acid residues belong to the epitope area that correspond to each epitope sequence indicated in Table 2:
    sav1.1 A1 Q2 S3 P5 H39 P40 D41 L42 N43 G63 T66 H67
    A69 G70 T71 A73 A74 L75 N77 S78 I79 G80 V81 L82
    G83 N204 V205 Q206 S207 T208 Y209 P210 S212 T213 Y214 A215
    S216 L217
    sav1.2 S153 G154 N155 S156 G157 A158 G160 S161 I162 S163 A169 R170
    A174 M175 A176 V177 G178 R186 F189 S190 Q191 Y192 G193 A194
    G195 L196 D197 I198 V199 T220 R247 K251 A254 T255 S256 T260
    N261 L262 Y263 G264 S265 G266 L267
    sav2.1 W6 G7 I8 R10 V11 Q12 A13 P14 A15 A16 R19 L21
    V84 T180 D181 Q182 N183 N184 I198 V199 A200 P201 H226 V227
    A230 L233 V234 K237 N238 H249 L250 T253 A254 T255 S256 L257
    S265 G266 L267 V268 N269 A270 E271 A272 A273 T274 R275
    sav2.2 S153 G154 N155 S156 G157 A158 S161 I162 S163 G178 A179 T180
    D181 N184 N185 R186 A187 S188 F189 S190 Q191 Y192 G193 L196
    T220 L262 Y263
    sav2.3 A142 T143 G146 V147 L148 Y171 A172 N173 A174 M175 D197 A231
    V234 K235 N238 P239 S240 W241 S242 N243 V244 Q245 I246 R247
    N248 H249 L250 K251
    sav3.1 S153 G154 N155 S156 G157 A158 V177 G178 A179 T180 D181 N184
    N185 R186 A187 S188 F189 S190 Q191 Y192 V199 A200 P201 G202
    V203 N218 G219 T220 A223 L262 Y263
    sav3.2 L111 E112 G115 N116 M119 A138 V139 N140 S141 A142 S144 R145
    G146 V147 V149 N173 N243
    sav4.0 Q2 H17 T22 G23 S24 G25 V26 K27 V28 V30 I35 S37
    T38 H39 P40 D41 L42 N43 I44 R45 G46 T66 A69 G70
    T71 172 A73 A74 L75 N76 N77 I79 G80 V81 L82 G83
    V84 A85 P86 S87 A88 E89 L90 Y91 A92 T208 Y209 P210
    S212 T213 Y214
    sav5.1 A1 Q2 S3 V4 I35 S37 H39 P40 D41 L42 N43 I44
    T66 A69 G70 A73 A74 L75 N76 N77 S78 179 G80 V81
    L82 G83 P86 L90 T208 Y214
    sav5.2 V30 T33 G34 I35 S37 T38 L42 N43 I44 R45 G46 E54
    S57 T58 Q59 D60 G61 N62 G63 H64 G65 T66 H67 A69
    L90 Y91 A92 K94 P210
    sav5.3 V4 P5 W6 G7 I8 S9 R10 V11 Q12 A13 P14 A15
    A16 R19 N269 A270 E271 A272 A273 T274 R275
    sav5.4 A1 Q2 P40 D41 F50 L75 N77 S78 I79 G80 V81 V104
    S105 S106 I107 A108 Q109 G110 L111 E112 W113 A114 G115 N116
    Q137 A138 S141 A142 Y214
    sav6.1 V139 N140 T143 L148 V149 A151 P168 A169 Y171 A172 N173 A174
    M175 A176 D197 1198 N243 V244 Q245 1246 R247 N248 H249 L250
    K251 N252 T253 A254 S265
    sav6.2 Q2 G25 V26 K27 V28 A29 I35 S37 T38 H39 P40 D41
    L42 N43 I44 R45 G46 G47 Q59 T66 A69 G70 A73 A74
    L75 N77 I79 G80 V81 L82 A88 E89 L90 Y91 N117 G118
    M119 H120 V121 S207 T208 Y209 P210 G211 S212 T213 Y214 A215
    sav7.1 K27 L31 I107 A108 Q109 G110 L111 E112 W113 A114 G115 N116
    N117 G118 M119 A122 L124 L135 Q137 A138 V139 S141
    A142 R145 V149
    sav7.2 V104 I107 A108 L111 S132 A133 T134 L135 E136 Q137 A138 V139
    N140 S141 A142 T143 S144 R145 G146 V147 V149 Y167 P168 Y171
    A172 N173 A174 M175 N243 R247
    sav9.1 L111 E112 A114 G115 N116 M119 H120 V121 A122 E136 Q137 A138
    V139 N140 S141 A142 T143 S144 R145 G146 V147 L148 V149 V150
    N173 M175 N243 I246 R247 L250
    sav9.2 L126 G127 S128 P129 A152 S153 G154 S161 I162 S163 Y167 P168
    A169 R170 Y171 A172 A176 V177 G178 Q191 Y192 G193 A194 G195
    L196 D197 I198 V199 T260 N261 L262 Y263 G264
    sav10.1 Q12 A13 P14 A15 A16 H17 N18 R19 G20 L21 T22
    N76 L82 G83 V84 A85 P86 L233 V234 K237 N238 H249 L250
    T253 N269 A270 E271 A272 A273 T274 R275
    sav10.2 V11 Q12 A13 P14 A15 A16 H17 N18 R19 G20 L21
    T22 G23 L233 V234 Q236 K237 N238 H249 L250 T253 A254 T255
    L267 V268 N269 A270 E271 A272 A273 T274 R275
    sav10.3 L31 D32 H64 V68 V95 L96 I107 L111 A114 G115 N116
    M119 V121 A122 N123 L124 S125 L126 G127 S128 P129 V139 S141
    A142 T143 S144 R145 G146 V147 L148 V149 V150 A151 A152 S153
    S163 Y167 P168 A169 N173 A174 M175 A176 V177 T220 S221 M222
    T224 P225 V227 A228 A231 N243 I246 R247 L250
    sav10.4 P131 S132 A133 L135 E136 V139 A151 A152 S153 G160 S161
    I162 S163 Y167 P168 A169 R170 Y171 A172 N173 A174 A176 Q191
    Y192 G193 A194 G195 L196 R247 S259 T260 N261 L262 Y263 G264
    sav11.0 W6 G154 N155 S156 G157 A179 T180 D181 Q182 N183 N184
    N185 R186 A187 S188 F189 S190 Q191 Y192 P201 G202 V203 N204
    V205 L217 N218 G219 T220 L262 Y263
    sav12.0 L31 I107 A108 Q109 G110 L111 E112 W113 A114 G115 N116
    N117 G118 A122 L124 S132 A133 T134 L135 Q137 A138 V139 N140
    S141 T143 R145 V149 A151 S163 Y167 P168 A169 R170 Y171 N173
    A174
    sav13.0 Q2 S3 P5 T38 H39 P40 D41 L42 N43 H67 G70
    A73 A74 L75 N77 I79 G80 V81 L82 G83 V205 Q206 S207
    T208 Y209 S212 T213 Y214 A215 S216 L217
    sav14.0 A16 H17 R19 G20 L21 T22 G23 S24 G25 V26 K27
    V28 A29 V30 I35 I44 R45 G46 G47 V84 A85 P86 S87
    A88 E89 L90 Y91 A92 V93 W113 N117 G118 M119 H120 V121
    A232 L233 K235 Q236 K237 T274
    sav15.0 W6 R10 G154 N155 S156 G157 V177 G178 A179 T180 D181
    Q182 N183 N184 N185 R186 A187 S188 F189 S190 Q191 V199 A200
    P201 G202 V203 N218 G219 T220 A223 L257 Y263 L267
    sav16.0 A13 A16 H17 G20 L21 T22 G23 S24 G25 V26 V28
    I72 A73 V84 A85 P86 S87 A88 E89 L90 H120 G229 A230
    A231 A232 L233 V234 K235 Q236 K237 N238 P239 S240 W241 I246
    H249 L250 A270 A273 T274
    sav17.0 T22 G23 S24 G25 V26 K27 V28 A29 V30 L31 D32
    I35 I44 R45 G46 G47 A48 F50 S87 A88 E89 L90 Y91
    A92 V93 K94 V95 G110 W113 N117 G118 M119 H120 V121 A232
    K235 Q236
    sav18.1 W6 G7 I8 S9 R10 V11 Q12 A179 T180 D181 Q182
    N183 N184 N185 R186 A187 I198 V199 A200 P201 V203 H226 V227
    A230 H249 L250 K251 N252 T253 A254 T255 S256 L257 S265 G266
    L267 V268 N269 A270
    sav18.2 A13 A16 H17 L21 T22 G23 V26 V28 V84 A85 A88
    V121 L148 Y171 A172 N173 V174 M175 A176 G195 L196 D197 I198
    V199 V227 A228 G229 A230 A231 A232 L233 V234 K235 Q236 K237
    N238 W241 N243 V244 Q245 I246 R247 N248 H249 L250 K251 N252
    T253 A254 Y263 G264 S265 G266 V268 A270 A273 T274
    sav19.1 A16 H17 R19 G20 L21 T22 G23 S24 G25 V26 K27
    V28 S87 A88 E89 H120 V121 A232 L233 V234 K235 Q236 K237
    N238 P239 T274
    sav19.2 A1 Q2 S3 V4 P5 D41 H64 H67 G70 T71 A74
    L75 N77 S78 I79 G80 V81 L82 G83 G202 V203 N204 V205
    Q206 S207 T208 Y209 Y214 A215 S216 L217 N218 G219 M222
  • For PD498, the following amino acid residues belong to the epitope area that correspond to each epitope sequence indicated in Table 3:
    pd1.1 D105 A108 S109 G110 I111 R112 Y113 A114 A115 D116 Q117 N131
    S132 T133 T134 L135 K136 S137 A138 V139 D140 Y141 A142 W143
    N144 K145 G146 A147
    pd1.2 C128 E129 A153 G154 N155 D156 N157 V158 S160 R161 T162 F163
    Q167 S170 G178 A179 I180 D181 D184 R185 K186 A187 S188 F189
    S190 N191 Y192 G193 T194 W195 V196 T220 T262 N263
    pd1.3 F50 L104 D105 S106 I107 A108 S109 G110 I111 R112 Y113 A114
    A115 D116 Q117 T133 T134 L135 K136 S137 A138 V139 D140 Y141
    A142 W143 N144 K145 G146 A147
    pd1.4 T28 *28aV A29 V30 D32 S33 G34 V35 Y37 *44aaV I45
    K46 G47 Y48 D49 F50 I51 R53 D54 N55 N56 P57 M58
    D60 L61 K89 I90 L91 A92 V93 R94 V95 L96 D97 A98
    Y113 A114 Q117 A119
    pd1.5 D32 S33 G34 K46 G47 Y48 D49 F50 I51 D52 R53 D54
    N55 P57 M58 L61 L91 A92 V93 R94 V95 L96 D97 A98
    L104 D105 S106 I107 A108 S109 G110 I111 R112 Y113 A114 A115
    D116 Q117 G118 A119 T133 T134 L135 K136 S137 A138 V139 D140
    Y141 A142
    pd2.1 V19 T21 I111 R112 Y113 A114 A115 D116 Q117 G118 A119 L122
    D140 Y141 A142 W143 N144 K145 G146 A147 V148 L233 L234 A235
    S236 Q237 G238 K239 N240 N243 V244 Q245 I246 R247 Q248 A249
    A273 V274 R275 Y276
    pd2.2 S24 S25 T26 Q27 T28 *28aV L42 A43 R44 *44aK *44aaV
    I45 D75 N77 D87 T88 K89 I90 L91 G118 A119 K120 V121
    L122 G146 A147 V148 A232 A235 S236
    pd2.3 R22 G23 S24 S25 T26 Q27 T28 *28aV D87 T88 K89 I111
    A115 G118 A119 K120 V121 L122 S137 A138 V139 D140 Y141 A142
    W143 N144 K145 G146 A147 V148 V149 V150 I175 A231 A232 A235
    S236 N243 I246 R247
    pd2.4 W-6 S12 T13 P14 A15 A16 V19 T21 R22 G23 S24 Q27
    L230 A231 L233 L234 A235 S236 Q237 G238 K239 N240 N243 Q245
    I246 S270 N271 K272 A273 V274 R275 Y276
    pd3.1 L31 K46 G47 Y48 F50 L91 V93 S103 L104 D105 S106 I107
    A108 S109 G110 I111 R112 Y113 A114 A115 D116 Q117 G118 L122
    L124 C130 S132 T133 T134 L135 K136 S137 A138 V139 D140 Y141
    A142 Q167 P168 Y171 P172
    pd3.2 V19 T21 R22 G23 S24 Q27 K120 V121 V148 L230 A231 A232
    L233 L234 A235 S236 Q237 G238 K239 N240 N243 Q245 I246 R247
    Q248 A249 I250 Q252 T253 K272 A273 V274 R275 Y276
    pd4.1 W-6 S12 T13 P14 A15 A16 W17 D18 V19 T21 R22 G23
    S24 M84 A85 P86 D87 T88 A142 W143 G146 A147 V148 G229
    L230 A231 A232 L233 L234 A235 S236 Q237 G238 K239 N240 N243
    V244 Q245 I246 R247 Q248 A249 I250 S270 N271 A273 V274 R275
    Y276
    pd4.2 W-6 T13 A16 W17 V19 T21 R22 G23 S24 *44aK A73 A74
    *75aT G83 M84 A85 P86 D87 T88 A142 G146 G146 A147 V148
    G229 L230 A231 A232 L233 L234 A235 S236 Q237 G232 K239 N240
    N243 V244 Q245 I246 R247 Q248 A249 I250 S270 A273 V274 R275
    Y276
    pd4.3 T26 Q27 T28 *28aV A29 V30 L31 Y37 *44aaV I45 K46
    G47 Y48 D49 D52 R53 D54 N55 N56 P57 M58 V72 T88
    K89 I90 L91 A92 V93 Y113 A114 A115 Q117 G118 A119 K120
    V121 L122 N123 A147 A228 A232
    pd4.4 K46 G47 F50 L91 V93 S103 L104 D105 S106 I107 A108 S109
    G110 I111 R112 Y113 A114 A115 D116 Q117 G118 C130 S132 T133
    T134 L135 K136 S137 A138 V139 D140 Y141 Q167 P168 A169 S170
    Y171 P172 N173 A174
    pd4.5 T28 *28aV A29 V30 L31 V35 D36 Y37 N38 H39 L42 A43
    *44aaV I45 K46 G47 Y48 F50 N55 N56 P57 M58 K89
    I90 L91 A92 V93 A108 S109 G110 I111 R112 Y113 A114 A115
    D116 Q117 G118 A119 L122
    pd5.0 F50 S103 L104 D105 S106 I107 A108 S109 G110 I111 R112 Y113
    A114 A115 D116 Q117 T133 T134 L135 K136 S137 A138 V139 D140
    Y141 A142
    pd6.1 Y4 Y6 G7 G63 H64 H67 V68 T71 N155 A179 F189 P201
    G202 V203 N204 I205 A206 S207 V209 G213 Y214 S215 Y216 M217
    S218 G219 T220 S221 M222 A223 S224 P225 H226
    pd6.2 W-6 T13 A16 W17 V19 T21 R22 G23 S24 S25 Q27 M84
    A85 P86 D87 T88 G229 L230 A231 A232 L233 L234 A235 S236
    Q237 G238 S270 V274
    pd7.0 R22 G23 S24 S25 Q27 T28 *28aV A29 V30 V35 D36 Y37
    N38 H39 P40 D41 L42 A43 R44 *44aK *44aaV T66 A69
    G70 V72 A73 A74 D75 N77 A85 P86 D87 T88 K89 I90
    L91 A119 V121 L122 N123 T208 A228 A231
    pd8.0 W-6 T13 A16 W17 T21 R22 G23 Q27 *44aK A73 A74 *75aT
    G83 M84 A85 P86 D87 T88 K120 V121 I175 A176 V177 G178
    V196 D197 V198 T199 A200 V227 G229 L230 A231 A232 L233 L234
    A235 S236 Q237 G238 K239 N240 N243 Q245 I246 Q248 A249 I250
    Q252 T253 A254 F264 Y265 G266 I268
    pd9.0 W-6 Y6 G7 P8 Q9 N10 T11 S12 T13 P14 A15 A16
    W17 D18 V19 T21 M84 V139 W143 V148 V149 A151 P168 A169
    Y171 P172 N173 A174 I175 A176 D181 S182 N183 D184 D197 P201
    L230 L233 L234 K239 N240 N243 V244 Q245 I246 R247 Q248 A249
    I250 E251 Q252 T253 A254 K267 I268 N269 S270 N271 K272 A273
    V274 R275 Y276
    pd10.0 L124 L126 G127 C128 E129 C130 N131 L135 V139 A151 A152 A153
    G154 N155 D156 N157 V158 S160 R161 T162 F163 Q167 P168 A169
    S170 Y171 A174 I175 A176 N191 Y192 G193 T194 W195 V196 T262
    N263 F264 *264aK
    pd11.0 W-6 S-5 Y2 Y4 Q5 Y6 G7 P8 Q9 N10 T11 S12
    T13 P14 W17 D18 V19 T21 A82 M84 I180 D181 S182 N183
    D184 P201 G202 V203 N204 I205 H226 L233 S270 N271 V274 R275
    pd12.0 G127 C128 E129 V139 V148 V149 V150 A151 A152 A153 G154 N155
    D156 V158 R161 T162 F163 Q167 P168 A169 S170 Y171 P172 N173
    A174 I175 A176 V177 G178 N191 Y192 G193 T194 W195 V196 D197
    V198 T199 A200 V227 R247 I250 E251 A254 N263 F264 *264aK
    Y265 G266 I268
    pd13.1 W-6 S-5 P-4 D-2 P-1 Y1 Y2 S3 *3aA Y4 Q5 P8
    Q9 S12 T13 P14 A15 A16 W17 D18 V19 T21 R22 G80
    V81 A82 N271 V274 R275
    pd13.2 W-6 S-5 P-4 N-3 D-2 P-1 Y1 Y2 S3 *3aA Y4 Q5
    P8 Q9 P14 W17 D41 G70 A74 D75 *75aT N76 N77 G78
    I79 G80 V81 A82 G83 A206 S207 T208 Y214
    pd14.0 T28 V35 D36 Y37 N38 H39 P40 D41 L42 A43 R44 *44aK
    *44aaV I45 K46 G47 Y48 D49 F50 R53 D54 N55 N56
    P57 M58 T66 A69 G70 A73 A74 D75 K89 I90 L91 A92
    V93 R94 Y113 T208
    pd15.0 V30 L31 D32 S33 G34 V35 D36 Y37 N38 H39 L42 A43
    *44aaV K46 Y48 D49 F50 I51 N56 P57 M58 D60 L61
    N62 G63 H64 G65 T66 A69 I90 A92 V93 R94 V95 L96
    D97 A98 G100 S101 G102 S103 S106 I107 G110 S125 L126 V209
    P210 N211 N212
    pd16.0 W-6 S-5 P-4 N-3 Y2 G7 P8 Q9 N10 T11 S12 T13
    P14 A15 A16 W17 D18 V19 T21 R22 *75aT N76 A82 G83
    M84 A85 P86 L233 N269 S270 N271
    pd17.1 T11 S12 A15 A16 D18 V19 T21 R22 G23 S24 Q27 L230
    A232 L233 L234 A235 S236 Q237 G238 K239 N240 N243 Q245 I246
    Q248 A249 Q252 T253 N269 S270 N271 K272 A273 V274 R275 Y276
    pd17.2 A108 I111 R112 A115 D116 K120 L124 T133 T134 L135 K136 S137
    A138 V139 D140 Y141 A142 W143 N144 K145 G146 A147 V148 V149
    P168 Y171 N173 A174 N243
    pd18.1 W-6 T13 A16 W17 V19 T21 R22 G23 S24 S25 *44aK M84
    A85 P86 D87 T88 K89 G229 L230 A231 A232 L233 L234 A235
    S236 Q237 K239 A249 I250 T253 N269 S270 N271 K272 A273 V274
    R275 Y276
    pd18.2 D-2 V30 V35 D36 Y37 N38 H39 P40 D41 L42 A43 R44
    *44aK *44aaV I45 K46 G47 Y48 P57 T66 A69 G70 A73
    A74 D75 *75aT N76 N77 I79 V81 A82 A85 P86 D87 T88
    K89 I90 L91 A92 V93 R94 T208
  • lip2.1 Y53 F55 V63 L78 F80 W117 V120 A121 D122 T123 L124 R125
    Q126 K127 V128 E129 D130 A131 V132 R133 V140 L159 R160 G161
    N162 G163 Y164 D165 I166 G190
    lip2.2 V2 L6 F10 A173 P174 R175 A182 L193 Y194 R195 I196 T197
    P204 R205 Y213 S214 H215 S216 S217 P218 E219 Y220 W221 I222
    I235 V236 K237 I238 E239 I241 D242 A243 G246 N247 N248
    lip2.3 V2 L6 F10 A182 L185 T186 L193 Y194 R195 I196 T197 H215
    S216 S217 P218 E219 Y220 W221 I222 I235 V236 K237 I238 E239
    G240 I241 A243 G246 N247 N248
    lip2.4 V2 L6 F10 L193 Y194 R195 I196 T197 S216 S217 P218 E219
    Y220 W221 I222 I235 V236 K237 I238 E239 G240 A243 G246 N247
    N248
    lip3.0 L93 K94 F95 H110 A173 P174 R175 V176 G177 N178 R179 A182
    L185 T186 L193 R195 N200 D201 I202 P204 R205 L206 P207 P208
    R209 E210 F211 G212 Y213 S214 H215 S216 S217 P218 E219 I238
    E239 G240 I241 D242 A243 T244 G245 N248 ?R259? P250 N251
    I252 P253 D254 I255
    lip4.0 R175 V176 G177 N178 R179 A180 F181 A182 E183 F184 L185 T186
    R205 P207 P208 R209 E210 F211 G212 Y213 S214 H215 S216 S217
    I241 D242 N248
    lip5.1 A20 Y21 N25 N26 T50 F51 L52 Y53 S54 F55 E56 V63
    T64 G65 F66 L67 A68 L69 I76 V77 L78 S79 F80 R81
    G82 S83 R84 S85 I86 E87 N88 W89 K127 V128 A131 H145
    S146 L147 G148 L151 G266
    lip5.2 K94 F95 L96 L97 K98 E99 R108 G109 H110 D111 G112 R175
    V176 G177 N178 R179 A180 F181 A182 E183 F184 R205 P207 P208
    R209 E210 F211 G212 Y213 S214 H215 S216 I241 D242 N248
    lip6.0 Q9 F10 N11 F13 A14 S17 V63 F80 R81 W89 L93 F113
    S116 W117 F142 T143 G144 H145 S146 L147 G148 G149 A150 L151
    A152 T153 V154 A155 G156 A157 V168 F169 S170 Y171 G172 A173
    P174 R175 V176 F181 L185 L193 Y194 R195 I196 T197 D201 V203
    P204 L206 P207 H215 H258 Y261 F262 I265
    lip7.0 F13 A14 Q15 Y16 S17 A180 A19 A20 Y21 C22 G23 N25
    N26 I34 C36 A40 C41 F51 L52 Y53 S54 F55 E56 V63
    T64 G65 F66 L67 S79 F80 R81 V120 A121 D122 T123 L124
    R125 Q126 K127 V128 L264 I265
    lip8.1 L12 F13 A14 Q15 Y16 S17 A18 A19 A20 I34 V44 A49
    T50 F51 L52 F66 L67 A68 L69 D70 N71 T72 N73 K74
    L75 I76 V77 S79 H135 P136 D137 Y138 R139 V140 V141 T143
    lip8.2 L12 F13 A14 Q15 Y16 S17 A18 A19 A20 I34 V44 A49
    T50 F51 L52 Y53 S54 F55 G65 F66 L67 A68 L69 D70
    N73 L75 I76 V77 L78 S79 T123 L124 R125 Q126 K127 V128
    E129 D130 A131 T143
    lip9.0 L6 F10 N25 N26 D27 A28 A30 G31 T50 F51 L52 Y53
    S54 F55 E56 G65 F66 L67 A68 L69 I76 T123 L124 R125
    Q126 K127 V128 E129 D130 A131 V132 R1333 E134 H135 P136 R139
    V140 V141 F142 G156 L159 R160 G161 N162 G163 Y164 D165 I166
    D167 V168 F169 S170 G190 G191 T192 L193 Y194 R195 I196 Y220
    lip10.0 N11 L12 Q15 Y16 I34 T35 C36 C41 P42 E43 V44 E45
    K46 A47 D48 A49 D70 N71 T72 N73 K74
    lip11.0 F95 L96 L97 K98 E99 I100 N101 D102 C107 R108 G109 H110
    D111 F113 T114 S115 A150 T153 V154 A173 P174 R175 V176 G177
    N178 R179 F181 V203 P204 R205 L206 P207 P208 R209 F211 G212
    Y213 S214 H215 G240 I241 D242 A243 T244 N248
    lip12.0 L96 L97 K98 E99 I100 N101 D102 C104 S105 G106 C107 R108
    G109 H110 T114 S115 V176 G177 N178 A180 F181 F184
    lip13.0 N11 L12 F13 A14 Q15 Y16 S17 A182 A19 A20 Y21 N26
    I34 C36 A40 C41 P42 E43 V44 A49 F55 E56 V63 T64
    G65 F66 L67 A68 D70 N73 L75 I76 V77 L78 S79 F80
    R81 G82 S83 R84 W89 W117 L124 V128 V141 F142 T143 G144
    H145 S146 L147 G148 G149 A150 L151 A152 A155
    lip14.0 Q9 F10 N11 F13 A14 S17 Y21 R81 G82 S83 R84 S85
    I86 E87 N88 W89 I90 G91 N92 L93 F113 T143 G144 H145
    S146 L147 G149 A150 T153 V168 F169 S170 Y171 A173 P174 R175
    V176 L193 Y194 R195 I196 T197 D201 V203 P204 L206 P207 H215
    H258 Y261 F262 I265 G266
    lip15.0 N11 L12 F13 A14 Q15 Y16 S17 A18 A19 A20 Y21 C22
    G23 K24 N25 N26 D27 A28 I34 T35 C36 A40 041 P42
    E43 V44 E45 K46 A47 A49 F51 L52 Y53 S54 F55 E56
    T64 G65 F66 L67 S79 F80 R81 T123 L124 K127 L264 I265
    lip16.0 A14 E87 I90 H145 G172 I196 T197 H198 T199 N200 D201 I202
    P204 R205 W221 I222 K223 S224 G225 T226 G246 N247 N254 I252
    P253 D254 I255 P256 A257 H258 L259 W260 Y261 F262 G263 I265
    lip17.0 E1 V2 F7 F10 G177 N178 R179 A180 F181 A182 E183 F184
    L185 T186 L193 R195 H198 T199 G212 S214 H215 S216 S217 P218
    E219 Y220 W221 I222 K223 S224 G225 T226 V228 P229 V230 T231
    R232 N233 D234 I235 V236 K237 I238 E239 G240 I241 D242 A243
    T244 G245 G246 I262
    lip18.0 Q9 F13 Y16 T32 N33 I34 C41 P42 E43 V44 E45 K46
    A47 D48 A49 T50 F51 L52 L67 A68 L69 D70 N71 T72
    N73 L75 I76 V128 V132 H135 P136 D137 Y138 R139 V140 V141
    F142 Y164 D165 I166 D167 F169 Y194
  • For Amylase, the following amino acid residues belong to the epitope area that correspond to each epitope sequence indicated in Table 5:
    je1.1 N2 G3 T4 R33 P346 Y349 I352 L353 T354 R355 P360 V362
    D366 Y367 M378 K379 A380 K381 I382 D383 P384 I385 L386 E387
    A388 R389 Q390 N391 F392 A393 Y394 I450 T451
    je1.2 Y57 D58 Y60 D61 F65 N66 Q67 L104 G105 G106 A107 D108
    A109 T110 E111 A135 W136 T137 K138 F139 D140 F141 P142 G143
    R144 G145 N146 T147 Y148 S149 F151 K152 W153 R154 F158
    je2.1 M6 Y8 E10 W11 H12 D26 L30 R33 V325 D326 N327 H328
    D329 S330 Q331 P332 G333 E334 E337 F339 K345 Y349 V362 F363
    Y364 G365 D366 Y367 Y368 G369 I370 P371 T372 H373 S374 V375
    P376 A377 M378 K379 I382 D383 L386
    je2.2 L289 L293 V314 P318 T323 F324 V325 D326 F339 K345 P346 L347
    A348 Y349 A350 L351 I352 L353 T354 R355 F356 Q357 G358 Y359
    P360 S361 V362 F363 Y364 G365 D366 Y367 Y368 G369 P376 A377
    M378 K379 I382 I385 R389 Q397
    je2.3 N102 V116 E117 V118 P120 R123 D159 G160 V161 D162 W163 Q168
    F169 Q170 N171 R172 I173 Y174 K175 A182 W183 D184 V187 D188
    N193 Y194 D195 Y196 L197 M198 Y199 A200 D201 V202 H236
    je2.4 T1 N2 T4 M6 Y8 D26 L30 R31 N32 R33 G34 I35
    V325 D326 F339 K345 Y349 L353 V362 F363 Y364 G365 D366 Y367
    Y368 G369 I370 P376 A377 M378 K379 I382 D383 P384 I385 L386
    E387 A388 R389 Q390 N391 F392 Y394 H417
    je3.1 M6 Q7 Y8 F9 E10 L13 H19 W20 N21 R22 L23 R24
    D25 D26 A27 S28 N29 L30 R31 N32 R33 I385 W39 I40
    P41 P42 A43 W44 V52 G53 Y54 Y75 A87 L88 N91 V93
    D98 V100 Y364 Y368
    je3.2 Y8 F9 W11 H19 W20 W39 I40 P41 P42 A43 W44 D51
    V52 G53 Y54 G55 A56 Y75 D98 V99 V100 M101 N102 H103
    L104 D195 L197 M198 A200 D201 V202 R230 I231 D232 A233 V234
    K235 H236 I237 E262 H328
    je3.3 Y8 F9 H19 W20 W39 I40 P41 P42 A43 W44 K45 G46
    T47 V52 G53 Y54 G55 A56 Y57 D58 L59 Q67 K68 Y75
    D98 V100 L104 G105 G106 A107 D108 A109 T110 E111 A135 W136
    T137 K138 F139 D140 F141 P142
    je4.1 L23 D25 D26 A27 S28 N29 L30 R31 N32 R33 G34 I35
    T36 I38 A84 I85 H86 A87 L88 K89 N90 N91 G92 V93
    Q94 V95 Q390
    je4.2 A43 W44 K45 L59 Y60 D61 L62 G63 E64 F65 V71 R72
    T73 K74 Y75 G76 T77 R78 S79 Q80 L81 E82 S83 Y148
    W219 Y220 T223 L224
  • Example 4
  • Having identified ‘antibody binding peptide’ sequences and by consensus analysis also “epitope patterns” (e.g. >DF>>K>), one can identify potential epitope sequences on the 3-dimensional surface of a parent protein (=acceptor protein) in a semi-automated manner using the following method:
  • The anchor amino acid residues are transferred to a three dimensional structure of the protein of interest, by colouring D red, F white and K blue. Any surface area having all three residues within a distance of 18 Å, preferably 15 Å, more preferably 12 Å, is then claimed to be an epitope. The relevant distance can easily be measured using e.g. molecular graphics programs like InsightII from Molecular Simulations Inc.
  • The residues in question should be surface exposed, meaning that the residue should be more than 20% surface exposed, preferably more than 50% surface exposed, more preferably 70% surface exposed. The percentage “surface accessible area” of an amino acid residue of the parent protein is defined as the Connolly surface (ACC value) measured using the DSSP program to the relevant protein part of the structure, divided by the residue total surface area and multiplied by 100. The DSSP program is disclosed in W. Kabsch and C. Sander, BIOPOLYMERS 22 (1983) pp. 2577-2637. The residue total surface areas of the 20 natural amino acids are tabulated in Thomas E. Creighton, PROTEINS; Structure and Molecular Principles, W. H. Freeman and Company, N.Y., ISBN: 0-7167-1566-X (1984).
  • Substitutions of one or more residue (s) within 18 Å, prefereably 15 Å, more prefereably 12 Å, around the geometrical center of the residues involved in the epitope, for a bigger or smaller residues, may destroy the epitope, and make the protein less antigenic.
  • Residues involved in epitope is 2, preferably 3 and more prefereably 4
  • Example 5 Production, Selection, and Evaluation of Enzyme Variants with reduced Antigenicity or Immunogenicity
  • Epitope sequences and hot-spots amino acids were mutated using standard techniques know to the person skilled in the field (e.g. site-directed mutagenesis, error-prone PCR—see for example Sambrook et al. (1989), Molecular Cloning. A Laboratory Manual, Cold Spring Harbour, N.Y.).
  • In the examples shown below, variants were made by site-directed mutagenesis. Amino acid exchanges giving new epitopes or duplicating existing epitopes, according to the information collected in the epitope-database (See Example 1), were avoided in the mutagenesis process.
  • Enzyme variants were screened for reduced binding of antibodies raised against the backbone enzyme. Antibody binding was assessed by competitive ELISA as described in the Methods section.
  • Variants with reduced antibody binding capacity were further evaluated in the mouse SC animal model (See methods section).
  • The following variants showed reduced IgE and/or reduced IgG levels in the mouse model:
    Parent % IgG % IgE
    protein Mutations Target epitope sequences response response
    Savinase D181N Sav11.0; Sav15.0 and Sav18.1. 50 19
    Hot spot amino acid.
    Savinase R170L; Q206E Sav9.4; Sav10.4; Sav1.1; and 5 34
    Sav19.2
    Savinase R170L, S57P Sav9.4; Sav10.4 45 12
    Savinase R247E Sav2.3, Sav6.1, Sav18.2 75 30
    Hot spot amino acid.
    Savinase R247Q Sav2.3, Sav6.1, Sav18.2 17 20
    Hot spot amino acid.
    Savinase R247H Sav2.3, Sav6.1, Sav18.2 40 27
    Hot spot amino acid.
    Savinase R247K Sav2.3, Sav6.1, Sav18.2 74 34
    Hot spot amino acid.
  • Example 6 Production, Selection, and Evaluation of Enzyme Variants with Reduced Antigenicity or Immunogenicity
  • Hot-spots or epitopes were mutated using techniques known to the expert in the field (e.g. site-directed mutagenesis, error-prone PCR).
  • In the examples showed below, variants were made by site-directed mutagenesis. Amino acid exchanges giving new epitopes or duplicating existing epitopes according to the information collected in the epitope-database, were avoided in the mutagenesis process. Enzyme variants were screened for reduced binding of antibodies raised against the backbone enzyme. This antibody binding was assessed by established assays (e.g. competitive ELISA, agglutination assay).
  • Variants with reduced antibody binding capacity were further evaluated in animal studies.
  • Mice were immunised subcutanuous weekly, for a period of 20 weeks, with 50 microliters 0.9% (wt/vol) NaCl (control group), or 50 microliters 0.9% (wt/vol) NaCl containing 10 micrograms of protein. Blood samples (100 microliters) were collected from the eye one week after every second immunization. Serum was obtained by blood clothing, and centrifugation.
  • Specific IgG1 and IgE levels were determined using the ELISA specific for mouse or rat IgG1 or IgE. Differences between data sets were analysed by using appropriate statistical methods.
  • A. Site-Directed mutagenesis of amino acids defining epitopes, with an effect on IgG1 and/or IgE responses in mice.
  • Epitope: A 172/A169 R170 A194 G193 N261 Pattern:AR>R>A>N Antibody: IgG1+IgE Backbone: Savinase
  • The variant carried the mutation R170F.
  • In a competitive IgE ELISA, this variant was less effective in competing for anti-savinase antibodies, giving a 15% lower endpoint inhibition as compared to the savinase backbone.
  • Mouse studies revealed an 80% reduction of the specific IgE levels, as compared to savinase backbone (p<0.01). The IgG1 levels were not significantly affected.
  • Epitope: S216 E219 Y220 Pattern: E Y>M Antibody: IgG1 Backbone: Lipoprime
  • The variant carried the mutation S216W.
  • In a competitive IgG ELISA, the variant was less effective in competing for Lipolase antibodies, giving a 38% decrease in endpoint inhibition as compared to the enzyme backbone.
  • Mouse studies revealed a 69% decrease in specific IgG1 levels, compared to the lipolase backbone (p<0.05). The IgE levels were not significantly affected.
  • B. Site-directed mutagenesis of epitopes, with examples of epitope duplication, and new epitope formation, respectively, predicted by the epitope-database.
  • Epitope: T143 N173 N140 E136 L135 Pattern: S/T N N>E L Antibody: IgG1 Backbone: Savinase
  • The variant carried the mutation E136R.
  • In a competitive IgG ELISA, the variants was less effective in competing for savinase antibodies, giving a 38% decrease in endpoint inhibition as compared to the savinase backbone.
  • Mouse studies revealed a dramatic increase in specific IgGl levels, compared to savinase backbone (p<0.01). The IgE levels were not significantly affected.
  • Mutation E136R establishes an IgG1 epitope of the R Y P R/K pattern, previously identified on PD498. Apparently, this new epitope was more antigenic in mice than the existing epitope. The introduction of a savinase unrelated epitope on the savinase backbone could explain the observed discrepancy between competitive ELISA and animal studies.
  • In this example, it was found that using information derived exclusively from screening phage libraries with anti-PD498 antibodies (to identify the R Y P R/K epitope pattern of Table 2) one could predict the outcome of a genetic engineering experiment for Savinase in which the E136R mutation created the PD498-epitope on the Savinase surface, leading to increased immunogenicity of this Savinase variant. This demonstrates that the epitope patterns identified may be used to predict the effect on immunogenicity of substitutions in proteins that are different from the parent protein(s) used to identify the epitope pattern.
  • C. Site-directed mutagenesis of amino acids defining epitope areas, with a differential effect on IqG1 and IgE antibody levels in mice, and an inhibiting effect on IgG binding, respectively.
  • Epitope: A172/A169 R170 A194 G193 N261 Pattern: A R>R>A>N Antibody: IgG1+IgE Backbone: Savinase Epitope area: P131, S132, A133, L135, E136, V139, A151, A152, S153, G161, S162, I165, S166, Y167, P168, Y171, N173, A174, A176, Q191, Y192, G195, L196, R247, S259, T260, L262, Y263, G264.
  • The variant was different at position Y167 by the mutation Y1671.
  • In a competitive IgE ELISA, the variant was less effective in competing for anti-savinase antibodies, giving a 8% lower endpoint inhibition as compared to the its backbone.
  • Mouse studies revealed an 75% reduction of the specific IgE levels, as compared to the backbone (p<0.01). In contrast, the IgG1 levels were dramatically increased (p<0.01). Epitope: T143 N173 N140 E136 L135 Pattern: S/T N N>E L Antibody: IgG1 Backbone: Savinas Epitope area: V10A, I107, A108, L111, E112, G115, S132, A133, T134, Q137, A138, V139, S141, A142, S144, R145, G146, V147, V149, Y167, P168, Y171, A172, A174, M175, N243, R247.
  • While variant no. 1 was mutated at the epitope position (N140D), variant no. 2 was mutated at N140 (N140D), but also at the epitope area position (A172D).
  • In a competitive IgG ELISA, variant no. 1 was less effective in competing for anti-savinase antibodies, as compared to savinase. This variant revealed a 21% lower endpoint inhibition as compared to the its backbone.
  • Variant no. 2 resulted in an endpoint inhibition that was 60% lower as compared to savinase, and 40% as compared to variant no. 1.
  • Example 7 Conjugation of Savinase Variant E136K with Activated Bis-PEG-1000
  • 4.9 mg of the Savinase variant was incubated in 50 mM Sodium Borate pH 9.5 with 12 mg of N-succinimidyl carbonate activated bis-PEG 1000 in a reaction volume of approximately 2 ml. The reaction was carried out at ambient temperature using magnetic stirring while keeping the pH within the interval 9.0-9.5 by addition of 0.5 M NaOH. The reaction time was 2 hours.
  • The derivatives was purified and reagent excess removed by size exclusion chromatography on a Superdex-75 column (Pharmacia) equilibrated in 50 mM Sodium Borate, 5 mM Succinic Acid, 150 mM NaCl, 1 mM CaCl2 pH 6.0.
  • The conjugate was stored at −20° C., in the above described buffer.
  • Compared to the parent enzyme variant, the protease activity of the conjugate was retained (97% using Dimethyl-casein as substrate at pH 9).
  • Example 8
  • Competitive ELISA was performed according to established procedures. In short, a 96 well ELISA plate was coated with the parent protein. After proper blocking and washing, the coated antigen was incubated with rabbit anti-enzyme poiyclonal antiserum in the presence of various amounts of modified protein (the competitior).
  • The amounts of residual rabbit antiserum was detected by pig anti-rabbit immunoglobulin, horseraddish peroxidase labelled.
  • Epitope: T143 N173 N140 E136 L135 Pattern: S/T N N>E L Antibody: IgG1 Backbone: Savinase Mutation: E136K Modification: bis-NHS-PEG1000
  • The data show that the derivative (60% endpoint inhibition) has reduced capacity to bind enzyme specific immunoglobulines, as compared to the parent protein (100% endpoint inhibition).
  • Example 9
  • For this example the epitope sequences were determined in four environmental allergens (Bet v1; Der f2; Der p2 and PhI p2), based on their structures (1btv.pdb; 1ahm.pdb; a19v.pdb; and 1whp.pdb, respectively), sequences (SEQ ID NOS: 6, 7, 8 and 9, respectively) and computer modelling of the epitope patterns that had been assembled in our database (shown in Table 8). The allergens arise from common sources of allergy: Birch (Bet v1 from Betula pendula), House dust mites (Der f2 from Dermatophagoides farinae and Der p2 from Dermatophagoides pteronyssinus), and Timothy grass (Phl p2 from Phleum pratense).
  • The protein surface is scanned for epitope patterns matching the given “consensus” sequence of about 6-12 residues. First, residues on the protein surface that match the first residue of the consensus sequence are identified. Within a specified distance from each of these, residues on the protein surface that match the next residue of the consensus sequence are identified. This procedure is repeated for the remaining residues of the consensus sequence. The method is further described under the paragraph “Methods” above and the computer program can be found in the Appendixes.
  • The critical parameters used in this screening included:
      • i) a maximal distance between the alpha-carbon atoms of subsequent amino acids,
      • ii) a minimal accessability of the amino acid of 20 Å2,
      • iii) the largest maximal distance between the most distinct amino acids should be less than 25 Å,
      • iv) the 5 best epitopes were taken,
      • v) the minimal homology with the epitope pattern of interest was 80%
  • In this way a number of potential epitopes are identified. The epitopes are sorted according to total surface accessible area, and certain entries removed:
      • 1) Epitopes that contain the same protein surface residue more than once. These are artefacts generated by the described algorithm.
      • 2) Epitopes which are “too big”, i.e. where a distance between any two residues in the epitope exceeds a given threshold.
  • The epitope sequences found by this second generation mapping procedure were:
  • The epitope sequences found were:
    Bet v1:
    Epi#02
    A146, K32, Q36, F30, T142, R145, V12
    A34, K32, Q36, F30, T142, R145, V12
    Epi#03
    L62, K65, —, I56, Y66
    L24, K20, H76, I23, Y81
    L24, K20, H76, I104, Y81
    Epi#04
    K134, S136, Q132, K129, A130, A135
    k134, S136, Q132, K129, V128, G1
    Epi#05
    G140, A146, R145, T10, G111, A106, T107, V12
    G26, A146, R145, T10, G110, A106, T107, V12
    G140, A146, R145, T10, G110, S11, S149, L152
    G110, A106, S11, T9, G140, R145, T10, V12
    G140, A146, R145, T10, G111, S11, S149, V12
    Epi#06
    G110, P108, D109, T107, A106, P14
    G111, P108, D109, T107, A106, P14
    A34, N28, D27, S40, K32, P35
    G26, N28, D27, S39, K32, P35
    A106, N78, D75, T77, A16, P14
    G26, N28, D27, S39, Q36, P35
    Epi#07
    G46, T52, D69, S99, R70, V71, P50, D72
    G49, T52, D69, S99, R70, V71, P50, D72
    G48, T52, D69, S99, R70, V71, P50, D72
    Epi#08
    K123, E127, G1, V2, H121, F3
    K65, E60, F64, V67, F58
    K65, E60, F58, V67, F64
    K129, E127, G1, V2, H121, F3
    Epi#09
    S149, L152, D156, N159, R17, L24, D75, K103, N78, A106, V12
    L152, S149, D156, N159, R17, L24, D75, H76, N78, A106, V12
    L152, D156, N159, R17, L24, D75, K80, N78, A106, V12
    Epi#10
    D109, A106, N78, T77, F79, R17, K20
    E141, T10, R145, T142, F30, G26, K32
    E8, T10, R145, T142, F30, G26, K32
    Epi#11
    F30, K32, I38, Q36, V33, E148
    F22, F30, I38, Q36, V33, E148
    F30, L143, I38, Q36, V33, E148
    Epi#12
    Y5, E6
    Y83, E73
    Y120, E127
    Y5, E8
    Y66, E87
    Y81, E73
    Epi#13
    H76, A16, P14, T107, A106, P108, G110, G111
    A16, R17, P14, T107, A106, P108, G110, G111
    A157, R17, P14, T107, A106, P108, G111, G110
    Epi#15
    K65, P90, D93, I91, K97, G92
    K32, P31, D27, I56, K65, G61
    Epi#17
    A153, S149, R145, S11
    A106, S11, R145, S149
    Epi#18
    R145, S149, L152, A153, Y150, L151, H154, S155
    R145, S149, L152, A153, S155, L151, A157, N159
    Epi#22
    D125, D93, P90, K65
    D93, P90, P63, E60
    Epi#23
    K55, N43, E42, S57, L62, P63
    K68, N43, E42, S40, F30, P35
    K54, N43, E42, S57, F64, P63
    K55, N43, E42, S40, F58, P35
    Epi#24
    E96, K97, E87, P90, F64, E60, K65
    E127, K123, E96, P90, F64, P63, K65
    E42, K68, E87, P90, F64, E60, K65
    E42, K55, E87, P90, F64, E60, K65
    D93, G92, E87, P90, F64, E60, K65
    D125, K123, E96, P90, F64, P63, K65
    Epi#25
    R70, K55, I44, E45, E42
    R70, K54, I44, E45, N47
    R70, K68, I53, E45, N47
    Epi#27
    D93, E127, D125, K123
    Epi#28
    A146, Q36, F58, E60, L62, F64, P63, K65
    I38, Q36, F58, E60, L62, F64, P63, K65
    A34, Q36, F58, E60, L62, F64, P63, K65
    L143, Q36, F58, E60, L62, F64, P63, K65
    V33, Q36, F58, E60, L62, F64, G61, K65
    Epi#29
    G61, K65, L62, F58, E60
    I56, K65, L62, F64, E60
    G89, K65, L62, F64, E60
    V67, K65, L62, F64, E60
    Epi#30
    G1, N4, S99, H121, K97, I91, P90
    I113, I13, S149, H154, S155, L152, L151
    I13, L152, A153, H154, S155, L151, V33
    G110, I13, S149, H154, S155, L152, L151
    G1, N4, S99, H121, K97, I98, V2
    G1, N4, S99, H121, K97, I91, V85
    Epi#33
    K32, F30, P35, S39, S57, K65
    Q36, F30, P35, S39, S40, K32
    K32, F30, P35, S40, S57, K65
    K65, F58, P35, S39, A34, R145
    Epi#34
    V105, P14, T107, V12, R145, Y150, S155
    I113, P14, T107, V12, R145, Y150, S155
    Epi#37
    P50, V74, L24, R17, N159
    P50, V74, L24, K20, N159
    P14, R17, L24, K20, N159
    Epi#38
    L143, G140, E141, R145, V33, N28, P31, S39
    L143, G140, E141, R145, V33, N28, P31, S40
    L143, G140, E141, R145, V33, N28, P31, S57
    Epi#39
    A130, E127, H126, T94, P90, G89, L62
    A130, E127, H121, T94, P90, G89, L62
    Epi#40
    A157, L152, A153, Y150, K32, S39
    A153, L152, A157, Y150, K32, S40
    R17, L151, A153, Y150, K32, S40
    R145, L143, A34, Y150, A153, S155
    R145, L143, G140, T9, K115, T10
    Epi#41
    P63, Y66, L62, S57
    Epi#44
    I23, R17, D156, Y150, S149, V12, T10
    L24, R17, D156, Y150, S149, V12, P14
    L24, R17, D156, Y158, A16, A106, P108
    I13, R17, D156, Y150, S149, V12, T10
    L151, R17, D156, Y150, S149, V12, T10
    L24, R17, D156, Y150, S149, V12, T107
    Epi#45
    K32, P35, F30, Y150, R145, M139, G140
    K32, P35, F30, Y150, R145, M139, L143
    K32, P31, F30, Y150, R145, M139, G140
    Epi#47
    L152, S149, R145, L143, A34, F30, N28, P31, P35
    A153, S149, R145, A146, A34, F30, N28, P31, P35
    Epi#48
    E60, K65, P90, P63, G61
    E60, K65, P63, P90, G92
    Epi#51
    T94, H126, E127, D125, G124, K123, H121
    D125, H126, E127, T94, K123, T122, H121
    Der f2:
    Epi#02
    A98, K100, S101, P99, R128, R31
    A98, K100, R128, P99, R31, V94
    T91, N93, P95, P34, R31, R128
    L61, N93, P95, P34, R31, R128
    Epi#03
    L40, K15, A39, I13, Y86
    L40, K14, A39, I88, Y90
    Epi#05
    G32, A98, R31, P34, G20, T36, T91, Y90
    G32, A98, R31, P34, G20, T36, T91, V94
    G32, A98, R31, P34, G20, T36, T91, L37
    G32, A98, R31, P34, G20, T36, T91, V18
    Epi#06
    A98, P99, D129, R31, K96, P95
    G32, P99, D129, R128, R31, P95
    A98, P99, D129, R31, K33, P95
    A98, P99, D129, R31, K96, P34
    A98, P99, D129, R128, K126, P26
    Epi#07
    T107, S57, D59, S101, R128, A98, P99, D129
    T107, S57, D59, S101, R31, A98, P99, D129
    Epi#08
    K15, D87, V76, H74, F75
    K14, D87, V76, H74, F75
    K77, D87, V76, H74, F75
    Epi#09
    L61, D64, I68, H74, F75, T70, N71
    N114, N46, D113, K48, N71, T70, T49
    G83, N46, D113, K48, N71, T70, T49
    Epi#10
    L40, I13, D42, N44, V81, K48, N46, N114, G115
    L40, I13, D42, N44, V81, K82, N46, N114, G115
    L37, D19, G20, V18, V3, D4, K6, A120, T107, V105
    Epi#11
    F75, K51, I111, Q45, V116, D113
    F75, K51, I111, Q45, V81, D113
    Epi#12
    Y90, E38
    Epi#13
    H30, R31, P95, A98, P99, S101, G60, L61
    Epi#15
    K96, P99, D129, I28, R128, A98
    K96, P99, D129, I127, R128, A98
    K96, P99, D129, I29, R128, A98
    K55, P66, D64, I68, T70, G67
    Epi#18
    R31, R128, I28, G125, T123, H124, V105
    R31, R128, I127, G125, T123, H124, V105
    Epi#22
    D1, M17, D4, V3, K6
    D1, M17, D19, P34, K96
    D1, M17, D4, V5, K6
    Epi#23
    K14, N11, E12, N44, Q85, P79
    k14, N11, E12, N10, Q45, P79
    K14, N11, E12, N44, Q84, P79
    K14, N11, E12, L40, Q85, P79
    Epi#24
    D129, K100, E102, P99, R128, R31, K96
    E62, G60, E102, P99, R128, R31, K96
    D129, K126, E102, P99, R128, R31, K33
    D129, K126, E102, P99, R31, P95, K96
    Epi#25
    R31, K96, I97, D59, E62
    R128, R31, I97, D59, E102
    R128, K126, I127, E102, N103
    Epi#27
    D64, E62, D59, K100
    D59, E62, D64, K55
    D87, E38, D19, K33
    D19, E38, D87, K15
    D19, E38, D87, K14
    D19, E38, D87, K77
    Epi#28
    V16, D87, Q85, K14, E12, K15, Q2, D1
    I13, D87, Q85, K14, E12, K15, Q2, D1
    V3, D1, Q2, K15, E12, K14, Q85, D87
    L40, D87, Q85, K14, E12, K15, Q2, D1
    I88, D87, Q85, K14, E12, K15, Q2, D1
    V76, D87, Q85, K14, E12, K15, Q2, D1
    V18, D1, Q2, K15, E12, K14, Q85, D87
    Epi#29
    G32, N93, L61, E62
    V94, N93, L61, E62
    Epi#30
    G60, I97, A98, H30, K96, P34, P95
    I68, N71, H74, K77, P79, V81
    G32, I97, A98, H30, K96, P95, P34
    Epi#34
    V105, P26, S24, G125, R128, S101, P99
    W92, P34, T91, V94, R31, S101, P99
    I28, P26, T123, G125, R128, S101, P99
    Epi#37
    A120, V16, L40, K14, N11
    A39, V16, L40, K14, N11
    Y90, A39, L40, K14, N11
    Y86, A39, L40, K14, N11
    Epi#39
    A120, E38, T91, P34, G20, L37
    A39, E38, T91, P34, G20, L37
    Epi#40
    G20, L37, A120, T123,K6, S24
    A39, L37, A120, T123, K6, S24
    G20, L37, A120, T107, K6, T123
    Epi#41
    P34, L37, V106, S57
    Epi#42
    P26, S24, G125, R128, R31
    P99, S101, G125, R128, R31
    Epi#44
    V16, Q2, D19, P34, W92, Y90, A39, V18, T91
    V16, Q2, D19, P34, W92, Y90, A39, V5, T123
    V3, Q2, D19, P34, W92, Y90, A39, V18, T91
    Epi#45
    K77, H74, F75, N71, D69, G67
    K77, H74, F75, N71, D69, V76
    K77, H74, F75, N71, D69, V65
    Epi#46
    A98, R128, R31, P95, N93, G32
    A98, R128, R31, P34, G20, Q2
    Epi#48
    Q2, D19, P34, P95, G32
    H30, K96, P95, P34, G20
    Epi#49
    D87, D42, L40, Q85, Q84, C78, T47, Q45, K48
    D87, D42, L40, Q85, Q84, C78, T47, Q45, K82
    Epi#50
    D19, W92, P34, T91
    D19, W92, P34, P95
    D19, W92, T91, T36
    Epi#51
    D129, H30, K33, R31, R128, K126, H124
    R31, H30, D129, R128, K100, K126, H124
    T123, H124, K126, R128, R31, K33, H30
    Der p2:
    Epi#03
    L17, K89, A39, I13, Y86
    L17, K89, A72, I88, Y90
    L17, K89, A72, I52, Y90
    Epi#04
    K15, S1, Q2, K14, V16, L17
    K15, S1, Q2, K14, A39, L17
    K15, S1, Q2, K14, V40, I13
    Epi#05
    G60, A56, L61, P99, G32, R31, H30, I97
    G60, A56, L61, P99, G32, R31, H30, I28
    Epi#06
    G60, A56, D64, S57, K55, P66
    G83, N46, D114, T49, K48, P79
    G60, N103, D59, S101, R31, P95
    Epi#08
    K55, D64, S57, V106, F35
    K55, E62, S57, V106, F35
    Epi#09
    L61, G60, E102, R128, I28, K126, N103, T123, V105
    L61, G60, E102, R128, I127, K100, N103, T123, V105
    L61, G60, E102, R128, I127, H124, N103, T123, V105
    Epi#10
    SAS: 435, Size 24.47: D69, T91, N93, F35, G32, R31
    SAS: 422, Size 20.74: E38, T91, N93, F35, G32, K96
    Epi#11
    K14, I13, Q85, V81, E42
    K15, I13, Q85, V81, E42
    K14, I13, Q85, V40, D87
    Epi#12
    Y86, E42
    Y90, E53
    Y90, E38
    Epi#13
    H30, A125, P26, T123, A122, P19, L37, P34, W92
    H30, A125, P26, T123, A122, H124, S24, G23, G20
    H30, A125, P26, T123, A122, P19, L17, G20, F35
    Epi#15
    K55, P66, D69, I68, K89, A72
    K55, P66, D69, I68, K89, A39
    K55, P66, D64, I54, K109, G115
    K55, P66, D64, I54, K109, A9
    Epi#18
    R31, I29, A125, S101, E102, N103
    R31, I29, A125, S101, E102, V104
    R31, I29, A125, T123, A122, V105
    Epi#22
    D69, P66, D64, V65, K55
    D64, P66, D69, T91, K89
    D59, L61, D64, P66, W92
    D59, L61, D64, V65, E62
    D69, P66, D64, V65, E53
    Epi#24
    D64, K55, E62, P99, R31, P34, K96
    E53, K55, E62, P99, R31, P95, K96
    D64, K55, E62, P99, R31, A98, K96
    Epi#25
    R31, H30, I28, E102, N103
    R128, K126, I127, E102, N103
    R128, K126, I28, E102, V105
    Epi#27
    D64, E53, D69, K89
    D69, E53, D64, K55
    D59, E62, D64, K55
    Epi#28
    V40, D87, Q85, E42, Q84, G83, K82
    G20, H22, Q2, L17, E38, L37, Q36, P34, K33
    G20, H22, Q2, L17, E38, L37, F35, P34, K33
    Epi#29
    I97, K100, L61, E62
    G60, N103, L61, E62
    I127, N103, L61, E62
    Epi#30
    G60, N103, S101, H30, K96, I97, P95
    G60, N103, A125, H30, K96, I97, P95
    I28, I127, A125, H30, K96, I97, P95
    Epi#33
    Q36, F35, V106, S57, A56, K55
    K33, F35, V106, S57, A56, K55
    Epi#34
    I28, P26, S24, G23, G20, T123, S57
    I28, P26, S24, V3, G20, T123, T107
    W92, P34, T91, V18, G20, T123, P26
    Epi#37
    P66, V63, L61, K100, N103
    P95, A98, L61, K100, N103
    P19, V18, L17, K89, D87
    P19, V3, L17, K89, D87
    T123, V104, L61, K100, N103
    Epi#38
    L61, G60, E102, A125, V105, N103, P99, S57
    L61, G60, E62, A56, V105, N103, P99, S57
    Epi#39
    A125, E102, H124, T123, P26, G20, L17
    Epi#40
    G60, L61, A56, T107, K6, T123
    A39, L17, G20, T123, P26, S24
    G60, L61, A56, T107, K55, S57
    G60, L61, A56, T123, K126, S101
    Epi#41
    P19, L17, V3, S1
    P19, L17, V5, S24
    Epi#44
    V65, D64, P66, W92, Y90, A39, V18, P19
    L61, D64, P66, W92, Y90, A39, V18, T91
    Epi#45
    R31, P34, F35, N93, V94
    K96, P34, F35, N93, G32
    Epi#47
    I127, S101, R31, I97, A98, L61, N103, P99, P95
    I28, S101, R31, I97, A98, L61, N103, P99, S57
    Epi#48
    H30, K96, P95, P99, G60
    H30, K96, P34, P19, G20
    H30, K96, P34, P19, V18
    H30, K96, P34, P95, V94
    H30, K96, P34 P19, V3
    E38, K89, P70, P66, V65
    H30, K96, P95, P34, G32
    Q36, K89, P70, P66, V65
    Epi#50
    D69, Y90, W92, P66, P70
    D69, Y90, W92, P34, P95
    D69, Y90, W92, T91, P34
    D69, Y90, W92, V94, P95
    D69, Y90, W92, L37, P19
    Epi#51
    K126, H124, E102, R128, I28, R31, H30
    T123, H124, K126, R128, I28, R31, H30
    D4, H124, K126, R128, I28, R31, H30
    PhI p2:
    Epi#02
    T87, K85, Q61, S38, R34, R67
    T87, K85, Q61, P63, R34, V42
    Epi#03
    K10, A90, I88, Y86
    K10, A18, I88, Y86
    Epi#04
    R34, S38, Q61, K85, T87, I88
    R34, S38, Q61, K85, T87, A90
    Epi#05
    G47, A18, S12, T87, G89, T91, T5, V1
    G73, A29, L69, T27, G50, T53, T45, V42
    G11, A18, L20, T91, G89, A90, T87, I88
    Epi#06
    A93, P94, D79, R34, Q61, P59
    A93, P94, D79, R34, Q61, P83
    A93, P94, D80, R34, Q61, P59
    A93, P94, D79, R34, Q61, P63
    Epi#08
    K10, E9, G11, A18, H16, F54
    K46, E48, G47, A18, H16, F54
    K10, E9, S12, A18, H16, F54
    Epi#09
    L69, T27, G73, N76, R67, V77, D79, R34, A43, T45, V42
    L69, T27, A29, E30, R67, V77, D80, R34, A43, T45, V42
    Epi#10
    D55, A18, N13, S12, F54, G47, K46
    T45, A18, N13, S56, F54, G47, K46
    Epi#09
    L60, S56, E57, D55, K15, N13, S12, G11
    L60, S56, E57, D55, H16, F54, T45, T53
    L60, S56, E57, D55, H16, F54, T45, G47
    Epi#12
    Y86, E84
    Y23, E24
    Epi#18
    N76, R67, F78, V81, A93, Y92, T91, T5, P2, V1
    Epi#19
    D39, W41, S38, Q61, R34, G37
    E40, W41, S38, Q61, R34, A43
    Epi#22
    D79, P94, D80, P83, K85
    D79, P94, D80, P63, K85
    Epi#23
    K10, N13, E14, L60, Q61, P59
    K10, N13, E14, L60, Q61, P83
    K10, N13, E14, L60, Q61, P63
    Epi#24
    E58, K15, E57, P59, S56, E14, Q61
    D55, K15, E57, P59, S56, E58, Q61
    Epi#25
    R34, R67, W41, D39, E40
    Epi#26
    S38, E40, W41, V42, E32, E30
    S38, E40, W41, V42, A43, E32
    Epi#27
    E14, E57, E58, K15
    D55, E14, E84, K85
    Epi#28
    G37, H36, Q61, K85, E84, L60, F54, A43, K46
    G37, H36, Q61, K85, E84, L60, F54, S12, D55
    G37, H36, Q61, K85, E84, L60, F54, S56, D55
    G37, H36, Q61, K85, E84, L60, F54, A43, R67
    G37, H36, Q61, K15, E57, L60, F54, A43, K46
    G37, H36, Q61, K85, E84, L60, F54, S12, K15
    G37, H36, Q61, K85, E84, L60, F54, S56, K15
    G37, H36, Q61, K85, E84, L60, F54, A43, R34
    G37, H36, Q61, K85, E84, L60, F54, A18, D55
    Epi#29
    G73, K72, L69, R67, E30
    I88, N13, L60, F54, E57
    G25, K72, L69, R67, E32
    V77, K75, L69, R67, E30
    G37, H36, L60, F54, E57
    G37, Q61, L60, F54, E57
    Epi#30
    I88, N13, S12, H16, K15, P59, L60
    I88, N13, S56, H16, K15, L60, P59
    I88, N13, A18, H16, K15, P59, L60
    Epi#33
    K46, F54, V42, S56, K15
    H16, F54, V42, S56, K15
    Epi#34
    V1, P2, T5, V4, P94, Y92, T87
    V1, P2, T5, L20, G89, T91, T87
    V81, P94, T5, V1, P2, Y92, T91
    Epi#37
    T27, A29, L69, K72, D26
    A43, R67, L69, K75, N76
    Epi#38
    L20, G89, E9, A18, N13, P59, S56
    Epi#40
    G49, L20, G89, Y86, K85, T87
    G49, L20, G89, T87, K10, S12
    G49, L20, G89, T87, K10, T7
    Epi#44
    V77, R67, D79, P94, Y92, A93, V1, P2
    L69, R67, D79, P94, Y92, A93, V1, T5
    Epi#45
    D79, P94, F78, N76, M74, L69
    D80, P94, F78, R67, D79, V77
    K3, P94, F78, N76, M74, G73
    Epi#46
    A43, R67, R34, P63, H36, Q61
    V77, R67, R34, P63, H36, G37
    L69, R67, R34, P63, G37, Q61
    Epi#47
    G37, E35, E40, A43, R34, L60, N13, P59, S56
    V77, E32, E40, A43, R34, L60, N13, P59, S56
    S38, G37, E40, A43, R34, L60, N13, P59, S56
    Epi#48
    E24, K3, P94, P2, V1
    E84, D80, P94, P2, V1
    Epi#50
    D39, W41, A43, T45
    D39, W41, V42, T45
    Epi#51
    D79, H36, E84, T87, K10, G11, H16
    D39, H36, Q61, K85, P63, R34, W41
    D79, H36, E40, D39, G37, R34, W41
    Q61, H36, E84, T87, K10, G11, H16
  • TABLE 8
    Each row indicates an epitope pattern. At each position (from 1 to
    maximum of 12) the cells indicate which amino acids (single letter
    coding) are allowed at that position. The last column indicates
    the patterns identified using IgE antibody binding.
    Epitope
    Pattern Position
    Number 1 2 3 4 5 6 7 8 9 10 11 12
    1 TS RQ YS NHC KR KR P HNP L IgE
    2 RV R Y- PST FR- ALPQS- RKN ALT IgE
    (SEQ ID
    NO: 197)
    3 Y I AH- K L
    4 AGIL ANRTV- KRY Q S Y- KR
    (SEQ ID (SEQ ID
    NO: 198) NO: 199)
    5 GILVY STH ASTR- G PT- RNAFLS A G IgE
    (SEQ ID (SEQ ID (SEQ ID
    NO: 200) NO: 201) NO: 202)
    6 P KRQSA STRC D PAN GA IgE
    (SEQ ID (SEQ ID
    NO: 203) NO: 204)
    7 D P AV- R S- D S- T G
    8 F HI- VA- FSG- DE- KA IgE
    9 NRGLTV- STAN ANF RKH D- AILV- R- (ENRSV- AGI- DGNT- LIS- IgE
    (SEQ ID (SEQ ID (SEQ ID SEQ ID (SEQ ID
    NO: 205) NO: 206) NO: 207) NO: 208) NO: 209)
    10 KR RG F C- AST- RN NTA DECT IgE
    (SEQ ID
    NO: 210)
    11 DE V- Q I FLK F
    12 E Y IgE
    13 FWYGL PG ALS- PH A T- P LRWA SAH IgE
    (SEQ ID (SEQ ID
    NO: 211) NO: 212)
    14 GV Q ILV I- Y GNR DN TEH
    15 AG RKQT- I D P RKN IgE
    (SEQ ID
    NO: 213)
    16 DN A DA SDN QRSW GMR Y P RQL
    (SEQ ID
    NO: 214)
    17 S- R S A
    18 VLSFN AEHNPT- T- L- ST- Y- GAL LIV- CSF- R FRN- SD IgE
    (SEQ ID (SEQ ID
    NO: 215) NO: 216)
    19 AGLKM R Q QSC NTW DEI IgE
    (SEQ ID
    NO: 217)
    20 D G D KN L LF- P K V A IgE
    21 P S I- I LR- CI IgE
    22 EDKW ACLPTV D- ASLPM- D- IgE
    (SEQ ID WY- (SEQ ID
    NO: 218) (SEQ ID NO: 220)
    NO: 219)
    23 AP LQF SYLN- E N RK IgE
    (SEQ ID
    NO: 221)
    24 KQ AELFPR- TSFR P EA GK DE IgE
    (SEQ ID (SEQ ID
    NO: 222) NO: 223)
    25 ENV DE IW- RKH R IgE
    26 DE AGE PHV W E- S W IgE
    27 K DE E DE IgE
    28 DKR APSG- QF- CFIKLW- E FIKLW- Q DH- AGILV IgE
    (SEQ ID (SEQ ID (SEQ ID (SEQ ID
    NO: 224) NO: 225) NO: 226) NO: 227)
    29 E RF- L KRQHNGP GILV IgE
    (SEQ ID (SEQ ID
    NO: 228) NO: 229)
    30 LVP LIP IKLPQS- H AS- LIMN GI
    (SEQ ID (SEQ ID
    NO: 230) NO: 231)
    31 D FI- MV- FW R N QR L
    32 V f- DE A A F
    33 KR SA- S VP YF KQH IgE
    34 STP STY GPR- GLV STM WP IVW
    35 I M S A- L AG
    36 AW A PV- K- Q- ST Y- G- V- A A TP IgE
    37 NYD KR L ARV TYAP IgE
    (SEQ ID
    NO: 232)
    38 S P N LR- RV- AR- E G L
    39 L G P RT- HL- E A
    40 ST- APK- YT AG L- AGR IgE
    41 St V- L Yh- P-
    42 RQ R P- H- NQG S P L
    43 T- RI ML S HQ GL YA WC I
    44 PT AGV SA Y W- P- D- RQ- ILVS IgE
    (SEQ ID
    NO: 233)
    45 LVG MD- RN Y- F PH KRD IgE
    46 AGQ HNQGC P R R AVLCY IgE
    (SEQ ID (SEQ ID
    NO: 234) NO: 235)
    47 PS RP N LFQA- AR AILMNV RE AGSYLE LIAGVS
    (SEQ ID (SEQ ID (SEQ ID (SEQ ID
    NO: 236) NO: 237) NO: 238) NO: 239)
    48 GV P P KHQD SHQE
    (SEQ ID (SEQ ID
    NO: 240) NO: 241)
    49 KN Q- TMC WYC- Q Q FP- VP- L W- D
    50 PST STAPLWV W WY- RHD
    (SEQ ID
    NO: 242)
    51 WH TSKHRQG LIRKGP DSRTQG DEKQHT H RKQDT
    (SEQ ID (SEQ ID KH- (SEQ (SEQ ID (SEQ ID
    NO: 243) NO: 244) ID NO: NO: 246) NO: 247)
    245)
    52 Q DNT- W R STRE- A FW
    (SEQ ID
    NO: 248)
  • Example 10
  • For this example the third-generation epitope sequences were determined in further 11 environmental allergens (Bosd2, Equc1, Gald4-mutant (with alanine substituted for glycine in position 102), Hevb8, Profillin1-AC, Profillin1-AT, Profillin2-AC, Profillin-birch pollen, Rag weed pollen5 and Vesv5), based on their structures sequences (SEQ ID NOS: 12, 13, 15, 16, 17, 18, 19, 20, 21 and 22, respectively), their structures (1bj7.pdb, 1ew3.pdb, 1flu.pdb, 1g5u.pdb, 1prq.pdb, 1a0k.pdb, 1f2k.pdb, 1cqa.pdb, 1bbg.pdb, and 1qnx.pdb, respectively), and computer modelling of the epitope patterns that had been assembled in our database (shown in Table 8). Further, the epitope sequences of the four environmental allergens of example 9, Bet v1, Der f2, Der p2, and Phl p2, were redetermined.
  • The additional allergens arise from common sources of allergy: cows (Bos d2 which is a bovine member of the lipocalin family of allergens), horses (Equ C 1, a major horse allergen aslo of the lipocalin family), Hen egg white (Lysozyme Gal D 4), Latex (Hev b8, a profilin from Hevea Brasiliensis), Acanthamoeba castellani (Profilin1-AC, a profilin isoform IA and Profilin2-AC, a profilin isoform II), Arabidosis thaliana (Profillin1-AT a cytoskeleton profilin), Birch (Profilin-birch pollen (Birch pollen profilin), Rag weed pollen5 (Ragweed pollen allergen V from Ambrosia trifida) and whasp venom (Ves v5 allergen from Vespula vulgaris venom).
  • The protein surface is scanned for epitope patterns matching the given “consensus” sequence of about 6-12 residues. First, residues on the protein surface that match the first residue of the consensus sequence are identified. Within a specified distance from each of these, residues on the protein surface that match the next residue of the consensus sequence are identified. This procedure is repeated for the remaining residues of the consensus sequence. The method is further described under the paragraph “Methods” above and the program can be found in Appendixes.
  • The critical parameters used in this screening included:
      • i) a maximal distance between the alpha-carbon atoms of subsequent amino acids,
      • ii) a minimal accessability of the amino acid of 20 Å2,
      • iii) the largest maximal distance between the most distinct amino acids should be less than 25 Å,
      • iv) the best epitope were taken,
      • v) the homology with the epitope pattern of interest was 100%
  • In this way a number of potential epitopes are identified. The epitopes are sorted according to total surface accessible area, and certain entries removed:
      • a. Epitopes that contain the same protein surface residue more than once. These are artefacts generated by the described algorithm.
      • b. Epitopes which are “too big”, i.e. where a distance between any two residues in the epitope exceeds a given threshold.
  • The epitope sequences found were:
    Bosd2:
    Epi#01
    L65, P155, P156, R17, R40, N37, Y39, R41, T67
    L65, P155, P156, R17, R40, N37, Y39, R41, S52
    L64, P155, P156, R17, R40, N37, Y39, R41, T54
    Epi#02
    T121, K150, S122, R17, P156, Y39, R41, R40
    T121, K150, S122, R17, P156, Y56, R36, V30
    Epi#03
    L128, K130, H92, I7, Y76
    L134, K130, H92, I7, Y76
    L128, K130, H92, I91, Y76
    Epi#04
    R72, Y76, S50, Q73, K71, V69, I45
    K71, Y76, S50, Q73, R72, V69, L80
    K71, Y76, S50, Q73, R72, V69, I42
    Epi#06
    G14, P13, D47, S10, K11, P9
    G14, P13, D47, S10, S94, P9
    G14, P13, D47, C44, S10, P9
    Epi#08
    K71, E49, S50, V69, F82
    K71, E49, S50, V79, F82
    Epi#09
    I7, S10, D8, E95, K119, N96, S122, T121
    S10,I7, D8, E95, K11, N96, S122, T124
    Epi#10
    E15, T54, R41, T67, F55, R17, K119
    E43, T54, R41, T67, F55, R17, K119
    E31, T151, N153, C63, F55, R40, R41
    E31, TI51, N153, C154, F55, R41, R17
    Epi#11
    K26, I145, Q132, E143
    K26, I145, Q132, E137
    K26, I145, Q132, E129
    Epi#12
    Y105, E108
    Y83, E81
    Epi#15
    N153, P156, D152, I149, T121, G120
    R17, P156, D152, I149, T121, G120
    N153, P156, D152, I149, R17, G14
    Epi#18
    R109, I110, G107, Y83, T85, E81, V69
    R109, I110, G107, Y105, T85, E81, V69
    Epi#19
    E43, N46, S50, Q73, R72, K71
    D47, N46, S50, Q73, R72, G75
    E49, N46, S50, Q73, R72, K71
    I45, N46, S50, Q73, R72, K71
    Epi#20
    V30, K28, P34, L57, L65, K58, D59, G32, D27
    V30, K28, P34, L57, L64, K58, D59, G33, D27
    Epi#22
    D8, S10, D47, P13, E15
    D8, S10, D47, P13, E43
    D47, S10, D8, V93, E95
    D8, S10, D47, C48, K71
    Epi#23
    k119, N96, E127, S122, L128, P125
    K150, N147, E146, Y20, F123, P125
    K11, N96, E127, S122, L128, P125
    Epi#24
    E129, K130, E126, P125, S122, L128, Q133
    E126, K130, E129, P125, S122, R17, K119
    E126, K130, E129, P125, T124, L128, Q133
    Epi#25
    R72, K71, I45, D47, N46
    R72, K71, I45, E43, N46
    Epi#27
    D47, E49, E74, K71
    D24, E143, E146, K150
    D47, E43, E15, K119
    Epi#28
    L134, Q133, L128, E126, K130, F123, S122, K150
    Q132, K130, E126, L128, F123, S122, K150
    L65, D59, Q60, K58, E31, L57, G32, D27
    G61, D59, Q60, K58, E31, K28, G32, D27
    Epi#29
    V69, K71, L80, R72, E74
    I45, K71, L80, R72, E74
    G61, Q60, L64, F55, E68
    Epi#30
    G120, N96, S94, H92, K130, L128, P125
    I91, I7, S94, H92, K130, L128, P125
    Epi#33
    K130, F123, P125, S122, K150
    k71, Y76, P9, S10, S94, K119
    Epi#34
    I7, P9, S10, G14, R17, T121, S122
    I45, P13, S10, G14, R41, Y39, P156
    Epi#37
    T67, V69, L80, K71, Y76
    P156, R40, L65, K58, D59
    P155, R40, L65, K58, N153
    Epi#38
    L80, G84, E108, R109, N25, P141, S136
    Epi#39
    E137, R138, P141, G139, L134
    E31, L57, R36, P34, G84, L80
    Epi#40
    R17, G120, T121, K150, S122
    R17, G120, T121, K150, T151
    Epi#41
    P34, Y83, L80, V69, S52
    P34, Y83, L80, V79, S50
    Epi#42
    L128, P125, S122, G120, R17, R41
    L128, P125, S122, G120, R17, R40
    Epi#44
    S10, D47, P9, Y76, S50, V69, T67
    I45, D47, P9, Y76, S50, V69, T67
    Epi#45
    D27, P34, F82, Y105, R109, D106, G107
    D59, P34, F82, Y105, R109, D106, G107
    K58, P34, F82, Y105, R109, D106, G107
    D27, P34, F82, Y105, R109, D106, G84
    Epi#46
    Y39, R41, R40, P155, C63, Q60
    Y20, R17, R40, P155, C63, Q60
    Epi#47
    L128, E126, E129, L134, R138, Q133, N142, P141, S136
    V69, E81, E68, I42, R41, F55, N37, R40, P156
    V69, E43, E15, I42, R41, F55, N37, R40, P156
    S122, E127, E129, L134, R138, Q133, N142, P141, S136
    Epi#48
    E43, D47, P13, P9, V93
    S10, D47, P9, P13, G14
    E43, D47, P13, P9, V90
    E49, D47, P13, P9, V93
    Equc1:
    Epi#02
    L66, N68, A65, F90, S69, Y72, R64, V89
    A65, R64, S31, F28, S112, Y123, R110, V108
    L179, R180, Q178, F177, P143, Y38, R141, V145
    L66, R64, S31, F28, S112, Y123, R110, V125
    L66, N68, A65, F90, S69, Y72, R64, V62
    Epi#03
    K32, A65, I63, Y72
    Epi#05
    G35, A65, S69, T93, G97, R26, S112, Y123
    G35, A65, S69, T93, G97, R26, S112, I25
    Epi#07
    G97, T93, S70, D91, S100, R110, V125, P132, D128
    Epi#08
    K129, D130, F127, V108, F90
    K129, D130, F127, V108, F109
    K129, D130, F127, V125, F136
    K129, D130, F127, V125, F133
    Epi#10
    E48, N53, N80, T77, C83, F177, R175, K172
    E82, N80, N53, T77, C83, F177, G181, R180
    E52, N53, N80, T77, C83, F177, R175, K172
    Epi#11
    F133, K47, I167, Q158, V163, E165
    Epi#12
    Y38, E142
    Y38, E36
    Y139, E142
    Epi#13
    K129, P132, D45, I167, Q158, G161
    R131, P132, D45, I167, K164, G161
    Epi#16
    P87, Y72, R64, S70, S69, D67, A65, N68
    Epi#17
    A65, S31, R64, S34
    Epi#18
    R64, S31, I30, A65, S34, L66, N68, S69
    Epi#19
    E82, N80, C83, Q178, R175, K172
    Epi#22
    D130, P132, D128, Y106, K129
    Epi#23
    D144, K150, E148, P147, S146, E151, K155
    Epi#25
    R160, K159, I156, E151, E148
    Epi#27
    E118, E142, D144, K172
    E36, E142, D144, k172
    Epi#28
    I173, D174, Q178, L179, E85, C83, F177, G181, R180
    I173, D174, Q178, L179, E85, C83, F177, P143, D144
    Epi#29
    G181, Q178, L179, R180, E36
    G181, Q178, L179, R180, E85
    Epi#30
    I30, N27, S112, H119, I121, I25, V23
    Epi#31
    L122, R110, N27, R26, F28, I30, D96
    L124, R110, N27, R26, F28, I30, D96
    Epi#33
    H119, Y38, V62, S34, S31, R64
    Epi#34
    V62, P87, M88, V89, R64, S31, S34
    Epi#37
    P87, V89, L66, R64, D67
    Epi#40
    R64, L66, A65, Y72, S34
    R64, L66, A65, Y72, S69
    Epi#41
    P132, Y106, L101, V89, S100
    P132, Y106, L101, V89, S70
    Epi#44
    V46, R131, D128, P132, Y106, S100, V89, P87
    Epi#45
    K129, P132, F127, Y106, N102, D91, V89
    K129, P132, F127, Y106, N102, D104, G105
    Epi#47
    S146, E148, E152, V23, R26, A24, N27, R110, S112
    V23, E115, E118, N116, R26, F28, N27, R110, S112
    Gald4:
    Epi#01
    L75, N65, P70, R73, R61, N59, Y53, R45, T47
    L75, N65, P70, R68, R61, N59, Y53, R45, T47
    Epi#02
    A90, N77, L75, R73, P70, R61, R68
    A122, R125, Q121, T118, R114, R112
    Epi#04
    R21, Y20, S24, Q121, R125, R128, L129
    R21, Y20, S24, Q121, R125, R128, G126
    Epi#05
    G16, A10, R128, G126, A122, T118, G117
    G4, A10, R128, G126, A122, T118, G117
    Epi#06
    G67, P79, D66, R61, R73, P70
    G67, N65, D66, S72, R73, P70
    G49, N46, D48, R61, R73, P70
    Epi#07
    G71, T69, D66, S72, R73, P70, D48
    G67, T69, D66, S72, R73, P70, D48
    Epi#08
    k1, D87, S86, V2, F38
    K1, D87, S86, V2, F3
    Epi#09
    Epi#10
    E7, A11, R14, A10, C6, F3, R5, R125
    D87, A11, R14, A10, C6, F3, R5, R125
    T47, N46, N44, S36, F34, R114, R112
    D18, A10, R14, A11, C6, F3, R5, R125
    T118, N113, R112, A100, F34, R114, K116
    Epi#11
    L129, I124, Q121, V120, D119
    Epi#12
    Y53, E35
    Epi#15
    R73, P70, D66, I78, A82
    R73, P70, D66, I78, A90
    Epi#17
    A102, S100, R21, S24
    Epi#18
    R112, N113, R114, F34, V109, A107, A102, N103
    N113, R112, R114, F34, V109, A107, N103, S100
    Epi#19
    D18, N19, S24, Q121, R125, L129
    D18, N19, S24, Q121, R125, G126
    Epi#22
    D48, P70, D66, W63, W62
    D66, P70, D48, T69, W62
    D48, P70, D66, W63, K97
    Epi#23
    R45, N44, E35, N39, Q41, A42
    R45, N44, E35, Y53, Q41, A42
    Epi#25
    R128, R125, W123, D119, N27
    R128, R125, W123, D119, V120
    Epi#26
    W62, S72, W63, P79, A82, D87
    W62, S72, W63, P79, G67, D66
    Epi#28
    G117, D119, Q121, I124, E7, C6, F3, A11, R14
    A122, D119, Q121, I124, E7, C6, F3, A11, R14
    Epi#29
    G126, R125, L129, R128, E7
    G16, R14, L129, R128, E7
    Epi#30
    I124, L129, A10, H15, I88, L84
    I124, L129, A11, H15, I88, L84
    Epi#31
    L75, R73, N65, R61, W62, I98, D101
    L75, R73, N74, R61, W62, I98, D101
    Epi#33
    Q41, F38, V2, S86, S85, K1
    Q41, F38, V2, S36, A110, R114
    Epi#34
    W63, W62, T69, G71, R73, S72, P70
    W62, W63, S72, L75, R73, T69, P70
    Epi#36
    A110, A107, A102, S100, K96, A90, A82
    Epi#37
    A10, R128, L129, R14, D18
    A10, R128, L129, K13, N19
    Epi#40
    R128, L129, A11, T89, A90, S85
    R14, L129, A11, T89, A90, S85
    Epi#41
    Y53, L84, S81
    Y53, L84, S86
    Epi#42
    P79, S81, N65, P70, R61, R73
    P79, S81, N65, P70, R61, R68
    Epi#44
    L129, R14, D18, Y20, S24, V120, T118
    L129, R14, D18, Y23, S24, V120, T118
    Epi#46
    L75, R61, R73, P70, N65, G67
    L75, R73, R61, P70, N65, A82
    L75, R61, R68, P70, N65, G67
    Epi#47
    S72, G71, R68, N65, R61, L75, N77, R73, P70
    G67, S72, R68, N65, R61, L75, N77, R73, P70
    Epi#49
    D87, L84, Q41, Q57, Y53, T43, N44
    D87, L84, Q57, Q41, Y53, T43, N46
    D87, L84, Q41, Q57, Y53, T43, N39
    Epi#50
    R73, W62, W63, P79, S81
    R73, W63, W62, S72, P70
    Epi#51
    D18, H15, K13, R14, L129, R125, W123
    Epi#52
    F34, A110, R112, R114, W111, N27, Q121
    F3, A11, E7, R5, W123, D119, Q121
    W123, A122, T118, R114, W111, N27, Q121
    Hevb8:
    Epi#01
    L20, P109, P112, k86, R84, N116, Y125, Q129, T111
    L110, P109, P112, K86, R84, N116, Y125, Q129, T111
    Epi#02
    A48, K43, Q41, F42, T70, Y72, R84, V74
    T21, R19, P109, P112, R84, V74
    A49, K43, Q41, F42, T70, Y72, R84, V74
    Epi#03
    L65, K86, I75, Y72
    Epi#05
    G30, A48, L60, P62, G58, T63, H66, G69
    G58, A61, R84, P112, G113, T111, S89, G88
    G80, A81, F54, P79, G58, T63, H66, G69
    G77, A81, F54, P79, G58, T63, H66, G69
    Epi#06
    G58, P79, D55, S59, K52, P57
    G80, P79, D55, S59, K52, P57
    G77, P79, D55, S59, K52, P57
    Epi#07
    G17, T5, S2, D16, R19, P109, D107
    Epi#08
    K52, D45, S44, A49, H66, F42
    Epi#10
    E78, A81, R96, F54, G58, K52
    D55, A81, R96, F54, G80, K52
    Epi#11
    F54, L60, I83, Q76, V82, E78
    Epi#12
    Y106, E108
    Epi#13
    H66, L65, P62, T63, A61, P57, A81, P79, G58
    H66, L65, P62, T63, A61, P57, A81, P79, G80
    H66, L60, P62, T63, A61, P57, A81, P79, G77
    Epi#15
    R19, P109, D107, I105, K86, G88
    Epi#18
    R19, G17, P109, S89
    Epi#22
    D29, S44, D45, A48, K52
    D29, M51, D55, P79, E56
    D45, M51, D55, P79, E78
    D29, S44, D45, A49, K52
    D45, M51, D55, P79, E56
    D29, M51, D55, P57, E78
    D29, M51, D55, P57, E56
    D45, M51, D55, P57, K52
    D45, M51, D55, P57, E78
    Epi#24
    D55, K52, E56, P79, F54, E78, Q76
    D45, K52, E56, P57, F54, E78, Q76
    Epi#25
    R84, K86, I105, D107, E108
    R96, H28, I26, D29, V3
    Epi#26
    W33, S2, W3, V32, G30, D29
    Epi#27
    D53, E56, D55, K52
    Epi#28
    V32, Q41, K43, E46, K52, F54, P57, D55
    G69, Q41, K43, E46, K52, F54, P57, D55
    Epi#29
    G130, Q99, L127, R96, E78
    L127, Q99, L131, R96, E78
    G98, Q99, L127, R96, E78
    Epi#30
    G69, L67, A49, H66, K71, L65, P62
    G80, M51, A48, H28, Q99, L127, L131
    Epi#33
    Q41, F42, V32, S31, S44, K43
    Q41, F42, V47, S44, A48, K52
    Q41, F42, V47, S44, A49, K52
    Epi#34
    I105, P112, S89, L110, R19, T21, S37
    I105, P112, T111, L20, R19, T21, S37
    Epi#37
    T63, A49, L60, K52, D55
    P62, V74, L60, K52, D45
    P62, A61, L60, K52, D55
    Epi#38
    G77, E78, R96, V82, R84, N116, P112, S89
    Epi#39
    A48, E46, H66, T63, P62, G58, L60
    A49, E46, H66, T63, P62, G58, L60
    Epi#40
    R19, L110, G113, T111, P109, S89
    R19, L110, G113, T111, P112, S89
    Epi#41
    P62, L65, V47, S44
    P109, Y106, L110, S89
    P112, Y106, L110, S8
    Epi#44
    L20, R19, D16, W3, Y6, S2, G17, P109
    L110, R19, D16, W3, Y6, S2, G17, P109
    Epi#45
    K52, P57, F54, R96, D124, L127
    D55, P79, F54, R96, D124, L131
    Epi#47
    I75, G77, E78, V82, R84, N116, P112, S89
    I75, G77, E78, I83, R84, N116, P112, P109
    Epi#48
    E78, Q76, P79, P57, G58
    E78, Q76, P79, P57, G80
    E78, Q76, P79, P57, G77
    Epi#50
    D9, W3, W33, S2, T5
    D16, W3, W33, S2, T5
    Epi#51
    R19, H18, E108, S89, K87, K71, H66
    R19, H18, E108, D107, K87, K71, H66
    Profillin1-AC:
    Epi#01
    L116, N111, P106, K80, K81, N101, S83, Q105, T108
    L116, N111, P106, K80, K81, N101, Y100, Q105, S83
    Epi#02
    T44, N51, P54, R56, T69, Y78, R71, V68
    L24, K93, S92, R75, S76, Y78, R71, R56
    Epi#03
    L24, K93, I121, Y119
    L24, K90, I121, Y119
    Epi#04
    K80, Y100, S83, Q105, K103, N101, G82
    K80, Y100, S83, Q105, K103, T17, G12
    K80, Y100, S83, Q105, K103, T17, G14
    Epi#05
    G34, A33, A36, T38, G64, A63, H66, V68
    G34, A33, S32, T17, G12, T4, S1, Y5
    Epi#06
    A46, N0, D53, R56, A57, P54
    A52, N50, D53, R56, A57, P54
    A72, N50, D53, R56, A57, P54
    A57, P54, D53, S47, Q43, P39
    Epi#07
    G64, T38, D61, S58, R56, A57, P54, D53
    G64, T38, D61, S58, R56, A52, P54, D53
    Epi#08
    K103, E102, G82, V68, H66, F60
    K81, E102, G82, V68, H66, F60
    Epi#09
    L24, S47, D53, A57, V68, R71, L70, R56, N51, N50, R75
    L24, S47, D53, A57, V68, R71, L70, R56, N51, T44, T38
    Epi#10
    D74, N50, N51, T44, F60, R56, R71
    D53, N50, N51, T44, F60, R56, R71
    Epi#11
    F125, K93, I121, Q123, D118
    F125, K90, I121, Q123, D118
    F49, K90, I121, Q123, D118
    Epi#12
    Y119, E114
    Y100, E102
    Epi#13
    A57, R56, P54, T44, A40, P39, A36, G64, Y67
    S58, A57, P54, T44, A40, P39, A36, G64, Y67
    Epi#15
    N51, P54, D53, I55, R56, A57
    R56, P54, D53, I55, T69, A57
    R56, P54, D53, I55, T44, A40
    Epi#16
    Q105, P106, Y100, G14, Q18, S32, A36, A33, D7
    Q105, P106, Y100, G14, Q18, S32, A36, A63, D61
    Epi#17
    A110, S76, R75, S92
    A72, S76, R75, S92
    Epi#18
    N51, N50, R75, S92, L24, S47, T44, P39, N27
    N51, N50, R75, S92, L24, T28, T38, P39, N27
    Epi#22
    D53, S47, D25, L24, K93
    D53, S58, D61, V68, K81
    Epi#23
    K103, N101, E102, S83, Q105, P106
    K103, N101, E102, S83, Q105, A84
    Epi#24
    E114, K115, A110, P106, S83, E102, K103
    D53, G59, A57, P54, R56, L70, K80
    E102, K103, A15, P106, S83, A84, Q105
    Epi#25
    R71, R56, I55, D53, N50
    R71, R56, I55, D53, N51
    Epi#28
    I104, Q105, K103, E102, K81, S83, K80
    G107, Q105, K103, E102, K81, G82, K80
    A84, Q105, K103, E102, K81, S83, K80
    A110, Q105, K103, E102, K81, S83, K80
    Epi#29
    I121, K115, L116, E114
    V112, K115, L116, E114
    Epi#30
    G59, I55, S58, H66, K80, L70, V68
    G59, I55, S58, H66, K80, P106, V99
    Epi#33
    K80, Y78, V68, S58, A57, R56
    K81, Y67, V68, S58, A57, R56
    Epi#34
    I55, P54, S58, V68, R71, Y78, P106
    W29, W2, T4, V11, G12, Y5, S1
    Epi#36
    A63, A36, A33, V11, G14, Y100, S83, Q105, K103, P106, A110, A15
    A63, A36, A33, V11, G14, Y100, T108, Q105, K103, P106, A15, A110
    Epi#37
    A57, R56, L70, R71, Y78
    A57, V68, L70, R56, D53
    Y78, R71, L70, R56, N51
    P54, R56, L70, R71, D73
    T69, R71, L70, R56, D53
    Epi#38
    G82, E102, A84, V99, N101, P106, S83
    Epi#40
    R71, L70, A72, Y78, K80, S83
    R71, L70, G59, T69, K81, S83
    R56, L70, A72, T69, K81, S83
    Epi#41
    P106, Y78, L70, V68, S58
    Epi#42
    P54, S47, N51, R56, R71
    P54, S58, G59, R56, R71
    Epi#44
    S83, Q105, P106, Y78, A110, G107, T108
    V68, R71, D73, Y78, A110, G107, T108
    L70, R71, D73, Y78, A110, V112, T108
    L70, R71, D73, Y78, A110, G107, P106
    Epi#45
    K81, H66, F60, R56, D53, G59
    K80, H66, F60, R56, D53, G59
    D61, H66, F60, R56, D53, G59
    Epi#46
    L70, R71, R56, P54, N51, A52
    L70, R71, R56, P54, N51, A72
    V68, R71, R56, P54, N51, A46
    Y78, R71, R56, P54, G59, A57
    Epi#47
    V68, A57, R56, L70, R71, A52, N51, P54, S58
    S58, A57, R56, L70, R71, A72, N51, P54, S47
    Epi#49
    D25, L24, Q43, Q41, T44, N51
    D25, L24, Q43, Q41, T38, N27
    Epi#50
    D7, W2, W29, S1, T4
    D7, Y5, W2, W29, S1
    Epi#51
    K80, H66, D61, T44, P39, T28, W29
    K80, H66, D61, T38, P39, T28, W29
    Profillin1-AT:
    Epi#01
    P109, P89, K86, R84, N116, Y106, Q114, T111
    Epi#02
    L42, K43, Q45, F66, T63, Y72, R84, V74
    L42, K43, Q45, F66, T63, Y72, R84, V82
    Epi#03
    K96, I127, Y125
    K86, I75, Y72
    Epi#05
    G77, A81, F54, P57, G58, A61, T63, V74
    G58, A61, F59, P57, G77, A81, T97, G80
    G80, A81, F54, P57, G58, A61, T63, Y72
    Epi#06
    G17, P109, D107, T21, K38, P40
    G112, P109, D107, T21, K38, P40
    G88, P89, D107, T21, K38, P40
    Epi#08
    K52, E55, G58, V74, F66
    K51, E55, G58, A61, F59
    Epi#09
    D29, D48, K52, F59, A61, T63
    D29, D48, K51, F59, A61, T63
    Epi#10
    E108, T111, N18, T21, F39, G68, K71
    E108, T111, N18, T21, F105, G112, K86
    Epi#11
    F105, K86, I75, Q76, V82, E78
    F66, K43, I47, Q28, V32, D29
    F59, K52, I47, Q28, V32, D29
    Epi#12
    Y125, E130
    Y125, E128
    Epi#15
    K43 P44, D29, I47, K52, G58
    K43, P44, D48, I47, Q45, G49
    K43, P44, D29, I47, K51, G80
    Epi#20
    K38, P40, F39, L42, K43, D48, G30, D29
    K51, P57, F59, L60, K52, D48, G30, D29
    Epi#22
    D48, P44, D29, V32, W33
    D48, P44, D29, V32, W3
    Epi#24
    D29, K51, E56, P57, F59, E55, Q79
    D48, K52, E55, P57, F59, E56, Q79
    Epi#25
    R121, K95, I83, D53, E55
    R121, K95, I83, E78, V82
    Epi#26
    W33, S2, W3, V32, G30, D29
    Epi#27
    E128, E130, D124, K96
    E130, E128, D124, K95
    Epi#28
    I75, Q76, E78, Q79, P57, K51
    A61, Q76, E78, Q79, P57, K52
    V32, D29, Q99, E130, I127, S129, D124
    V32, D29, Q99, I127, E128, S129, D124
    Epi#29
    V32, Q41, L42, F66, E70
    G69, Q41, L42, F66, E70
    G68, Q41, L42, F66, E70
    Epi#30
    G17, N18, H19, Q114, L117, V15
    G17, M110, H19, Q114, L117, V15
    G113, M110, H19, Q114, L117, V15
    Epi#33
    Q41, F39, P40, S36, A37, K38
    Epi#34
    V74, P62, M73, G88, P89, Y106, T111
    Epi#37
    T111, V15, L117, R121, Y125
    T111, V15, L117, R121, D124
    Epi#39
    A81, E55, P57, G58, L60
    A81, E78, P57, G58, L60
    Epi#40
    R121, L117, G112, Y106, P109, T111
    R121, L117, G112, Y106, P89, T111
    Epi#41
    Y125, L131, S129
    Epi#44
    I75, R84, Y72, A61, G58, P62
    I75, R84, Y72, A61, V74, T63
    Epi#45
    K38, P40, F105, Y106, N18, D14, G17
    K38, P40, F105, Y106, N18, D107, G88
    K38, P40, F105, Y106, N18, D14, V15
    Epi#48
    E16, H19, P109, P89, G88
    E16, H19, P109, P89, G112
    Epi#49
    D124, L131, Q99, Q28, T97, N98
    D124, L131, Q99, Q28, T97, K96
    Epi#50
    D9, Y6, W3, W33, S2
    D9, W3, W33, S2, S5
    D9, W3, W33, V32, S31
    Epi#51
    D14, H19, E108, T111, L117, R121, H10
    D107, H19, E16, Q114, L117, R121, H10
    D14, H19, D107, T21, K38, Q35, W33
    Profillin2-AC:
    Epi#01
    L116, N111, P106, K80, K81, N101, S83, Q105, T108
    L116, N111, P106, K80, K81, N101, S83, Q105, T108
    Epi#02
    T53, N58, S57, R56, T69, Y67, R66, V68
    T53, K50, A52, R56, T69, Y67, R66, V68
    T53, K50, A72, R56, T69, Y67, R66, V68
    Epi#03
    L116, K115, I121, Y119
    Epi#04
    K81, Y100, S83, Q105, K103, T17, G12
    K80, Y100, S83, Q105, K103, A84, G82
    K81, Y100, S83, Q105, K103, T17, G14
    K80, Y100, S83, Q105, K103, N101, I104
    K81, Y100, S83, Q105, K103, A15, G107
    Epi#06
    A54, N47, D25, T28, A36, P39
    A40, N27, D25, T28, A36, P39
    A44, N47, D25, T28, A36, P39
    G34, A33, D7, T31, A36, P39
    A43, N47, D25, T28, A36, P39
    Epi#08
    K103, E102, G82, V68, F60
    K103, E102, G82, V68, F60
    K81, E102, G82, V68, F60
    Epi#10
    T53, N58, R56, S57, F60, R66, K81
    E61, N58, R56, S57, F60, R66, K80
    Epi#11
    F125, K93, I121, Q105, E102
    F125, K93, I121, Q123, D118
    Epi#12
    Y100, E102
    Y119, E114
    Epi#13
    A52, A44, P39, A43, H24, S92, G124, Y119
    A46, A44, P39, A43, H24, S92, G124, Y119
    Epi#15
    K103, P106, D118, I121, K93, G124
    K103, P106, D118, I121, Q105, G107
    K103, P106, D118, I121, Q123, G122
    Epi#16
    Q105, P106, Y78, R71, S57, N58, A54, A44, D51
    Q105, P106, Y78, R71, R56, D51, D74, A52, N47
    Epi#18
    R66, N58, R56, S57, V68, G82, S83, E102, N101
    R66, N58, R56, S57, V68, G82, S83, P106, N101
    Epi#22
    D74, A52, D51, T53, K50
    D25, A44, D51, T53, K50
    D74, A46, D51, T53, K50
    D74, A72, D51, T53, K50
    Epi#23
    K103, N101, E102, S83, Q105, P106
    K103, N101, E102, S83, Q105, A84
    Epi#24
    D74, K81, A84, P106, S83, E102, K103
    D74, K81, E102, P106, T108, A15, K103
    Epi#25
    R66, K81, E102, N101
    Epi#28
    I121, D118, Q105, K103, E102, K81, G82, D74
    G107, D118, Q105, K103, E102, K81, G82, D74
    G122, D118, Q105, K103, E102, K81, G82, D74
    Epi#29
    I121, K115, L116, E114
    V112, K115, L116, E114
    Epi#30
    I55, N47, A44, H24, K93, I121, L116
    I55, N47, A43, H24, K93, I121, L116
    Epi#31
    R56, N58, R66, F60, V68, I55, D51
    R66, N58, R56, F60, V68, I55, D51
    Epi#33
    K115, Y119, P106, S83, A84, K103
    Q123, Y119, P106, S83, A84, K103
    K81, Y67, V68, S57, A54, R56
    K80, Y78, V68, S57, A54, R56
    Epi#34
    W29, W2, T8, V11, G12, 4, S1
    W29, W2, T4, G12, G14, T13, T8
    Epi#37
    T108, V112, L116, K115, Y119
    T108, A110, L116, K115, N111
    T13, V112, L116, K115, D118
    P106, A110, L116, K115, N111
    Epi#38
    G64, E61, A40, V37, N27, P39, S38
    G82, E102, A84, V99, N101, P106, S83
    Epi#39
    A110, E114, T108, P106, G122, L116
    Epi#40
    G14, G12, T17, K103, S83
    R56, A52, T53, A54, S57
    R66, A63, T65, K81, S83
    R56, A72, T53, A54, S57
    R56, G59, T53, A54, S57
    R66, G64, Y67, K81, S83
    Epi#42
    P106, S83, G82, R75, R71
    Epi#44
    S1, Q3, D7, W2, Y5, S32, G12, T8
    S1, Q3, D7, W2, Y5, A30, A36, P39
    S1, Q3, D7, W2, Y5, S32, V11, T8
    S1, Q3, D7, W2, Y5, S32, G12, T4
    S1, Q3, D7, W2, Y5, A30, A33, T31
    S1, Q3, D7, W2, Y5, A30, A36, T28
    S1, Q3, D7, W2, Y5, S32, G12, T13
    S1, Q3, D7, W2, Y5, S32, G34, T31
    Epi#45
    K93, H24, F49, R75, D74, G82
    D25, H24, F49, R75, D74, G82
    Epi#47
    A36, G64, E61, A40, A44, A54, N58, R56, S57
    Epi#50
    D7, Y5, W2, T8, S1
    D7, W2, W29, T28, P39
    Epi#51
    K90, H24, K93, D25, P39, T28, W29
    T91, H24, K93, D25, P39, T28, W29
    Profillin-brich pollen:
    Epi#01
    L124, N118, P114, K88, K73, H68, Y74, R86, T95
    Epi#02
    T113, N118, Q116, P114, R86, V76
    T50, K54, L62, T65, Y74, R86, V84
    Epi#03
    L133, K98, I129, Y127
    Epi#04
    S40, Q43, K45, T50, G32
    S40, Q43, K45, T50, G51
    S40, Q43, K45, T50, I49
    Epi#05
    G82, A81, A83, P59, G60, A63, T65, V76
    G82, A83, A81, P59, G60, A63, H61, V76
    G79, A81, A83, P59, G60, A63, T65, V76
    Epi#06
    G70, P46, D31, T50, K54, P59
    A81, P59, D55, T50, Q47, P46
    G32, P46, D31, T50, K45, P42
    G51, P46, D31, T50, K54, P59
    Epi#08
    A81, E57, G60, A63, H61, F56
    A81, E57, G60, V76, H68, F44
    K54, E57, G60, A63, H61, F56
    Epi#11
    F56, K98, I85, Q78, V84, E122
    F56, K98, I27, Q37, V34, D31
    F56, K97, I85, Q78, V84, E80
    Epi#12
    Y6, E9
    Y127, E122
    Epi#13
    H68, L62, P64, T65, A63, P59, A81, G82, G79
    H61, L62, P64, T65, A63, P59, A81, G79, F56
    H68, L62, P64, T65, A63, P59, A83, G79, G60
    Epi#15
    K45, P46, D31, I49, Q47, G32
    K45, P46, D31, I49, K54, G60
    K45, P46, D31, I49, K54, G82
    K45, P46, D31, I49, T50, G51
    Epi#16
    Q116, P114, Y108, M12, S39, S40, A23, A24, D8
    Q116, P114, Y108, M12, Q37, S40, A23, A24, D8
    R86, P114, Y108, M12, S39, S40, A23, A24, D8
    Epi#22
    D126, L133, D130, Y127, E122
    D130, L124, D126, Y127, E122
    D130, L128, D126, Y127, E122
    Epi#23
    R123, N118, E122, L124, L11, A23
    R123, N118, E122, L124, L11, A36
    R123, N118, E122, L124, L11, A24
    Epi#24
    E109, G90, E110, P114, R86, E80, Q78
    E57, K54, E58, P59, F56, A81, Q78
    E58, G60, E57, P59, F56, E80, Q78
    Epi#25
    R86, K88, I107, E109, E110
    R86, K88, I77, E80, V84
    R86, K88, I107, E109, V112
    Epi#27
    57, E58, D55, K54
    D55, E57, E58, K54
    Epi#28
    V34, D31, Q101, K98, E122, L128, Q131, G132, D130
    I129, D126, Q131, L128, E122, K98, Q101, G100, D130
    I72, H68, Q47, F44, E48, K45, Q43, G70, K73
    I72, H68, Q47, I49, E48, K45, Q43, G71, K73
    Epi#29
    I129, Q101, L128, R123, E122
    G132, Q131, L128, R123, E122
    Epi#30
    I77, M75, A63, H61, P59, L62, P64
    G90, M75, A63, H61, K54, L62, P64
    Epi#33
    Q116, Y108, P111, S91, K89
    K88, Y108, P111, S91, K8
    Epi#34
    V76, P64, M75, L62, G51, T50, P46
    I27, W35, S33, V34, G32, T50, P46
    V76, P64, T65, L62, G51, T50, P46
    Epi#35
    A24, L22, A23, S39, M12, I107
    A23, L11, A36, S39, M12, I10
    Epi#37
    Y127, R123, L124, K97, N118
    Y108, A23, L11, R123, Y127
    A23, A24, L11, R123, Y127
    Epi#39
    A81, E57, H61, T65, P64, G60, L62
    A81, E58, H61, T65, P64, G60, L62
    Epi#40
    R123, L11, A23, Y108, P111, S91
    R123, L11, A24, Y108, P111, T113
    Epi#41
    P111, Y108, L22, V112, S91
    P114, Y108, L22, V112, S91
    Epi#43
    I27, W35, A36, L11, Q37, S39, M12, I107, T95
    Epi#44
    I77, R86, P114, Y108, S91, V112, P111
    V120, Q116, P114, Y108, S91, V112, P111
    L22, Q116, P114, Y108, S91, V112, T113
    L22, Q116, P114, Y108, A23, V112, P111
    Epi#47
    I129 Y127, E122, M119, R123, L124, N118, R86, P114
    L133, Y127, E122, M119, R123, L124, N118, R86, P114
    Epi#48
    E122, Q116, P114, P111, V112
    S91, K88, P114, P111, V112
    Epi#50
    H10, Y6, W3, S2, T5
    H10, Y6, W3, T5, S39
    Epi#51
    K73, H68, K45, Q47, P46, S33, W35
    Q101, H30, D31, T50, K45, Q47, H68
    Rag weed pollen5:
    Epi#03
    L4, K37, A33, I34, Y17
    L4, K37, A33, I34, Y29
    Epi#05
    A33, N36, T40, G3, S20, L4
    A33, N38, T40, G3, S20, Y25
    A33, N36, G3, T40, S20, I22
    Epi#06
    A33, N36, D2, C19, K24, P21
    A33, N38, D2, S20, K24, P21
    Epi#09
    I22, L4, D2, N38, D1, K37, A33, N36, T40
    T9, G15, E7, V14, D30, K32, N36, T40, L4
    T9, G15, E7, V14, D30, K32, N38, N36, L4
    Epi#12
    Y17, E7
    Y6, E7
    Epi#20
    V27, K24, P21, L4, K37, D2, G3, D1
    V27, K24, P21, L4, N36, D2, G3, D1
    Epi#22
    D1, D2, L4, K37
    D1, D2, P21, K24
    D2, L4, T40, D1
    Epi#23
    N10, E7, Y6, L4, P21
    Epi#25
    K32, I34, D30, V14
    K37, I34, D30, V14
    K16, I34, D30, V14
    Epi#33
    K32, Y17, V27, S20, K24
    K16, Y6, P21, S20, K24
    Epi#34
    I22, P21, S20, V27, G12, Y17, T9
    I22, P21, S20, V27, G12, Y29, S31
    Epi#40
    G12, G15, Y29, K37, T40
    G15, G12, Y17, K16, T9
    G12, G15, Y29, K32, S31
    Epi#41
    P21, Y6, L4, S20
    Epi#44
    L4, D2, P21, Y25, S20, V27, T40
    L4, D2, P21, Y25, S20, G3, T40
    Vesv5:
    Epi#01
    L59, P67, P65, K143, K144, N64, Y140, R62, T61
    L59, P67, P70, R57, K204, N73, Y201, Q202, T203
    L59, P67, P69, R57, K72, N73, Y201, Q202, T203
    L152, N149, P142, K145, K143, N64, Y140, R62, T61
    Epi#02
    L9, K7, Q108, P191, Y107, R102, V13
    L9, K7, Q108, S192, Y107, R102, V13
    Epi#03
    L9, K7, A105, I6, Y3
    Epi#04
    K106, Y107, S192, Q108, K7, A105, I6
    K106, Y107, S192, Q108, K7, V13, G12
    Epi#05
    G58, A56, R57, P69, G66, R62, T61, L59
    G58, A56, R57, P69, G63, R62, T61, L59
    Epi#06
    G66, N64, D139, R62, K138, P67
    G66, N64, D139, R62, K138, P65
    G63, N64, D139, R62, K138, P67
    Epi#08
    K145, E199, S147, F151
    K196, E198, S147, F151
    K144, E199, S147, F151
    Epi#09
    L152, D150, S147, K144, N64, T61, L59
    L152, D150, D139, K153, F151, S147, N197
    D139, N64, R62, D135, K153, F151, S147, N197
    Epi#10
    E199, N197, N194, S147, F151, G148, K143
    E199, N197, N194, S147, F151, G148, K196
    E199, N197, N194, S147, F151, G148, K145
    Epi#11
    K179, I176, Q177, V30, E178
    K29, I176, Q177, V30, E178
    Epi#12
    Y201, E199
    Epi#13
    S147, L200, P142, T203, A56, P70, L59, P67, G66
    S147, L200, P142, T203, A56, P69, L59, P67, G58
    S147, L200, P142, T203, A56, P70, L59, P67, G63
    S147, L200, P142, T203, A56, P69, L59, P67, Y140
    Epi#15
    K106, P191, D103, I6, K5, A105
    K106, P191, D103, I6, K7, G12
    Epi#16
    R57, P70, Y201, M74, Q53, N76, D50, A56, N73
    R57, P69, Y201, M74, Q53, N76, D50, A56, N73
    Q108, P191, Y107, R102, Q111, S192, D103, A105, N2
    Epi#18
    R57, L59, T61, P67, N64
    R57, L59, T61, P65, N64
    Epi#19
    E167, N164, S192, Q108, R102, K7
    E198, N194, S192, Q108, R102, K7
    D103, T100, C8, Q108, R102, K7
    Epi#22
    L9, D103, T100, K10
    A105, D103, L9, K7
    D50, L45, D43, T37, K38
    S147, D150, L152, K153
    Epi#23
    K196, N197, E199, N164, Q202, P70
    K145, N197, E199, N164, Q202, P69
    Epi#24
    E198, K196, E199, P142, T203, P69, K143
    E198, K145, E199, P142, T203, P70, K204
    E198, K196, E199, P142, T203, P70, K72
    E198, K145, E199, P142, F146, F151, K196
    Epi#25
    R57, K54, D50, N76
    R57, K54, D50, E47
    Epi#27
    D43, E40, D125, K122
    D50, E47, D43, K38
    Epi#28
    Q202, E199, K196, F151, S147, K144
    Q202, E199, K196, F195, S147, K145
    Epi#29
    G58, R57, L59, R62, E136
    G148, K145, L200, F195, E199
    G148, K145, L200, F195, E198
    Epi#33
    K23, Y19, P24, S21, A16, K18
    K23, Y34, P24, S21, A16, R102
    Epi#34
    I176, W180, T116, L115, G117, T119, S118
    V31, P24, S21, L22, G35, Y34, T37
    Epi#37
    P69, R57, L59, K54, D50
    P70, R57, L59, R62, D135
    A56, R57, L59, R62, N64
    P69, R57, L59, R62, D139
    Epi#39
    E199, L200, T203, P70, G58, L59
    E198, L200, T203, P69, G58, L59
    Epi#40
    R57, L59, G58, T203, P69, T61
    R57, L59, A56, Y201, K204, T203
    R57, L59, A56, Y201, K72, T203
    Epi#41
    P24, Y19, L22, S21
    P24, Y34, L36, S33
    Epi#42
    P191, S192, Q111, H98, R102, Q108
    Epi#44
    L59, R57, P70, Y201, A56, G58, T61
    L59, R57, P69, Y201, A56, G58, T203
    L59, R57, P70, Y201, A56, G58, P67
    Epi#45
    K153, H156, F151, Y140, N149, D150, L152
    D135, H156, F151, Y140, N141, D150, L152
    K143, P142, F146, Y140, N149, D150, L152
    Epi#47
    G58, L59, R57, M74, A56, Q202, N73, P70, P69
    G148, Y140, R62, L59, R57, A56, N73, P70, P67
    G66, G63, R62, L59, R57, A56, N73, P70, P67
    G155, E136, R62, L59, R57, A56, N73, P70, P67
    Epi#48
    Q202, K204, P69, P67, G58
    Q202, K204, P70, P67, G63
    Q202, K72, P70, P67, G66
    Epi#49
    D125, D43, L45, V78, Q42, Q39, T37, K38
    D125, D43, L45, V78, Q42, Q39, T37, K41
    Epi#50
    H98, Y96, W90, L22, S21
    H98, Y96, W90, P24, S33
    Epi#52
    F0, A16, R102, W90, N25, Q95
    F0, A16, R102, W90, N25, Q93
    Betv1:
    Epi#03
    SAS: 270, Size 11.07: L24, K20, H76, I23, Y81
    SAS: 204, Size 11.96: L24, K20, A16, I23, Y81
    Epi#05
    SAS: 298, Size 14.01: G110, A106, A16, P14, G111, T10
    SAS: 242, Size 14.01: G110, A106, A16, P14, G111, T107
    Epi#08
    SAS: 464, Size 11.12: K123, E127, G1, H121, F3
    SAS: 455, Size 12.95: K129, E127, G1, H121, F3
    SAS: 438, Size 13.31: K123, D125, G1, H121, F3
    SAS: 428, Size 11.12: K123, E127, V2, H121, F3
    SAS: 425, Size 11.65: K123, E127, G124, H121, F3
    Epi#09
    SAS: 466, Size 20.55: D109, A106, V105, K80, A16, T77
    SAS: 444, Size 20.55: D109, G110, V105, K80, A16, T77
    SAS: 427, Size 20.55: D109, G111, V105, K80, A16, T77
    SAS: 398, Size 19.17: T10, G110, V105, K80, A16, T77
    SAS: 381, Size 19.17: T10, G111, V105, K80, A16, T77
    Epi#10
    SAS: 558, Size 15.18: D75, T77, N78, A106, F79, R17, K20
    SAS: 549, Size 21.96: E6, T7, N4, F3, G1, K123
    SAS: 517, Size 13.31: D75, T77, N78, A16, F79, R17, K20
    SAS: 497, Size 15.13: D75, T77, N78, A16, F22, R17, K20
    Epi#12
    SAS: 335, Size 9.08: T7, Y5, E6, N4
    SAS: 331, Size 11.28: R145, Y150, E148, L152
    SAS: 326, Size 10.37: R70, Y83, E73, P50
    SAS: 311, Size 10.32: I116, Y5, E6, N4
    SAS: 308, Size 8.33: R145, Y150, E148, S149
    Epi#18
    SAS: 328, Size 24.67: S117, K103, F79, V105, A16, Y158, L24
    Epi#22
    SAS: 533, Size 9.96: D125, D93, K123, E127
    SAS: 533, Size 9.96: D93, D125, K123, E127
    SAS: 476, Size 11.40: D125, D93, K123, E96
    SAS: 476, Size 11.40: D93, D125, K123, E96
    SAS: 400, Size 17.99: D125, D93, P90, E87
    Epi#23
    SAS: 451, Size 22.02: K68, N43, E42, S57, F64, P63
    SAS: 450, Size 22.02: K55, N43, E42, S57, F64, P63
    SAS: 428, Size 22.02: K68, N43, E42, S57, L62, P63
    SAS: 427, Size 22.02: K55, N43, E42, S57, L62, P63
    SAS: 412, Size 18.85: K68, N43, E42, S40, F30, P35
    Epi#24
    SAS: 734, Size 18.92: E127, K123, E96, P90, S136, E131, K129
    SAS: 729, Size 18.92: D93, K123, E96, P90, S136, E131, K129
    SAS: 716, Size 19.57: E127, K123, E96, P90, S136, E131, K134
    SAS: 711, Size 19.57: D93, K123, E96, P90, S136, E131, K134
    SAS: 708, Size 20.49: D125, K123, E96, P90, S136, E131, K129
    Epi#25
    SAS: 467, Size 12.68: R70, K55, I44, E42, E45
    SAS: 425, Size 12.68: R70, K54, I44, E42, E45
    SAS: 420, Size 14.01: R70, K55, I44, D27, E42
    Epi#27
    SAS: 613, Size 14.25: D93, E127, A130, E131, K129
    SAS: 595, Size 16.54: D93, E127, A130, E131, K134
    SAS: 592, Size 16.70: D125, E127, A130, E131, K129
    SAS: 574, Size 19.79: D125, E127, A130, E131, K134
    SAS: 524, Size 18.78: D93, E127, A130, E131, K137
    Epi#28
    SAS: 869, Size 21.93: V33, Q36, F58, E60, L62, F64, P63, K65
    SAS: 837, Size 21.83: V33, Q36, F58, E60, L62, F64, G61, K65
    SAS: 808, Size 24.56: V33, Q36, F58, E60, L62, F64, P90, K65
    SAS: 783, Size 21.83: V33, Q36, F58, E60, K65, F64, S57, K68
    SAS: 782, Size 21.83: V33, Q36, F58, E60, L62, F64, S57, K65
    Epi#29
    SAS: 516, Size 9.52: G61, K65, L62, E60
    SAS: 440, Size 8.7: G61, P63, L62, E60
    SAS: 371, Size 6.78: G61, P59, L62, E60
    Epi#32
    SAS: 374, Size 17.88: F79, A16, A106, D109, V12
    SAS: 354, Size 20.42: F22, A16, A106, D109, V12
    Epi#33
    SAS: 541, Size 18.79: K65, F64, P90, S136, A135, K134
    SAS: 498, Size 9.15: Q36, F30, P35, S39, K32
    SAS: 496, Size 11.27: Q36, F30, P35, S40, K32
    SAS: 494, Size 12.19: Q36, F58, P35, S39, K32
    SAS: 493, Size 18.79: K65, Y66, P90, S136, A135, K134
    Epi#36
    SAS: 447, Size 19.17: T77, A16, A106, V12, G110, T10
    SAS: 430, Size 19.17: T77, A16, A106, V12, G111, T10
    SAS: 392, Size 19.17: T77, A16, A106, V105, G110, T10
    SAS: 391, Size 19.17: T77, A16, A106, V12, G110, T107
    SAS: 375, Size 19.17: T77, A16, A106, V105, G111, T10
    Epi#40
    SAS: 246, Size 21.55: A106, A16, Y158, S155
    SAS: 223, Size 13.25: A135, A130, Y5, T7
    SAS: 196, Size 14.88: A135, A130, Y5, S117
    SAS: 178, Size 10.62: A135, G140, T142, S136
    Epi#44
    SAS: 530, Size 19.04: L24, R17, D156, Y150, S149, V12, T10
    SAS: 492, Size 19.04: I23, R17, D156, Y150, S149, V12, T10
    SAS: 490, Size 17.39: L24, R17, D156, Y150, S149, V12, P14
    SAS: 483, Size 23.09: L24, R17, D156, Y158, A16, A106, P108
    SAS: 474, Size 20.83: L24, R17, D156, Y150, S149, V12, T107
    Epi#45
    SAS: 606, Size 21.41: K32, P35, F30, Y150, R145, V12
    SAS: 546, Size 20.89: K32, P31, F30, Y150, R145, V12
    SAS: 533, Size 15.19: K32, P35, F30, Y150, R145, G140
    SAS: 533, Size 12.63: K32, P35, F30, Y150, R145, V33
    SAS: 532, Size 19.60: K32, P35, F30, N28, D27, I44
    Epi#47
    SAS: 333, Size 21.03: R17, L24, N28, P31, P35
    SAS: 300, Size 22.72: R17, L24, N28, P31, S39
    SAS: 298, Size 21.80: R17, L24, N28, P31, S40
    SAS: 269, Size 24.87: R17, L24, N28, P31, S57
    Epi#48
    SAS: 436, Size 14.26: S57, K65, P90, P63, G61
    SAS: 414, Size 17.96: S39, K32, P35, P59, G61
    SAS: 412, Size 17.96: S40, K32, P35, P59, G61
    SAS: 389, Size 18.32: S57, K65, P63, P90, G92
    SAS: 365, Size 21.15: S57, K65, P59, P35, V33
    “SAS” is solvent accessible surface. “Size” is
    the total suface area of the epitope in Å2.
    Derf2:
    Epi#02
    A98, K100, S101, P99, R128, R31
    A98, K100, R128, P99, R31, V94
    T91, N93, P95, P34, R31, R128
    L61, N93, P95, P34, R31, R128
    Epi#03
    L40, K15, A39, I13, Y86
    L40, K14, A39, I88, Y90
    Epi#05
    G32, A98, R31, P34, G20, T36, T91, Y90
    G32, A98, R31, P34, G20, T36, T91, V94
    G32, A98, R31, P34, G20, T36, T91, L37
    G32, A98, R31, P34, G20, T36, T91, V18
    Epi#06
    A98, P99, D129, R31, K96, P95
    G32, P99, D129, R128, R31, P95
    A98, P99, D129, R31, K33, P95
    A98, P99, D129, R31, K96, P34
    A98, P99, D129, R128, K126, P26
    Epi#07
    T107, S57, D59, S101, R128, A98, P99, D129
    T107, S57, D59, S101, R31, A98, P99, D129
    Epi#08
    K15, D87, V76, H74, F75
    K14, D87, V76, H74, F75
    K77, D87, V76, H74, F75
    Epi#09
    L61, D64, I68, H74, F75, T70, N71
    N114, N46, D113, K48, N71, T70, T49
    G83, N46, D113, K48, N71, T70, T49
    Epi#10
    L40, I13, D42, N44, V81, K48, N46, N114, G115
    L40, I13, D42, N44, V81, K82, N46, N114, G115
    L37, D19, G20, V18, V3, D4, K6, A120, T107, V105
    Epi#11
    F75, K51, I111, Q45, V116, D113
    F75, K51, I111, Q45, V81, D113
    Epi#12
    Y90, E38
    Epi#13
    H30, R31, P95, A98, P99, S101, G60, L61
    Epi#15
    K96, P99, D129, I28, R128, A98
    K96, P99, D129, I127, R128, A98
    K96, P99, D129, I29, R128, A98
    K55, P66, D64, I68, T70, G67
    Epi#18
    R31, R128, I28, G125, T123, H124, V105
    R31, R128, I127, G125, T123, H124, V105
    Epi#22
    D1, M17, D4, V3, K6
    D1, M17, D19, P34, K96
    D1, M17, D4, V5, K6
    Epi#23
    K14, N11, E12, N44, Q85, P79
    K14, N11, E12, N10, Q45, P79
    K14, N11, E12, N44, Q84, P79
    K14, N11, E12, L40, Q85, P79
    Epi#24
    D129, K100, E102, P99, R128, R31, K96
    E62, G60, E102, P99, R128, R31, K96
    D129, K126, E102, P99, R128, R31, K33
    D129, K126, E102, P99, R31, P95, K96
    Epi#25
    R31, K96, I97, D59, E62
    R128, R31, I97, D59, E102
    R128, K126, I127, E102, N103
    Epi#27
    D64, E62, D59, K100
    D59, E62, D64, 55
    D87, E38, D19, K33
    D19, E38, D87, K15
    D19, E38, D87, K14
    D19, E38, D87, K77
    Epi#28
    V16, D87, Q85, K14, E12, K15, Q2, D1
    I13, D87, Q85, K14, E12, K15, Q2, D1
    V3, D1, Q2, K15, E12, K14, Q85, D87
    L40, D87, Q85, K14, E12, K15, Q2, D1
    I88, D87, Q85, K14, E12, K15, Q2, D1
    V76, D87, Q85, K14, E12, K15, Q2, D1
    V18, D1, Q2, K15, E12, K14, Q85, D87
    Epi#29
    G32, N93, L61, E62
    V94, N93, L61, E62
    Epi#30
    G60, 197, A98, H30, K96, P34, P95
    I68, N71, H74, K77, P79, V81
    G32, I97, A98, H30, K96, P95, P34
    Epi#34
    V105, P26, S24, G125, R128, S101, P99
    W92, P34, T91, V94, R31, S101, P99
    I28, P26, T123, G125, R128, S101, P99
    Epi#37
    A120, V16, L40, K14, N11
    A39, V16, L40, K14, N11
    Y90, A39, L40, K14, N11
    Y86, A39, L40, K14, N11
    Epi#39
    A120, E38, T91, P34, G20, L37
    A39, E38, T91, P34, G20, L37
    Epi#40
    G20, L37, A120, T123, K6, S24
    A39, L37, A120, T123, K6, S24
    G20, L37, A120, T107, K6, T123
    Epi#41
    P34, L37, V106, S57
    Epi#42
    P26, S24, G125, R128, R31
    P99, S101, G125, R128, R31
    Epi#44
    V16, Q2, D19, P34, W92, Y90, A39, V18, T91
    V16, Q2, D19, P34, W92, Y90, A39, V5, T123
    V3, Q2, D19, P34, W92, Y90, A39, V18, T91
    Epi#45
    K77, H74, F75, N71, D69, G67
    K77, H74, F75, N71, D69, V76
    K77, H74, F75, N71, D69, V65
    Epi#46
    A98, R128, R31, P95, N93, G32
    A98, R128, R31, P34, G20, Q2
    Epi#48
    Q2, D19, P34, P95, G32
    H30, K96, P95, P34, G20
    Epi#49
    D87, D42, L40, Q85, Q84, C78, T47, Q45, K48
    D87, D42, L40, Q85, Q84, C78, T47, Q45, K82
    Epi#50
    D19, W92, P34, T91
    D19, W92, P34, P95
    D19, W92, T91, T36
    Epi#51
    D129, H30, K33, R31, R128, K126, H124
    R31, H30, D129, R128, K100, K126, H124
    T123, H124, K126, R128, R31, K33, H30
    Derp2:
    Epi#03
    L17, K89, A39, I13, Y86
    L17, K89, A72, I88, Y90
    L17, K89, A72, I52, Y90
    Epi#04
    K15, S1, Q2, K14, V16, L17
    K15, S1, Q2, K14, A39, L17
    K15, S1, Q2, K14, V40, I13
    Epi#05
    G60, A56, L61, P99, G32, R31, H30, I97
    G60, A56, L61, P99, G32, R31, H30, I28
    Epi#06
    G60, A56, D64, S57, K55, P66
    G83, N46, D114, T49, K48, P79
    G60, N103, D59, S101, R31, P95
    Epi#08
    K55, D64, S57, V106, F35
    K55, E62, S57, V106, F35
    Epi#09
    L61, G60, E102, R128, I28, K126, N103, T123, V105
    L61, G60, E102, R128, I127, K100, N103, T123, V105
    L61, G60, E102, R128, I127, H124, N103, T123, V105
    Epi#10
    SAS: 435, Size 24.47: D69, T91, N93, F35, G32, R31
    SAS: 422, Size 20.74: E38, T91, N93, F35, G32, K96
    Epi#11
    K14, I13, Q85, V81, E42
    K15, I13, Q85, V81, E42
    K14, I13, Q85, V40, D87
    Epi#12
    Y86, E42
    Y90, E53
    Y90, E38
    Epi#13
    H30, A125, P26, T123, A122, P19, L37, P34, W92
    H30, A125, P26, T123, A122, H124, S24, G23, G20
    H30, A125, P26, T123, A122, P19, L17, G20, F35
    Epi#15
    K55, P66, D69, I68, K89, A72
    K55, P66, D69, I68, K89, A39
    K55, P66, D64, I54, K109, G115
    K55, P66, D64, I54, K109, A9
    Epi#18
    R31, I29, A125, S101, E102, N103
    R31, I29, A125, S101, E102, V104
    R31, I29, A125, T123, A122, V105
    Epi#22
    D69, P66, D64, V65, K55
    D64, P66, D69, T91, K89
    D59, L61, D64, P66,W92
    D59, L61, D64, V65, E62
    D69, P66, D64, V65, E53
    Epi#24
    D64, K55, E62, P99, R31, P34, K96
    E53, K55, E62, P99, R31, P95, K96
    D64, K55, E62, P99, R31, A98, K96
    Epi#25
    R31, H30, I28, E102, N103
    R128, K126, I127, E102, N103
    R128, K126, I28, E102, V105
    Epi#27
    D64, E53, D69, K89
    D69, E53, D64, K55
    D59, E62, D64, K55
    Epi#28
    V40, D87, Q85, E42, Q84, G83, K82
    G20, H22, Q2, L17, E38, L37, Q36, P34, K33
    G20, H22, Q2, L17, E38, L37, F35, P34, K33
    Epi#29
    I97, K100, L61, E62
    G60, N103, L61, E62
    I127, N103, L61, E62
    Epi#30
    G60, N103, S101, H30, K96, I97, P95
    G60, N103, A125, H30, K96, I97, P95
    I28, I127, A125, H30, K96, I97, P95
    Epi#33
    Q36, F35, V106, S57, A56, K55
    K33, F35, V106, S57, A56, K55
    Epi#34
    I28, P26, S24, G23, G20, T123, S57
    I28, P26, S24, V3, G20, T123, T107
    W92, P34, T91, V18, G20, T123, P26
    Epi#37
    P66, V63, L61, K100, N103
    P95, A98, L61, K100, N103
    P19, V18, L17, K89, D87
    P19, V3, L17, K89, D87
    T123, V104, L61, K100, N103
    Epi#38
    L61, G60, E102, A125, V105, N103, P99, S57
    L61, G60, E62, A56, V105, N103, P99, S57
    Epi#39
    A125, E102, H124, T123, P26, G20, L17
    Epi#40
    G60, L61, A56, T107, K6, T123
    A39, L17, G20, T123, P26, S24
    G60, L61, A56, T107, K55, S57
    G60, L61, A56, T123, K126, S101
    Epi#41
    P19, L17, V3, S1
    P19, L17, V5, S24
    Epi#44
    V65, D64, P66, W92, Y90, A39, V18, P19
    L61, D64, P66, W92, Y90, A39, V18, T91
    Epi#45
    R31, P34, F35, N93, V94
    K96, P34, F35, N93, G32
    Epi#47
    I127, S101, R31, I97, A98, L61, N103, P99, P95
    I28, S101, R31, I97, A98, L61, N103, P99, S57
    Epi#48
    H30, K96, P95, P99, G60
    H30, K96, P34, P19, G20
    H30, K96, P34, P19, V18
    H30, K96, P34, P95, V94
    H30, K96, P34, P19, V3
    E38, K89, P70, P66, V65
    H30, K96, P95, P34, G32
    Q36, K89, P70, P66, V65
    Epi#50
    D69, Y90, W92, P66, P70
    D69, Y90, W92, P34, P95
    D69, Y90, W92, T91, P34
    D69, Y90, W92, V94, P95
    D69, Y90, W92, L37, P19
    Epi#51
    K126, H124, E102, R128, I28, R31, H30
    T123, H124, K126, R128, I28, R31, H30
    D4, H124, K126, R128, I28, R31, H30
    PhIp2:
    Epi#02
    T87, K85, Q61, S38, R34, R67
    T87, K85, Q61, P63, R34, V42
    Epi#03
    K10, A90, I88, Y86
    K10, A18, I88, Y86
    Epi#04
    R34, S38, Q61, K85, T87, I88
    R34, S38, Q61, K85, T87, A90
    Epi#05
    G47, A18, S12, T87, G89, T91, T5, V1
    G73, A29, L69, T27, G50, T53, T45, V42
    G11, A18, L20, T91, G89, A90, T87, I88
    Epi#06
    A93, P94, D79, R34, Q61, P59
    A93, P94, D79, R34, Q61, P83
    A93, P94, D80, R34, Q61, P59
    A93, P94, D79, R34, Q61, P63
    Epi#08
    K10, E9, G11, A18, H16, F54
    K46, E48, G47, A18, H16, F54
    K10, E9, S12, A18, H16, F54
    Epi#09
    L69, T27, G73, N76, R67, V77, D79, R34, A43, T45, V42
    L69, T27, A29, E30, R67, V77, D80, R34, A43, T45, V42
    Epi#10
    D55, A18, N13, S12, F54, G47, K46
    T45, A18, N13, S56, F54, G47, K46
    Epi#09
    L60, S56, E57, D55, K15, N13, S12, G11
    L60, S56, E57, D55, H16, F54, T45, T53
    L60, S56, E57, D55, H16, F54, T45, G47
    Epi#12
    Y86, E84
    Y23, E24
    Epi#18
    N76, R67, F78, V81, A93, Y92, T91, T5, P2, V1
    Epi#19
    D39, W41, S38, Q61, R34, G37
    E40, W41, S38, Q61, R34, A43
    Epi#22
    D79, P94, D80, P83, K85
    D79, P94, D80, P63, K85
    Epi#23
    K10, N13, E14, L60, Q61, P59
    K10, N13, E14, L60, Q61, P83
    K10, N13, E14, L60, Q61, P63
    Epi#24
    E58, K15, E57, P59, S56, E14, Q61
    D55, K15, E57, P59, S56, E58, Q61
    Epi#25
    R34, R67, W41, D39, E40
    Epi#26
    S38, E40, W41, V42, E32, E30
    S38, E40, W41, V42, A43, E32
    Epi#27
    E14, E57, E58, K15
    D55, E14, E84, K85
    Epi#28
    G37, H36, Q61, K85, E84, L60, F54, A43, K46
    G37, H36, Q61, K85, E84, L60, F54, S12, D55
    G37, H36, Q61, K85, E84, L60, F54, S56, D55
    G37, H36, Q61, K85, E84, L60, F54, A43, R67
    G37, H36, Q61, K15, E57, L60, F54, A43, K46
    G37, H36, Q61, K85, E84, L60, F54, S12, K15
    G37, H36, Q61, K85, E84, L60, F54, S56, K15
    G37, H36, Q61, K85, E84, L60, F54, A43, R34
    G37, H36, Q61, K85, E84, L60, F54, A18, D55
    Epi#29
    G73, K72, L69, R67, E30
    I88, N13, L60, F54, E57
    G25, K72, L69, R67, E32
    V77, K75, L69, R67, E30
    G37, H36, L60, F54, E57
    G37, Q61, L60, F54, E57
    Epi#30
    I88, N13, S12, H16, K15, P59, L60
    I88, N13, S56, H16, K15, L60, P59
    I88, N13, A18, H16, K15, P59, L60
    Epi#33
    K46, F54, V42, S56, K15
    H16, F54, V42, S56, K15
    Epi#34
    V1, P2, T5, V4, P94, Y92, T87
    V1, P2, T5, L20, G89, T91, T87
    V81, P94, T5, V1, P2, Y92, T91
    Epi#37
    T27, A29, L69, K72, D26
    A43, R67, L69, K75, N76
    Epi#38
    L20, G89, E9, A18, N13, P59, S56
    Epi#40
    G49, L20, G89, Y86, K85, T87
    G49, L20, G89, T87, K10, S12
    G49, L20, G89, T87, K10, T7
    Epi#44
    V77, R67, D79, P94, Y92, A93, V1, P2
    L69, R67, D79, P94, Y92, A93, V1, T5
    Epi#45
    D79, P94, F78, N76, M74, L69
    D80, P94, F78, R67, D79, V77
    K3, P94, F78, N76, M4, G73
    Epi#46
    A43, R67, R34, P63, H36, Q61
    V77, R67, R34, P63, H36, G37
    L69, R67, R34, P63, G37, Q61
    Epi#47
    G37, E35, E40, A43, R34, L60, N13, P59, S56
    V77, E32, E40, A43, R34, L60, N13, P59, S56
    S38, G37, E40, A43, R34, L60, N13, P59, S56
    Epi#48
    E24, K3, P94, P2, V1
    E84, D80, P94, P2, V1
    Epi#50
    D39, W41, A43, T45
    D39, W41, V42, T45
    Epi#51
    D79, H36, E84, T87, K10, G11, H16
    D39, H36, Q61, K85, P63, R34, W41
    D79, H36, E40, D39, G37, R34, W41
    Q61, H36, E84, T87, K10, G11, H16
  • Example 11
  • For this example a third-generation epitope sequences were determined for some additional enzymes and redetermined for all of the enzymes in example 1-3. New enzymes are AMG (AMG pdb), BPN′ (1sup.pdb), Esperase (structure see Appendix D), Natalase (structure modelling based on SP722), Amylase-AA560 (Structure modelling based on SP722), Protease A, Alcalase, Protease B, ProteaseC, ProteaseD, ProteaseE, Properase and Relase based on their sequences and structures. The structures of Protease B, Properase, Relase, Protease A, Alcalase, ProteaseC, ProteaseD and ProteaseE can be found by “Homology modelling” (see above) and computer modelling of the epiope patterns that had been assembled in our database (shown in Table 8). Furhermore, the epitope sequences were redetermined for CAREZYME, Laccase, PD498, Savinase, Amylase SP722, and Cellulase, according to the method.
  • The protein surface is scanned for epitope patterns matching the given “consensus” sequence of about 6-12 residues. First, residues on the protein surface that match the first residue of the consensus sequence are identified. Within a specified distance from each of these, residues on the protein surface that match the next residue of the consensus sequence are identified. This procedure is repeated for the remaining residues of the consensus sequence. The method is further described under the paragraph “Methods” above and the program can be found in Appendixes.
  • The critical parameters used in this screening included:
      • i) a maximal distance between the alpha-carbon atoms of subsequent amino acids,
      • ii) a minimal accessability of the amino acid of 20 Å2,
      • iii) the largest maximal distance between the most distinct amino acids should be less than 25 Å
      • iv) the best epitope were taken,
      • v) the homology with the epitope pattern of interest was 100%
  • In this way a number of potential epitopes are identified. The epitopes are sorted according to total surface accessible area, and certain entries removed:
      • 1) Epitopes that contain the same protein surface residue more than once. These are artefacts generated by the described algorithm.
      • 2) Epitopes which are “too big”, i.e. where a distance between any two residues in the epitope exceeds a given threshold.
  • The subtilisin sequences and positions mentioned in the following are not given in the BPN′ numeration but in the subtilisins own numeration (see the alignement as described above in Tables 1A and 1B).
  • The epitope sequences found were:
    AMG:
    Epi#01
    L104, P123, P107, R125, R122, N182, S184, Q172, T173
    L104, P107, P123, R125, R122, N182, S184, Q172, S453
    L104, P107, P123, R125, R122, N182, S184, Q172, T452
    Epi#02
    L234, R241, S240, F237, T173, Y175, R122, R125
    L234, R241, S240, F237, T173, Y169, R125, R122
    L234, R241, S240, F237, T173, Y175, R125, R54
    Epi#03
    L291, K404, I288, Y289
    L66, K61, H254, I253, Y329
    Epi#04
    R122, Y175, S184, Q172, Y169, A454, I455
    R122, Y175, S184, Q172, Y169, N171, A451
    R125, Y175, S184, Q172, Y169, T452, A451
    Epi#06
    G31, A24, D25, S30, A27, P41
    G146, N145, D144, T148, S149, P467
    A471, N145, D144, T148, S149, P467
    Epi#07
    G294, T290, S405, D293, S287, R286, P307, D283
    G294, T290, S287, D293, S296, R286, P307, D283
    G207, T204, S200, D214, S209, R160, P157, D153
    G294, T290, S405, D293, S287, R286, P307, D309
    Epi#08
    A27, D25, S30, V111, F49
    A24, D25, S30, V111, F49
    Epi#09
    S149, T148, G146, N145, A471, R68, N69, T72, V470
    S73, S76, T72, N69, R68, A471, N145, T148
    Epi#10
    D238, N182, N236, S240, F237, R241, K244
    D238, T173, N182, S239, F237, R241, K244
    Epi#11
    F49, F109, I91, Q85, E113
    Epi#12
    Y363, E342
    Y311, E308
    Y175, E180
    Epi#13
    S119, W120, P123, A102, P94, S92, G90, L98
    S119, W120, P123, A102, P94, S92, G96, G90
    Epi#15
    K244, P307, D283, I288, T290, G294
    R160, P157, D153, I154, T462, G90
    R286, P307, D283, I288, T290, G294
    Epi#16
    L410, P46, Y48, R413, S397, S394, A392, A393, N395
    R160, P157, Y458, G456, S211, S209, A205, A201, D214
    Epi#17
    A201, S209, R160, S459
    A205, S209, R160, S459
    Epi#19
    D44, N45, S411, Q409, R413, L410
    D47, N45, S411, Q409, R413, L410
    Epi#20
    K61, P434, L66, L423, N427, D65, G70, D71
    Epi#22
    D357, S356, D349, V346, D345
    D349, S356, D357, A359, D345
    D357, S356, D349, L348, D345
    Epi#23
    K404, N292, E299, S298, L295, A300
    K404, N292, E299, S296, L295, A300
    Epi#24
    D336, K337, E259, P258, S431, L332, K378
    D336, K337, E259, P258, S431, R429, K378
    D336, K337, A261, P258, S436, E259, Q338
    Epi#25
    R125, R122, W120, E180, N182
    R241, K244, E308, N313
    Epi#26
    W212, S200, E198, W437, V197, G438, E259
    W212, S200, E198, W437, V197, A201, D214
    Epi#27
    D283, E280, D349, K352
    D403, E408, D406, K404
    D349, E280, D283, K244
    D349, E280, D283, K279
    Epi#28
    L332, D336, Q338, K337, E259, C262, P272, D345
    V374, D336, Q338, K337, E259, C262, P272, D345
    G339, D336, Q338, K337, E259, C262, P272, D345
    Epi#29
    L295, G294, L291, R286, E299
    I288, K404, L291, R286, E299
    L348, K352, L354, F380, E299
    Epi#33
    K352, Y355, V374, S371, S365, K337
    K352, Y355, V374, S365, S340, K337
    Epi#34
    V463, W466, S468, V470, P467, T464, T462
    I469, W466, S468, V470, P467, T464, T462
    I154, W466, S468, V470, P467, T464, T462
    V463, W466, S468, V470, P467, S465, T464
    Epi#37
    T362, A359, L348, K352, D357
    T360, V346, L348, K352, D357
    T362, A359, L348, K352, D349
    Epi#38
    G438, E259, A435, R68, L66, N69, P434, S431
    Epi#39
    A353, E299, R286, P307, G243, L234
    A300, E299, R286, P307, G243, L234
    Epi#40
    A205, L143, G146, Y147, P467, T464
    G146, L143, A205, T204, A201, S209
    A451, A450, T448, P446, S444
    Epi#41
    P467, Y147, L143, V206, S149
    Epi#42
    L66, P434, S431, N430, R429, R428
    L104, P123, S95, G101, P94, R122, R125
    L104, P107, S95, G96, P123, R125, Q172
    Epi#44
    L143, Q140, D144, W141, Y147, S468, V470, T72
    V206, Q140, D144, W141, Y147, S468, V470, P467
    S211, Q216, D214, P218, Y223, A451, A450, T448
    S211, Q216, D214, P218, Y223, A450, G447, T448
    Epi#45
    R413, P46, F49, Y50, N110, D112, G31
    R413, P41, F49, Y50, N110, D33, G31
    D44, P46, F49, Y50, N110, D112, G31
    Epi#46
    Y175, R125, R122, P123, G174, Q172
    Y169, R125, R122, P123, G174, Q172
    V432, R429, R428, P434, N69, G70
    Y175, R125, R122, P94, N93, G90
    Y175, R122, R125, P123, N182, G121
    Y175, R125, R122, P94, G101, A102
    Y175, R125, R122, P94, G118, A115
    Y175, R125, R122, P94, G101, G96
    Y175, R122, R125, P123, N182, G183
    Epi#48
    S211, D214, P218, P446, G447
    E259, K337, P258, P434, V432
    S215, D214, P218, P446, G447
    S209, D214, P218, P446, V445
    E259, K337, P258, P434, V433
    Epi#50
    R122, Y175, W120, T117, S119
    R125, Y175, W120, S119, T117
    Epi#51
    T390, H391, E408, Q409, R413, S411, W317
    T390, H391, E408, S405, I288, K404, W317
    D406, H391, E408, Q409, R413, S411, W317
    T390, H391, E408, D406, K404, Q409, W317
    Epi#52
    W437, A260, T266, R273, W228, D264, Q225
    BPN′:
    Epi#02
    T255, K256, S260, F261, P194, Y262, R186, V203
    L257, K256, S260, F261, P194, Y262, R186, V203
    T253, K256, S260, F261, P194, Y262, R186, V203
    Epi#03
    K141, A137, I108, Y104
    K136, A137, I108, Y104
    K136, A134, I108, Y104
    Epi#04
    K265, Y262, S188, Q185, R186, N184, L257
    k265, Y262, S188, Q185, Y263, R186, L257
    K265, Y262, S188, Q185, R186, N184, G258
    K265, Y262, S188, Q185, Y263, R186, G258
    Epi#05
    G80, A1, N77, P40, G211, S38, S37, V44
    G80, A1, N77, P40, G211, S38, S37, L42
    G127, A152, N155, T164, G160, S158, S188, Y262
    Epi#06
    G211, N212, D36, S37, K43, P40
    G80, N212, D36, S38, K43, P40
    G211, N212, D36, S38, K43, P86
    Epi#08
    K256, D259, S260, F261
    K43, D36, S38, V44, F58
    Epi#09
    S105, S132, A133, A137, D140, K141, A144, S145, N118
    S248, T244, A144, S145, D120, K27, N118, A116, N117
    Epi#10
    E54, T55, N57, S37, F58, G46, K43
    T55, A48, N57, S37, F58, G46, K43
    E54, T55, N57, S49, F58, G46, K43
    Epi#11
    K136, I108, Q103, V51, D98
    Epi#12
    Y171, E195
    Epi#13
    S101, W106, P52, T55, A48, P56, S49, G47, F58
    S105, W106, P52, T55, A48, P56, S49, G47, W113
    Epi#15
    N25, P239, D120, I115, K141, A144
    N240, P239, D120, I115, K141, A144
    Epi#16
    Q271, P14, Y21, G20, Q19, S18, A15, A272, N252
    Q59, P210, Y214, G211, S38, D36, D61, A99, D98
    Epi#17
    A187, S188, R186, S183
    A187, S188, R186, S182
    Epi#18
    N184, R186, S188, G157, S158, T159, S161
    N184, R186, S188, G157, S158, T159, S162
    N184, R186, S188, G157, S158, E156, N155
    N184, R186, S188, G157, S158, E156, F189
    Epi19
    E156, N155, S188, Q185, R186, L257
    E156, N155, S188, Q185, R186, G258
    E156, N155, S188, Q185, R186, A187
    Epi#22
    D197, S260, D259, L257, K256
    D197, S260, D259, Y263, K256
    Epi#23
    N155, E156, S188, Q185, A187
    Epi#24
    E156, G166, E195, P194, S260, L257, K256
    D259, G264, E195, P194, S260, L257, K256
    D197, K170, E195, P194, S260, L257, K256
    Epi#25
    K141, I115, D120, N25
    K141, I115, D120, N118
    K141, I115, E112, N118
    Epi#26
    W113, S49, W106, P52, E54, D98
    W113, S49, W106, P52, E54, D60
    W113, S49, W106, V51, E54, D98
    Epi#28
    A99, D61, Q59, F58, E54, L96, Q103, G102, D98
    A99, D98, Q59, F58, E54, L96, Q103, G100, D61
    A99, D61, Q59, F58, E54, L96, Q103, S101, D98
    Epi#29
    G102, Q103, L96, E54
    G100, Q103, L96, E54
    Epi#30
    I79, N76, S87, H17, S18, P14, V4
    I79, N76, S87, H17, Q19, P14, V4
    Epi#31
    L257, Q185, N184, R186, F189, V203, I205, D181
    L267, Q10, N184, R186, F189, V203, I205, D181
    Epi#33
    K213, Y214, P210, S38, S37, K43
    Q59, F58, V44, S38, S37, K43
    Epi#34
    W106, P52, M50, G47, P56, T55, S53
    W106, P52, S49, G47, P56, T55, S53
    I115, W113, M50, V51, P52, T55, S53
    I108, W106, S105, V51, P52, T55, S53
    Epi#35
    A99, L96, S49, M50, I108
    A99, L96, S49, M50, I107
    Epi#36
    A137, A134, A133, G131, Y104, S105, Q103, V51, A48, W113
    A134, A137, A133, G131, Y104, S101, Q103, V51, A48, W113
    Epi#37
    Y262, R186, L257, K256, D259
    Y263, R186, L257, K256, N252
    Epi#39
    E156, T164, P129, G127, L126
    E156, T164, P129, G128, L126
    E156, T164, P129, G154, L126
    E156, T164, P129, G166, L126
    Epi#40
    R247, L250, A272, T255, K256, S260
    R186, L257, G258, Y263, K256, S260
    G264, L257, G258, T255, K256, S260
    Epi#41
    P194, Y262, L257, S260
    P194, Y263, L257, S260
    Epi#42
    P194, S260, G258, R186, Q185
    Epi#44
    S182, Q185, D181, Y6, S9, V4, P14
    S183, Q185, D181, Y6, S3, V4, P5
    S248, R247, D197, P194, Y262, S260, G258, T255
    S53, P52, W106, Y104, S105, V51, T55
    Epi#45
    K170, P194, F261, Y262, R186, D181, V203
    D197, P194, F261, Y262, R186, D181, V203
    Epi#46
    S162, S158, E156, N155, A187, Q185, N184, R186, S188
    S188, S158, E156, N155, A187, Q185, N184, R186, S183
    S158, S188, E156, N155, A187, Q185, N184, R186, S182
    S161, S158, E156, N155, A187, Q185, N184, R186, S183
    G160, S158, E156, N155, A187, Q185, N184, R186, S188
    Epi#48
    S38, K43, P40, P210, G211
    S37, K43, P86, P14, V4
    S38, K43, P40, P210, G215
    Epi#50
    H238, W241, T242, P239
    H238, W241, T244, T242
    H238, W241, T242, T244
    Epi#51
    T242, H238, Q275, Q271, P14, S18, H17
    Q245, H238, Q275, K237, P239, T242, W241
    Q275, H238, Q245, T242, R247, T244, W241
    Q245, H238, Q275, Q271, P14, Q19, H17
    CAREZYME Core:
    Epi#01
    P61, P165, K164, R158, N154, Y168, R153, S151
    P137, P49, K44, K13, N32, Y54, Q36, T39
    P61, P165, K164, R158, N154, S152, R153, S151
    Epi#02
    L115, N118, S117, R4, T6, Y147, R146, V129
    L115, N118, S5, R4, T6, Y147, R146, V129
    Epi#03
    K44, A43, I38, Y54
    K13, A43, I38, Y54
    Epi#04
    R153, S151, Q145, Y147, R146, I131
    R153, S151, Q145, Y147, R146, G144
    R153, S151, Q145, Y147, R146, L142
    Epi#05
    G3, A1, S183, T95, G101, A100, S96, G97
    G3, A1, F184, T93, G101, T95, S96, G97
    G97, A100, S96, T95, G101, T93, S183, G3
    Epi#06
    G140, P160, D161, R158, K164, P165
    G50, P137, D133, R146, Q145, P143
    A162, P165, D161, R158, K164, P160
    Epi#07
    G148, T6, S181, D178, R170, P165, D58
    G128, T6, S181, D178, R170, P165, D58
    Epi#08
    K44, D42, S45, A43, F41
    Epi#09
    A191, E192, R196, A195, R200, N25, N202, N206
    D161, R158, D157, R153, N176, S151, N154
    Epi#10
    D161, A57, N34, A162, F159, R158, K164
    D2, A1, R185, S183, F184, G3, R4
    Epi#11
    F41, F29, I38, Q36, D58
    Epi#12
    Y168, E155
    Y90, E91
    Epi#13
    A63, W62, P165, T60, A162, P160, L142, G149, Y147
    A63, W62, P165, T60, A162, P160, L142, G128, Y147
    A63, W169, P165, T60, A162, P160, L142, G144, Y147
    Epi#15
    P137, D133, I131, R146, G144
    P137, D133, I131, R146, G148
    P137, D133, I131, R146, G130
    P137, D133, I131, R146, G128
    P137, D133, I131, R146, G149
    Epi#16
    Q138, P137, Y54, R37, Q36, N34, A162, A57, D161
    R170, P165, Y168, R153, S151, N176, D172, A63, D67
    R170, P165, Y168, R153, S151, N176, D172, A63, D66
    Epi#17
    A1, S183, R4, S117
    A100, S181, R4, S183
    A1, S183, R4, S5
    Epi#18
    N118, R4, S181, —, G3, —, S117, L115, —, A78, S80
    N34, N32, R37, F35, —, A33, Y54, S45, —, —, A43, V52
    Epi#19
    D157, N154, S151, Q145, R146, L142
    D178, N176, S151, Q145, R146, G144
    Epi#22
    D40, A43, D42, W18, K20
    D40, A43, D42, A19, K20
    Epi#23
    R158, N154, E155, L142, Q145, P143
    R153, N154, E155, S151, Q145, P143
    Epi#24
    D42, K44, E48, P137, F139, A33, Q36
    D40, K44, E48, P137, F139, A33, Q36
    D161, K164, A162, P160, R158, L142, Q145
    D161, K164, E155, P143, R158, L142, Q145
    Epi#25
    R158, K164, W169, D172, N176
    R4, H119, I77, E82, N81
    Epi#26
    W18, S15, E82, W85, P23, A19, D42
    W18, S15, E82, W85, P23, G84, D203
    Epi#28
    I131, D133, Q138, L142, E155, K164, F159, P165, D161
    I131, D133, Q138, L142, E155, K164, F159, P143, R158
    I131, D133, Q138, L142, E155, K164, F159, P160, R158
    Epi#29
    I131, R146, L142, R158, E155
    G144, Q145, L142, R158, E155
    Epi#30
    G79, N81, A78, H119, S117, I77, L115
    G79, N81, A78, H119, S76, I77, L115
    Epi#31
    L142, R158, N154, R153, W169, F171, D172
    Epi#33
    Q36, F29, P27, S15, A19, K20
    K44, F41, P27, S15, A19, K20
    Epi#34
    V129, P143, S151, G144, R146, Y147, T6
    V129, P143, S151, G148, R146, Y147, T6
    V129, P143, S151, G149, R146, Y147, T6
    Epi#36
    A83, A22, A19, S15, K13, V52, A43, W18
    Epi#37
    Y147, R146, L142, R158, D161
    Y147, R146, L142, R158, N154
    Y147, R146, L142, R158, D157
    Epi#38
    E155, R158, P160, G140, L142
    E155, R158, P143, G144, L142
    Epi#40
    G79, L115, G113, T111, A74, T6
    G79, L115, G113, T111, A74, S15
    G79, L115, G113, T111, A74, S110
    G116, L115, G113, T111, A74, T6
    G79, L115, G113, T111, A74, S76
    Epi#42
    L142, P143, S151, G144, R146, Q145
    L142, P143, S151, G148, R146, Q145
    L142, P143, S151, G149, R146, Q145
    Epi#44
    L142, R158, D161, P165, W62, Y168, S152, G144, P143
    I131, R146, D133, P137, Y54, A33, V52, P49
    L142, R158, D161, P165, W62, Y168, S152, G149, P143
    Epi#45
    R185, P208, F207, N206, D203, V24
    D67, P213, F68, N65, D66, V64
    R185, P208, F207, N206, D204, G205
    Epi#46
    A195, R200, R201, P23, N202, G205
    A191, R200, R201, P23, N202, G205
    V24, R201, R200, P190, Q211, A209
    Epi#47
    A191, A195, E192, V194, R200, N202, R201, P23
    A195, A191, E192, V194, R200, N25, R201, P23
    A191, A195, R196, V194, R200, N202, R201, P23
    Epi#48
    E48, K44, P49, P137, V52
    E48, K44, P49, P137, G50
    E48, K44, P49, P137, G140
    Epi#50
    D172, Y168, W62, V64, P213
    D42, W18, A43, T39
    D67, W173, W62, V64, P213
    D66, W173, W62, V64, P213
    D42, W18, S45, P49
    D172, W169, W62, V64, P213
    Epi#51
    R4, H119, D2, T95, P98, K175, W169
    R4, H119, D2, R185, P208, Q186, W85
    R4, H119, D2, T95, G97, K175, W173
    Epi#52
    W18, A22, R200, R201, W85, Q186
    Esperase:
    Epi#01
    N24, P239, R237, K235, N243, S240, Q245, T242
    N24, P239, K235, R27, N117, Y91, R43, S87
    N24, P239, R237, K235, N243, Y241, Q245, S240
    Epi#02
    T3, N76, L75, R43, S38, Y209, R213, V215
    T3, N76, S87, R43, S38, Y209, R213, V215
    T129, N166, Q161, R160, T156, Y192, R186, V203
    Epi#03
    R186, Y192, S261, Q161, R160, N155, G127
    R186, Y192, S261, Q161, R160, N155, G157
    R186, Y192, S261, Q161, R160, N155, L126
    R186, Y192, S261, Q161, R160, T156, G162
    R186, Y192, S261, Q161, R160, N155, A187
    Epi#05
    G102, A105, S133, T134, G131, R170, T129, Y167
    G102, A105, S133, T134, G131, R170, T129, G127
    G211, A37, R43, P40, G80, T3, S78, I79
    Epi#06
    G211, N61, D97, R98, S53, P55
    G102, N99, D97, R98, S53, P55
    G100, N99, D97, R98, S53, P55
    Epi#07
    211, T210, D60, S38, R43, P86, D89
    Epi#08
    A108, E136, S133, A105, F50
    A108, E136, S132, A105, F50
    A187, D181, S188, V203, F189
    Epi#09
    N212, G211, S38, H59, N61, N99, R98
    S52, S53, R98, N99, N61, G211
    Epi#10
    T129, T156, N155, S188, F189, G157, R160
    D181, N183, R186, S188, F189, G157, R160
    T129, N166, N155, S188, F189, G157, R160
    T129, T156, N155, S218, F189, G157, R160
    D97, N99, N61, S57, F50, G102, R98
    Epi#12
    Y167, E136
    Y192, E195
    Y171, E136
    Epi#13
    S38, R43, P40, A37, H59, S57, P55, Y58
    S38, R43, P40, A37, H59, S57, P55, F50
    S38, R43, P40, A37, H59, S49, P55, Y58
    Epi#15
    N24, P86, D89, I44, R43, A45
    N24, P86, D89, I44, R43, G46
    N76, P86, D89, I44, R43, A45
    N24, P86, D89, I44, R43, A37
    Epi#16
    Q161, P194, Y192, G157, R160, S188, D181, A187, N183
    Q161, P194, Y192, R186, Q185, S188, D181, A187, N183
    Q161, P194, Y192, G162, R160, S188, D181, A187, N155
    Epi#17
    A37, S38, R43, S87
    Epi#18
    N144, N140, R141, L137, S133, T134, E136, S132
    N140, N144, R141, L137, S133, T134, A105, S103
    N143, N144, R141, L137, S133, T134, E136, N140
    Epi#19
    I21, N18, Q15, Q275, R19, G20
    I21, N18, Q15, Q275, R237, G20
    E197, N265, S261, Q161, R160, G162
    E197, N265, S261, Q161, R160, G157
    I21, N18, Q15, Q275, R237, G25
    Epi#23
    R98, N61, E54, S53, F50, P55
    R98, N61, E54, Y58, F50, P55
    R98, N61, E54, S57, F50, P55
    R98, N61, E54, S52, F50, A105
    Epi#24
    E195, G264, E197, P260, S261, P194, Q161
    D89, G46, A48, P55, S52, F50, Q109
    E197, G264, E195, P194, S261, L262, Q161
    Epi#25
    R98, H59, E54, N61
    R98, H59, D60, N61
    R43, H39, I44, D89, N24
    R27, H120, I115, E112, N116
    Epi#28
    L104, Q109, I115, E112, W113, F50, S53, R98
    A105, Q109, I115, E112, W113, F50, G102, R98
    A108, Q109, I115, E112, W113, F50, S53, R98
    V107, Q109, I115, E112, W113, F50, S53, R98
    Epi#29
    I147, N140, L137, R141, E136
    G146, N140, L137, R141, E112
    I115, N143, L137, R141, E136
    G102, N99, L96, R98, E54
    Epi#30
    G211, N212, S38, H59, S57, I51, P55
    G211, N61, S57, H59, S38, P40, L75
    G211, N212, S38, H59, S49, I51, P55
    G211, N212, S38, H59, P55, I51, L96
    Epi#31
    L257, Q185, N183, R186, F189, V203, D181
    L262, Q185, N183, R186, F189, V203, D181
    Epi#33
    H59, Y58, P55, S52, S53, R98
    Q109, F50, P55, S57, S53, R98
    Q109, F50, P55, S49, S53, R98
    Epi#34
    I79, P40, S38, G211, R213, Y209, S216
    I79, P40, S38, G211, R213, Y214, T210
    I51, P55, S49, L96, R98, S53, S52
    Epi#37
    T134, A108, L137, R141, N144
    Y256, A254, L257, R186, N183
    A105, A108, L137, R141, N144
    Epi#38
    L257, G264, E195, L262, N265, P260, S259
    L257, G264, E195, L262, N265, P260, S261
    Epi#39
    E195, R170, P194, G264, L257
    E195, R170, P194, G264, L262
    Epi#40
    R141, L137, A108, T134, A105, S133
    R43, L42, A37, Y58, P55, S52
    R186, L257, A254, Y256, P260, S259
    R186, L262, G258, Y256, P260, S259
    R186, L257, G184, Y256, P260, S259
    R141, L137, A108, T134, A105, S103
    R186, L262, G264, Y256, P260, S259
    R186, L257, A254, Y256, P260, S261
    R186, L262, G258, Y256, P260, S261
    R186, L257, G264, Y256, P260, S261
    Epi#41
    P260, Y256, L257, S259
    Epi#42
    L75, P86, S87, N24, P239, R237, Q275
    L75, P86, S87, N24, P239, R237, R19
    Epi#44
    S53, R98, D97, Y58, S57, A48, P55
    S53, R98, D97, Y58, S38, G211, T210
    Epi#45
    R19, H17, F22, N24, D89, G25
    R43, P86, F22, N24, D89, G25
    R272, H269, F10, N183, D181, V203
    R272, H269, F10, N183, D181, G184
    R43, P86, F22, N24, D89, G46
    Epi#46
    R19, R237, P239, N24, G20
    R19, R237, P239, N24, G25
    Epi#47
    G162, Y192, R160, N155, A187, Q185, N183, R186, S188
    G157, Y192, R160, N155, A187, Q185, N183, R186, S188
    S261, Y192, R160, N155, A187, Q182, N183, R186, S188
    L262, Y192, R160, N155, A187, Q182, N183, R186, S188
    Epi#48
    S261, Q161, P194, P260, G258
    S261, Q161, P194, P260, G264
    Epi#50
    D181, W6, V4, T3
    D181, W6, V203, S188
    D181, W6, V4, S9
    D181, W6, T3, P5
    Epi#51
    R98, H64, T210, R213, P40, S38, H59
    R98, H64, T210, R213, G211, S38, H59
    R19, H17, Q15, Q275, R272, Q252, H269
    Laccase:
    Epi#02
    A14, N15, S17, F21, P180, Y176, R266, V177
    T22, N15, P18, F21, P180, Y176, R266, V177
    A274, N275, A181, R175, P180, Y176, R266, V177
    A24, N15, S17, F21, P180, Y176, R266, V177
    T272, N275, A181, R175, P180, Y176, R266, V177
    Epi#03
    L184, K173, I186, Y256
    Epi#04
    R234, S211, Q261, K264, N267, G271
    R234, S211, Q261, K264, R266, G268,
    R259, S211, Q302, R234, N299, A301
    R259, S211, Q236, R234, N299, A301
    Epi#05
    G372, A371, L369, P350, G81, S349, S351, V352
    G372, A371, L369, P350, G81, S351, S349, Y347
    Epi#06
    G286, N289, D291, T293, S295, P292
    G214, P252, D254, T293, S295, P298
    A288, N289, D291, T293, S295, P292
    Epi#07
    G214, T294, D291, R283, V253, P252, D254
    G30, T12, D53, R59, A497, P89, D51
    G30, T10, D51, R59, A497, P55, D53
    Epi#08
    A371, E348, S349, A346, F335
    A14, D53, G90, A92, H91, F93
    A181, E183, G20, V16, F21
    A181, E183, G20, A182, F21
    Epi#09
    N41, A100, N43, V6, D42, R37, N4, T8, L94
    N41, A100, N43, V6, D42, R37, N4, T8, N47
    L369, N366, E376, R379, N472, A471, V474
    Epi#10
    E183, A181, N275, T272, F273, G268, R266
    D129, N41, N43, A100, F69, G72, R71
    E183, A181, N275, A274, F273, G271, K264
    Epi#11
    F93, L486, I489, Q485, V481, E482
    Epi#12
    Y490, E488
    Y375, E376
    Epi#13
    N366, P370, D367, I358, Q363, A471
    N366, P370, D367, I358, Q363, G361
    R379, P378, D326, I319, T321, G323
    R379, P378, D326, I319, T321, G318
    R379, P378, D326, I319, T321, A324
    Epi#15
    N366, P370, D367, I358, Q363, A471
    N366, P370, D367, I358, Q363, G361
    R379, P378, D326, I319, T321, G323
    R379, P378, D326, I319, T321, G318
    R379, P378, D326, I319, T321, A324
    Epi#16
    R175, P180, Y176, R266, Q164, N267, D166, A163, D205
    R283, P292, Y256, G214, Q251, D254, A285, A288, N289
    R283, P292, Y256, G214, Q251, D254, D291, A290, N289
    Epi#17
    A306, S413, R409, S414
    A411, S413, R409, S414
    A306, S410, R409, S414
    A411, S414, R409, S410
    Epi#19
    E216, N250, Q251, Q191, R283, G286
    E190, N250, Q251, Q191, R283, A288
    E216, N250, Q251, Q191, R283, A290
    E190, N250, Q251, Q191, R283, A285
    Epi#22
    D491, P494, D492, P495, E496
    D492, P494, D491, L493, E496
    Epi#23
    R339, N460, E348, S349, L369, A371
    R339, N460, E348, S351, L369, P370
    R339, N460, E348, S351, L369, A365
    R339, N460, E348, S351, L369, P350
    R283, N188, E190, N250, Q191, P252
    Epi#24
    D475, G72, A476, P445, R379, A471, Q363
    D53, G90, A497, P495, T498, P55, Q501
    D53, G90, A497, P495, S499, L58, Q501
    Epi#25
    R37, K40, D129, N130
    R37, K40, D129, N41
    Epi#27
    E142, E139, D138, K194,
    E142, E139, D138, K193
    Epi#28
    L58, Q501, I500, E496, L493, P495, D492
    G286, D254, Q191, K194, E190, K193, G192, D138
    A288, D254, Q191, K193, E190, K194, G192, D138
    G192, D248, Q191, K194, E139, L136, A135, D138
    V253, D254, Q191, K193, E190, K194, G192, D138
    A285, D254, Q191, K193, E190, K194, G192, D138
    Epi#29
    G390, Q332, L329, R330, E435
    V374, N366, L369, E348
    I500, P495, L493, E496
    G344, Q332, L333, R330, E435
    Epi#30
    G412, N304, A306, H309, I312, P314, V419
    I312, L311, A315, H309, P229, L136, P132
    Epi#31
    L329, Q332, N343, R330, F331, V386, D434
    L333, Q332, N343, R330, F331, V386, D434
    L58, Q501, N54, R59, F112, M459, F456, D205
    L58, Q501, N54, R59, F112, M459, I454, D205
    Epi#33
    Q485, Y490, P494, S499, A497, R59
    Q251, Y256, P292, S295, A296, R234
    H153, F21, V16, S17, A182, K173
    H153, F21, P18, S17, A182, K173
    Epi#34
    V431, P395, T432, G433, G412, T415, S414
    V431, P388, T432, G412, G433, S414, T415
    V419, P320, T321, G323, P322, Y416, S414
    V431, P395, T432, G390, G433, S414, T415
    Epi#35
    A371, L369, A362, S360, M359, I358
    G372, L369, A362, S360, M359, I358
    A365, L369, A362, S360, M359, I358
    Epi#36
    A362, A471, A476, V474, G361, S360, Q357, P350, A371, A365
    A290, A288, A285, V253, Y256, S295, A296, W257
    A288, A285, A287, V253, Y256, S295, A296, W257
    Epi#37
    P132, A135, L136, K194, N250
    A135, A134, L136, K194, D138
    P298, A301, L303, R234, N299
    Epi#38
    L356, G81, E348, A371, V374, L369, N366, P370, S351
    L356, G81, E348, A371, V374, L369, N366, P370, S349
    Epi#39
    A411, E435, T432, P395, G393, L392
    A1, E142, L35, R37, P34, G30, L27
    A389, E435, T432, P395, G394, L392
    Epi#40
    R330, L333, G390, T432, A411, S414
    G393, L392, G394, T432, A411, S414
    R330, L333, G390, T432, A411, T415
    Epi#41
    P370, L369, V352, S351
    P350, L369, V352, S351
    Epi#42
    L392, P395, S428, G430, P388, R330, Q332
    Epi#44
    S360, Q363, D367, P370, Y347, A371, G372, T345
    V253, Q191, D254, P292, W257, Y256, S295, A296, P298
    S360, Q363, D367, P370, Y347, S349, V352, P350
    V253, Q191, D254, P292, W257, Y256, S295, G214, P252
    Epi#45
    R409, P322, F418, Y416, N420, D313, V419
    K423, P314, F418, Y416, N420, D313, V419
    R175, P180, F21, Y176, R266, D166, G268
    Epi#46
    A296, R259, R234, P300, N299, A301
    Y256, R259, R234, P300, N299, Q302
    Epi#47
    I212, S211, R234, L303, A301, N299, P300, P298
    I212, S211, R234, V232, A301, N299, P300, P298
    Epi#48
    S158, Q160, P157, P155, V504
    S499, Q501, P55, P155, V504
    E488, Q485, P480, P479, V481
    Epi#49
    D367, L369, V352, P350, Q357, Q363, M359, N478
    D367, L369, P370, P350, Q357, Q363, M359, N478
    Epi#50
    D291, Y256, W257, S295, P298
    D254, Y256, W257, T293, S295
    Epi#51
    D307, H309, E228, T218, P229, T231, H230
    R234, H215, E216, T231, P229, H230, H309
    D248, H215, E216, T231, P229, H230, H309
    Epi#52
    F69, A100, T98, R71, W75, T73, Q70
    F97, A100, T98, R71, W75, T73, Q70
    Natalase:
    Epi#01
    P344, P382, R387, R33, N32, S28, R31, T36
    P344, P382, R387, R33, N29, S28, R31, T36
    Epi#02
    A87, N21, Q18, R24, S28, R31, R33
    A87, K89, S83, R24, S28, R31, R33
    Epi#03
    L307, K305, H402, I404, Y398
    L307, K305, H401, I404, Y398
    L307, K305, A304, I404, Y398
    Epi#04
    R167, S166, Q168, R172, N171, I173
    R177, Y131, S128, Q125, R123, N124, I127
    Epi#05
    G178, A180, N124, P120, G190, S187, H234, L195
    G178, A180, N124, P120, G190, R123, S187, Y192
    G178, A180, N124, P120, G190, S187, H234, Y192
    Epi#06
    A87, N21, D25, R24, Q18, P14
    G145, N146, D150, T147, R144, P142
    G143, N146, D150, T147, R144, P142
    G450, N451, D447, T455, K452, P453
    A87, N21, D25, R22, Q18, P14
    G454, N451, D447, T455, K452, P453
    A378, P382, D447, T455, K452, P453
    Epi#07
    G145, T147, D150, S149, R213, V208, P205, D201
    Epi#08
    K305, D400, A304, H402, F399
    K305, D400, A304, H401, F399
    Epi#09
    S79, S83, D25, R22, R24, H86, N90, S28, R31
    N439, A460, N459, V444, K478, N417, T413, T414
    Epi#10
    E254, N249, R248, T245, F239, R212, R213
    E254, N249, R248, T245, F239, R241, K275
    Epi#11
    F169, I173, Q170, D162
    L195, I173, Q170, D162
    Epi#12
    Y192, E188
    Y357, E354
    Epi#13
    H12, L13, P369, A375, P374, S372, P330, W11
    H12, L13, P369, A375, P374, S372, P330, L334
    H12, L13, P369, A375, P374, S372, P330, G331
    Epi#15
    N451, P453, D447, I448, T449, A378
    N451, P453, D447, I448, K452, G450
    Epi#16
    Q313, P316, Y357, R353, Q395, D397, D400, A304, N308
    Q355, P316, Y357, G356, R353, D397, D400, A304, D302
    Epi#17
    A87, S83, R24, S28
    A87, S28, R24, S83
    Epi#18
    R33, N32, R31, S28, G92, N90
    Epi#19
    D16, N50, S48, Q49, R72, G69
    D25, N21, Q80, Q18, R24, A87
    E82, T77, Q18, Q80, R72, G69
    Epi#22
    D461, A460, W463, W433
    Epi#23
    K478, N417, E410, N439, Q438, A460
    K478, N417, E410, N439, Q438, A441
    Epi#24
    E332, G331, E335, P330, S372, A375, K379
    D381, K379, A375, P369, S372, P374, K377
    Epi#25
    R154, K138, W136, D162, N171
    R213, R212, W217, E216, N249
    R154, K138, W136, E134, N112
    R241, K236, W183, D203, E206
    Epi#26
    W163, S166, E134, W136, V161, E117, E126
    W163, S166, E134, W136, V161, E117, D130
    W163, S166, E134, W136, V161, E117, D162
    Epi#27
    D203, E206, D201, K236
    E117, E126, D130, K175
    D201, E206, D203, K179
    E126, E117, D162, K175
    Epi#28
    L195, D162, Q168, W163, E134, W136, Q165, S166, R167
    I173, D162, Q170, W163, E134, W136, Q165, S166, R167
    V161, D162, Q170, W163, E134, W136, Q165, S166, R167
    Epi#29
    G331, P330, L334, F337, E335
    G178, K175, L114, R177, E117
    Epi#30
    G450, N451, H446, K478, I448, P453
    G454, N451, H446, K478, I448, P453
    Epi#31
    Q168, N171, R172, W163, M196, I173, D162
    Q170, N171, R172, W163, V161, I173, D162
    Epi#33
    K377, Y366, P369, S372, A375, K379
    K377, Y366, P374, S372, A375, K379
    Epi#34
    W433, W463, T457, V444, G454, T455, P453
    W433, W463, T457, V456, G454, T455, P453
    Epi#37
    Y156, R177, L114, K175, D130
    T132, R177, L114, K175, N124
    Epi#38
    G429, E431, N469, P428, S472
    G430, E431, N469, P428, S472
    Epi#39
    E10, H12, T370, P330, G331, L334
    E10, L13, T370, P330, G331, L334
    Epi#40
    A378, A375, Y366, P369, S372
    R177, L114, G178, Y156, K138, T110
    A375, A378, Y366, P369, T370
    Epi#41
    P369, L13, V52, S48
    Epi#42
    P316, S281, G356, R353, Q355
    P316, S281, G356, R353, Q395
    Epi#44
    V208, R213, W217, Y148, S149, G145, P142
    S28, R33, D381, Y365, A378, A375, P369
    L13, D16, P14, W11, Y362, A375, V373, T370
    S333, D327, P330, W11, Y362, A375, V373, P369
    Epi#45
    D108, P142, F65, Y60, N146, D150, G145
    D140, P142, F65, Y60, N146, D150, G145
    Epi#46
    Y392, R387, R33, P382, G450, G454
    Y392, R387, R33, P382, Q388, G3
    Epi#47
    S83, S79, E82, I85, R24, A87, N90, R31, S28
    A250, G252, E254, N249, R248, F256, N279, R241, S238
    Epi#48
    S372, H371, P374, P369, V373
    Epi#49
    D51, W11, L13, V52, P14, Q18, Q80, T77, N21
    D51, W11, L13, V52, P14, Q18, Q80, T77, K74
    Epi#50
    D461, Y435, W433, W463, T457
    D400, Y398, W433, W463, T457
    D397, Y435, W433, W463, T457
    Epi#51
    T394, H396, D397, D400, K305, H402, H401
    T455, H446, K478, T457, G442, Q438, W463
    Epi#52
    W136, A109, E134, R167, W163, N171, Q170
    W136, A109, E134, R167, W163, N171, Q168
    PD498:
    Epi#02
    T262, K258, S260, F266, T198, Y196, R168, V166
    T262, K258, S260, F266, T264, Y196, R168, V166
    T141, N139, Q171, F170, S167, Y196, R168, V166
    Epi#03
    L99, K51, A49, I53, Y56
    L99, K51, A49, I53, Y43
    Epi#04
    R28, S331, Q333, K97, R50, I53
    R28, S331, Q333, K97, R50, A49
    Epi#05
    G108, A106, N107, G110, S109, S111, I59
    G110, A106, N107, G108, S109, S111, L112
    G108, A106, N107, G110, S111, S117, Y121
    G108, A106, N107, G110, S111, S109, G135
    G110, A106, L68, P214, G217, S219, Y220
    G108, A106, N107, G110, S111, S109, L134
    Epi#06
    G135, N163, D164, R168, S174, P176
    G162, N165, D164, R168, S174, P176
    A22, N274, D25, S2, S9, P6
    G154, N152, D148, T142, K144, P176
    A22, P21, D25, S2, S9, P6
    G154, N152, D148, S145, K144, P176
    Epi#07
    29, T332, S331, D95, S240, R28, V26, P21, D25
    G29, T332, S330, D95, S331, R28, V26, P21, D25
    Epi#08
    K258, D257, S260, F266
    K190, D185, S192, V207, F193
    Epi#09
    N215, N44, R50, I53, K54, N64, N63, R61
    N44, A49, R50, I53, K54, N63, N64, R61
    Epi#10
    D188, N187, R189, S260, F266, G263, K258
    D185, N187, R189, S260, F266, G263, K258
    Epi#12
    Y268, E253
    Epi#15
    R50, P46, D82, I87, T83, G86
    N215, P46, D82, I87, T83, G86
    Epi#18
    N216, N44, R50, I53, A49, P46, N215
    N215, N44, R50, I53, A49, P46, N216
    Epi#19
    D95, T332, S240, Q241, R28, G29
    D95, T332, S330, Q241, R28, G29
    Epi#22
    D185, S192, D164, Y196, K267
    D105, S111, D113, T141, K144
    Epi#24
    D95, K51, A49, P46, R50, K97
    Epi#25
    R120, K153, W151, D148, N152
    R189, K190, D188, N187
    R189, K190, D185, N208
    Epi#27
    D201, E253, D257, K258
    D257, E253, D201, K267
    Epi#28
    I259, D257, Q254, E253, K267, F266, S260, R189
    I259, D257, Q254, E253, K267, F266, S260, K258
    Epi#29
    L68, G108, L134, F170, E137
    G135, N163, L134, F170, E137
    Epi#30
    G110, N107, A106, H71, L68, L104, L112
    G108, N107, A106, H71, L68, P214, V213
    G110, N107, A106, H71, P214, L68, L104
    G110, N107, A106, H71, L68, L104, L134
    Epi#33
    Q12, Y220, V207, S222, S192, R189
    190, F193, V207, S222, S192, R189
    Q16, Y13, V207, S222, S192, R189
    Epi#34
    V26, W1, T27, G29, R28, S331, T332
    W1, P21, T27, V26, R278, Y279, T255
    Epi#35
    G135, L134, S225, M221, I209
    G110, L134, S225, M221, I209
    G108, L134, S225, M221, I209
    G162, L134, S225, M221, I209
    Epi#37
    A49, V52, L99, K54, N63
    SAS: 309, Size 17.16: Y121, A127, L99, K54, N63
    SAS: 307, Size 13.09: Y43, V52, L99, K54, N63
    Epi#40
    R189, G261, Y268, K258, S260
    R189, G261, Y268, K258, T262
    Epi#42
    P3, S2, Q16, P21, R28, Q241
    Epi#43
    W199, Y196, G162, Q171, S140, L112, I115, T142
    Epi#44
    S145, D148, P176, W199, Y196, S167, G162, T169
    S174, D201, P176, W199, Y196, S167, G197, T198
    Epi#47
    S330, S331, R28, V26, A22, Q16, N17, P21, S2
    G242, S240, R28, V26, A22, Q16, N17, P21, S2
    G29, S331, R28, V26, A22, Q16, N17, P21, S2
    Epi#48
    S2, D25, P21, P3, G86
    S9, Q16, P21, P3, G86
    Epi#50
    R168, Y196, W199, T264, T198
    D164, Y196, W199, T264, S260
    Savinase:
    Epi#01
    L21, N18, P14, R19, K231, N232, S236, Q239, S234
    L21, N18, P14, R19, K231, N232, S234, Q230, S24
    L21, N18, P14, R19, K231, N232, S234, Q230, T22
    Epi#02
    T254, N255, A188, R164, S158, Y186, R180, V197
    T249, N263, Q12, R10, P14, R19, R269
    T249, N263, S9, R10, P14, R19, R269
    Epi#03
    K27, A86, I43, Y89
    Epi#04
    K229, S234, Q230, K231, R269, A266
    K27, S24, Q230, K231, R269, A15
    K231, S234, Q239, R241, N246, A248
    Epi#05
    G187, A188, N255, T254, G252, S250, T249, L251
    G189, A188, N255, T254, G252, S250, T249, L261
    Epi#06
    G252, N179, D175, S182, S154, P127
    A188, N255, D191, R164, S158, P127
    A188, N255, D191, R164, S128, P127
    Epi#08
    A131, E134, S139, A106, F49
    A166, E134, S139, A106, F49
    Epi#09
    S103, T132, A131, E134, A166, R164, N167, S142, R143
    Epi#10
    D175, N177, N179, S182, F183, G155, R180
    D175, N212, N153, S182, F183, G155, R180
    Epi#11
    F49, L94, I105, Q107, V102, E134
    F49, K92, I105, Q107, V102, E134
    Epi#12
    Y161, E134
    Y165, E134
    Epi#13
    S76, L73, P39, T207, A209, P204, S206, G205, Y208
    S85, L73, P39, T207, A209, P204, S206, G205, Y203
    Epi#16
    R164, P127, Y161, G152, S158, N255, D191, A166, N167
    R164, P129, Y161, G152, S158, N255, D191, A166, N138
    Epi#17
    A156, S158, R164, S128
    A188, S158, R164, S126
    Epi#18
    N177, N179, R180, S182, G155, S154, A156, S158
    N177, N178, R180, S182, G155, S154, N153, F183
    Epi#19
    D175, N179, S182, Q185, R180, L256
    D175, N179, S182, Q185, R180, L251
    I240, W235, S234, Q239, R241, K245
    D175, N179, S182, Q185, R180, G252
    Epi#23
    R143, N114, E110, S139, Q135, A131
    R143, N115, E110, N138, Q135, A131
    Epi#24
    D58, G59, E53, P51, F49, P54, Q57
    D58, G59, E53, P51, S48, P54, Q57
    D58, G59, E53, P54, S55, F49, Q107
    Epi#25
    R19, R269, E265, N18
    R269, R19, E265, N18
    Epi#28
    V102, Q107, F49, E53, K92, Q57, G46, R44
    A47, Q107, F49, E53, K92, Q57, G46, R44
    V50, Q107, F49, E53, K92, Q57, G46, R44
    Epi#29
    I77, N74, L41, R44, E87
    V4, N74, L41, R44, E87
    G20, N18, L21, R19, E265
    Epi#30
    G59, N60, S97, H62, L94, P51, P54
    G98, N60, S97, H62, L94, P51, P54
    Epi#31
    L256, R180, N178, R10, W6, V197, D175
    L251, R180, N178, R10, W6, V197, D175
    Epi#33
    Q107, F49, P51, S48, S55, K92
    Q107, F49, P54, S55, A47, K92
    Epi#34
    V102, P129, S128, G125, R164, Y161, P127
    V102, P129, S126, G125, R164, S158, P127
    Epi#37
    T254, A188, L256, R180, N177
    T254, A188, L256, R180, N179
    Epi#38
    L94, G59, E53, A96, N60, P204, S206
    L94, G59, E53, A96, N60, P204, S36
    Epi#39
    A131, E134, L133, T132, P129, G125, L124
    A166, E134, L133, T132, P129, G125, L124
    Epi#40
    R44, L41, G78, T207, P39, T37
    R19, L21, G20, T22, K231, S234
    R180, L256, G252, T254, A188, S158
    Epi#41
    P127, Y161, L133, V102, S99
    P127, Y161, L133, V102, S103
    P127, Y161, L133, V102, S101
    P127, Y161, L133, V102, S126
    Epi#42
    L73, P84, S85, N74, H17, P14, R19, R269
    L80, P5, S3, N74, H17, P14, R19, R269
    L21, P84, S85, N74, H17, P14, R19, R269
    Epi#43
    105, W111, A47, G46, Q57, S36, L41, I43, T37
    Epi#44
    S126, R164, P127, Y161, S158, A188, T254
    S128, R164, P129, Y161, S158, A188, T254
    Epi#46
    A15, R269, R19, P14, N18, G20
    A266, R269, R19, P14, N18, A15
    Epi#48
    S55, Q57, P54, P51, G52
    E53, Q57, P54, P51, G52
    Epi#50
    R10, W6, S3, S76
    R241, W235, S234, P233
    R10, W6, V4, S9
    Epi#51
    Q239, H243, T247, R269, R19, K231, W235
    R19, H17, E265, R269, K231, S234, W235
    Epi#52
    A15, S9, R10, W6, N198, Q176
    A15, S9, R10, W6, N198, Q200
    Amylase SP722:
    Epi#02
    T419, N423, P422, F396, T5, Y398, R393, R37
    T419, N418, P422, F396, T5, Y398, R393, R37
    Epi#03
    L313, K311, H408, I410, Y404
    L313, K311, H407, I410, Y404
    Epi#04
    R171, S170, Q172, R176, N175, I177
    R181, Y135, S132, Q129, R127, N128, I131
    Epi#05
    G184, A186, N128, P124, G196, S193, H240, L201
    G184, A186, N128, P124, G196, R127, S193, Y198
    Epi#06
    G147, N150, D154, T151, R148, P146
    G149, N150, D154, T151, R148, P146
    Epi#07
    G149, T151, D154, S153, R219, V214, P211, D207
    Epi#08
    K311, D406, A310, H407, F405
    K311, D308, A310, H408, F405
    Epi#09
    T461, R485, K484, N423, T419, N418
    R485, K484, N423, T420, T419
    Epi#10
    E260, N255, R254, T251, F245, R218, R219
    T419, N423, N395, T5, F396, R393, R37
    E260, T257, N255, T251, F245, R218, R219
    Epi#11
    F173, I177, Q174, D166
    L201, I177, Q174, D166
    Epi#12
    Y363, E360
    Y398, E360
    Y198, E194
    Epi#13
    H16, L17, P375, A381, P380, S378, P336, W15
    H16, L17, P375, A381, P380, S378, P336, G337
    H16, L17, P375, A381, P380, S378, P336, L340
    Epi#15
    N457, P459, D453, I454, K458, G456
    K458, P459, D453, I454, T455, A384
    N457, P459, D453, I454, K458, G460
    Epi#16
    Q319, P322, Y363, R359, Q401, D403, D406, A310, N314
    Q319, P322, Y363, G362, R359, D403, D406, A310, N314
    Q319, P322, Y363, R359, R415, D403, D406, A310, N314
    Epi#17
    A91, S32, R28, S87
    A91, S87, R82, S83
    Epi#18
    R485, V450, G448, T463, T461, H452, V462
    N126, N128, R127, G196, Y198, S193, N195, N125
    N25, R26, R28, S87, I89, A91, H90, N94
    Epi#19
    D20, N54, S52, Q53, R76, G73
    D20, N19, Q22, Q84, R76, G73
    D29, N25, Q22, Q84, R28, A91
    Epi#20
    K385, P350, L355, L313, K311, D308, G305, D432
    Epi#22
    D183, A186, D209, W189, K242
    D183, A186, D209, W189, E190
    D183, A186, D209, P211, E212
    D209, A186, D183, Y160, W159
    D183, A186, D209, W187, W189
    Epi#23
    R415, N418, E416, N445, Q444, A466
    K446, N445, E416, Y441, Q444, A466
    Epi#24
    D387, K385, A381, P375, S378, P380, K383
    E341, G337, E338, P336, S378, A381, K385
    D333, G337, E341, P336, S378, A381, K385
    Epi#25
    R485, H452, I454, E391, N36
    R485, K484, I454, E391, N395
    Epi#26
    W167, S170, E138, W140, V117, G182, D183
    W167, S170, E138, W140, V165, E121, D134
    W167, S170, E138, W140, V165, E121, E130
    Epi#27
    E212, E216, D154, K156
    E216, E212, D209, K242
    Epi#28
    L201, D166, Q172, W167, E138, W140, Q169, S170, R171
    L201, D166, Q169, W140, E138, W167, F173, S170, R171
    L201, D166, Q174, W167, E138, W140, Q169, S170, R171
    Epi#29
    V214, N215, L217, R219, E222
    G96, H90, L228, R82, E86
    V214, R219, L217, R218, E212
    Epi#30
    G456, N457, H452, K484, I454, P459
    G362, M323, S287, H324, K320, P322, V318
    G362, M323, S287, H321, K320, P322, V318
    G460, N457, H452, K484, I454, P459
    Epi#31
    L217, R219, N215, R218, F245, V214, D248
    L217, R219, N215, R218, F245, M208, D209
    Epi#33
    K383, Y372, P375, S378, A381, K385
    K383, Y372, P380, S378, A381, K38
    Epi#34
    W439, W469, T463, V450, R485, T461, P459
    W439, W469, T463, V462, R485, T461, P459
    Epi#37
    T251, R218, L217, R219, N215
    P211, V214, L217, R219, N215
    A256, R218, L217, R219, N215
    Epi#38
    G435, E437, N475, P434, S478
    G436, E437, N475, P434, S478
    Epi#39
    E338, H16, T376, P336, G337, L340
    E14, H16, T376, P336, G337, L340
    Epi#40
    A384, A381, Y372, P375, S378
    A384, A381, Y372, P375, T376
    Epi#41
    P375, L17, V56, S52
    Epi#42
    S378, P380, Y372, A381, A384, P375
    S378, P375, Y372, A381, A384, P388
    S378, P375, Y372, A381, A384, T455
    Epi#45
    K72, P146, F69, Y64, R148, D154, G149
    K311, H408, F405, N409, D432, G304
    D406, H408, F405, N409, D432, G304
    Epi#46
    Y398, R393, R37, P388, Q394, G7
    Y398, R359, R393, P388, G456, G460
    Y398, R393, R37, P388, Q394, G38
    Epi#47
    A256, G258, E260, N255, R254, F262, N285, R247, S244
    S193, Y198, E194, N125, R127, Q129, N123, R176, P124
    Epi#48
    S378, H377, P380, P375, V379
    H16, H377, P375, P380, V379
    Epi#49
    D55, W15, L17, P18, Q22, Q84, T81, N25
    D55, W15, L17, P18, Q22, Q84, T81, K78
    Epi#50
    D467, Y441, W439, W469, T463
    D406, Y404, W439, W469, T463
    D183, Y160, W159, W140, T114
    D403, Y441, W439, W469, T463
    Epi#51
    D406, H408, D308, K311, L313, Q319, H321
    Epi#52
    W140, A113, E138, R171, W167, N175, Q174
    W140, A113, E138, R171, W167, D166, Q172
    Amylase AA560:
    Epi#01
    L390, P388, P350, K383, K385, N457, S478, R458, T461
    L390, P388, P350, K383, K385, N457, S478, R458, T452
    L390, P388, P350, K383, K385, N457, S478, R458, T455
    Epi#02
    L390, K395, Q394, R393, T5, Y398, R359, R400
    L173, K172, S170, T136, Y135, R118, R181
    L173, R171, S170, T136, Y135, R118, R181
    L390, K395, Q394, R393, T5, Y398, R400, R415
    Epi#03
    K438, H407, I410, Y404
    Epi#04
    K172, S170, Q169, R171, N174, L173
    R171, S170, Q169, K172, N175, I177
    Epi#05
    G456, A459, R458, T461, G460, T452, T463, V450
    G456, A459, R458, T452, G460, T461, T463, G448
    Epi#06
    A51, N54, D20, R76, Q71, P146
    G73, A51, D55, S52, K72, P146
    Epi#07
    G456, T455, S384, D387, R393, P388, D453
    Epi#08
    K259, S255, V222, H252, F245
    K259, G258, A256, H252, F245
    Epi#09
    N128, V131, R176, D166, K172, N175, N174, R171
    Epi#10
    467, N445, R444, F441, R415, R400
    D467, A466, R444, F441, R415, R400
    Epi#11
    F69, K72, I75, Q53, V56, D55
    Epi#12
    Y16, E337
    Y363, E360
    Y198, E194
    Epi#15
    K385, P388, D453, I454, R458, A459
    K385, P388, D387, I454, T452, A459
    K385, P388, D387, I454, R458, G456
    Epi#17
    A87, S29, R28, S32
    A91, S29, R28, S32
    Epi#18
    N445, R444, A466, T463, T461, N471, N437
    N445, R444, A466, T463, T461, T452, V450
    Epi#19
    166, W167, S170, Q169, R171, K172
    E138, W167, S170, Q169, R171, K172
    E134, T136, S170, Q169, R171, K172
    Epi#22
    D209, P211, D207, Y160, D183
    Epi#23
    R400, N418, E416, N445, Q449, A466
    R82, N83, E68, N70, F69, P146
    Epi#24
    E134, G133, E130, P124, R176, L173, K172
    E134, K179, E130, P124, R176, L173, K172
    Epi#25
    R444, K446, W469, D467, N445
    R171, K172, W167, D166, N175
    R171, K172, W167, D166, N174
    Epi#26
    W167, S170, E138, W140, V165, E121, E130
    W167, S170, E138, W140, V165, E121, E134
    W167, S170, E138, W140, V165, E121, D166
    Epi#27
    E130, E121, D166, K172
    D36, E391, D387, K385
    E134, E121, D166, K172
    Epi#28
    L201, D166, Q169, W140, E138, K172, S170, R171
    L173, D166, Q169, K172, E138, W167, S170, R171
    Epi#29
    V131, R176, L173, R171, E138
    I177, N175, L173, R171, E138
    I177, N174, L173, R171, E138
    Epi#30
    I39, N33, S29, H23, P18, L17, P375
    G38, N33, S29, H23, L17, P375, P380
    G362, M323, S287, H321, Q319, P322, V318
    G417, N423, A420, H421, K395, L390, P388
    G21, N25, S29, H23, P18, L17, P375
    G399, N418, A420, H421, K395, L390, P388
    Epi#31
    L173, R171, N174, R176, W167, M202, I177, D166
    L173, R171, N174, R176, W167, V165, I177, D166
    Epi#33
    K108, Y58, V56, S52, A51, K72
    Epi#34
    W439, W469, T463, V450, G460, T452, T461
    W15, P18, T376, G378, P375, Y372, S384
    W469, W439, S473, G460, R458, T461, T463
    Epi#37
    P124, R176, L173, K172, N175
    P124, R176, L173, R171, N174
    Epi#40
    R400, G399, Y396, P422, T419
    R400, G417, Y396, P422, T419
    Epi#41
    P375, Y16, L17, V56, S52
    P18, Y16, L17, V56, S52
    Epi#42
    P350, S478, G433, H408, R310, Q311
    P322, S287, N285, H324, R320, Q319
    P322, S287, G362, H321, R320, Q319
    Epi#44
    L17, D20, P18, W15, Y368, A381, G378, T376
    L340, D333, P336, W15, Y368, A381, G378, P375
    Epi#45
    K72, P146, F69, Y64, N150, D144, G147
    D112, P146, F69, Y64, N150, D144, G149
    Epi#46
    Y398, R359, R393, P388, G456, A459
    Y363, R359, R393, P388, Q394, G7
    Y363, R359, R393, P388, Q394, G38
    Epi#47
    I75, E68, R76, N83, R82, Q84, N90, R28, S29
    G133, E134, E130, V131, R176, L173, N174, R171, S170
    Epi#48
    S384, K383, P380, P375, G378
    E337, H377, P380, P375, V379
    Epi#50
    R444, W469, W439, S473, T461
    D183, Y160, W159, W140, T114
    Epi#51
    R320, H321, Q319, P322, H324, H286
    Epi#52
    W140, A113, E138, R171, W167, D166, Q169
    W140, A113, E115, R118, W159, T114, Q169
    Protease A:
    Epi#01
    L21, N18, P14, R19, K237, N238, S242, Q245, S240
    L21, N18, P14, R19, K237, N238, S240, Q236, S24
    Epi#02
    T255, N269, Q12, R10, P14, R19, R275
    T255, N269, S9, R10, P14, R19, R275
    Epi#03
    K27, A88, I44, Y91
    Epi#04
    K235, S240, Q236, K237, R275, A15
    K27, S24, Q236, K237, R275, A15
    K237, S240, Q245, R247, N252, A254
    R145, S141, Q137, Y171, N173, A172
    Epi#06
    G61, N62, D60, T38, Q59, P55
    G211, P210, D60, T38, Q59, P55
    A98, N62, D60, T38, Q59, P55
    G100, N62, D60, T38, Q59, P55
    Epi#08
    A131, E136, S141, A108, F50
    A172, E136, S141, A108, F50
    A98, E54, G53, V51, F50
    Epi#09
    S162, S170, A172, N173, V244, H249, N252, S256, T260
    S259, S256, T260, N261, L262, R186, N185, S188, N155
    S162, S170, A172, N173, V244, H249, N248, N252, T255
    S156, S162, N261, S259, L262, R186, N185, S188, N155
    Epi#10
    D181, N183, N185, S188, F189, G157, R186
    D181, N218, N155, S156, F189, G157, R186
    Epi#12
    Y171, E136
    Y91, E89
    Epi#13
    S78, L75, P40, T213, A215, P210, S212, G211, Y209
    S87, L75, P40, T213, A215, P210, S212, G211, Y214
    Epi#16
    L262, P194, Y192, G195, S162, N261, D197, A172, N140
    L262, P194, Y192, G157, S162, N261, D197, A172, N173
    L262, P194, Y192, G161, S162, S170, D197, A172, N173
    Epi#17
    A138, S141, R145, S144
    A108, S141, R145, S144
    Epi#18
    N185, N183, R186, L262, S259, T260, P194, N261
    N185, N183, R186, L262, Y192, T260, P194, S162
    Epi#19
    I246, W241, S240, Q245, R247, K251
    D181, N185, S188, Q191, R186, L262
    Epi#23
    R145, N116, E112, S141, Q137, A138
    R145, N117, E112, S141, Q137, A108
    Epi#24
    E136, G133, A131, P129, S103, F50, Q109
    E136, G132, A131, P129, S103, A108, Q137
    D60, G61, E54, P52, F50, P55, Q59
    Epi#25
    R275, R19, E271, N18
    Epi#28
    G20, H17, Q12, E271, L21, Q236, S240, K237
    A15, H17, Q12, E271, L21, Q236, S240, K237
    Epi#29
    V244, Q245, L148, R145, E112
    V244, N173, L148, R145, E112
    Epi#30
    G61, N62, A98, H64, L96, P52, P55
    G20, N18, A15, H17, S87, L75, P40
    I79, N76, S87, H17, Q12, P14, V4
    G100, N62, A98, H64, L96, P52, P55
    Epi#31
    L262, R186, N184, R10, W6, V203, D181
    L257, R186, N184, R10, W6, V203, D181
    Epi#33
    Q109, F50, P52, S49, S56, K94
    Q109, F50, P55, S56, A48, K94
    Epi#34
    W241, P239, S242, G146, R145, S141, S144
    I165, P194, T260, G258, R186, S188, S156
    V104, P129, S130, G127, G102, S101, S99
    V244, W241, S242, G146, R145, S141, S144
    I165, P194, S170, G127, P129, S130, S103
    Epi#37
    P14, A15, L21, R19, N18
    T143, R145, L148, R247, N252
    T143, V244, L148, R145, N116
    Epi#38
    L96, G97, E54, A98, N62, P210, S212
    L96, G97, E54, A98, N62, P210, S37
    Epi#39
    A15, E271, H17, R19, P14, G20, L21
    A254, E271, H17, R19, P14, G20, L21
    A272, E271, H17, R19, P14, G20, L21
    Epi#40
    R186, L257, G258, T260, P194, S162
    R186, L262, G161, Y192, P194, T260
    Epi#41
    P194, Y192, L262, S259
    P194, Y192, L196, S162
    Epi#42
    L82, P5, S3, N76, H17, P14, R19, R275
    L82, P5, S9, Q12, H17, P14, R19, R275
    Epi#43
    W113, A48, G47, Q59, S37, L42, I44, T38
    Epi#44
    V244, R247, D197, P194, Y192, S162, G195, T260
    V244, R247, D197, P194, Y192, S170, G195, T260
    S56, Q59, D60, P210, Y214, S212, G211, T38
    S56, Q59, D60, P210, Y209, S212, G211, T38
    Epi#46
    A15, R275, R19, P14, N18, G20
    A272, R275, R19, P14, N18, G20
    A272, R275, R19, P14, N18, A15
    Epi#47
    S130, A131, E136, N173, A172, N140, R145, S144
    S105, A131, E136, N173, A172, N140, R145, S144
    Epi#48
    E54, Q59, P55, P52, G53
    S56, Q59, P55, P52, G53
    S49, Q59, P55, P52, G53
    Epi#50
    R10, W6, S3, S78
    R10, W6, V4, S9
    R10, W6, V203, S188
    Epi#51
    Q245, H249, T253, R275, K237, S240, W241
    R19, H17, E271, R275, K237, S240, W241
    R145, H120, K27, S24, K237, S240, W241
    R145, H120, K235, K237, P239, S240, W241
    Epi#52
    A15, S9, R10, W6, N204, Q206
    A15, S9, R10, W6, N204, Q182
    Alcalase:
    Epi#01
    L10, P5, P9, K15, K12, N269, S251, R249, T253
    L82, P5, P9, K15, K12, N269, S251, R249, T253
    Epi#02
    T115, N141, A144, R145, S242, R247, R249
    A138, N141, A144, R145, S242, R247, R249
    Epi#03
    L196, K170, A129, I165, Y167
    L196, K170, A194, I165, Y171
    Epi#04
    R145, Y143, S173, Q137, K136, T133, A134
    K170, Y167, S132, Q137, K136, N141, A144
    Epi#05
    G53, A52, F50, G102, S105, S103, Y104
    G53, A52, F50, G102, S101, S103, Y104
    Epi#06
    A24, N25, Q120, R145, S242, P239
    A144, N141, D140, R145, S242, P239
    Epi#08
    K265, E197, S260, A194, F261
    A56, E54, G53, A52, F50
    Epi#10
    T162, N161, N163, A194, F261, G264, K265
    E195, N161, N163, S158, F261, G258, K265
    Epi#12
    Y57, E54
    Y262, E197
    Epi#13
    S38, A37, P40, T213, A215, H64, L217, G204, Y206
    S38, A37, P40, T213, A215, H64, S98, G100, G61
    S87, L75, P40, T213, A215, H64, L217, G204, Y6
    Epi#16
    L10, P9, Y6, G204, S182, N183, D181, A187, N185
    Q2, P5, Y206, G204, S182, N183, Q181, A203, N218
    L10, P9,Y6, G204, S182, N183, D181, A187, N155
    Epi#17
    A144, S244, R247, S252
    A272, S252, R249, S244
    A144, S244, R249, S251
    A254, S252, R249, S244
    Epi#18
    N141, R145, A144, Y143, S244, N248, S252
    Epi#19
    N248, S244, Q245, R249, A272
    N240, S242, Q245, R249, A254
    N240, S242, Q245, R249, L241
    Epi#22
    D76, L82, D14, A18, K15
    D181, L10, D14, A18, K15
    Epi#23
    K27, N117, E112, N141, Q137, A134
    K27, N117, E112, N141, Q137, A138
    K27, N117, E112, S109, F50, A52
    Epi#24
    D120, K27, A24, P86, F21, A18, K15
    D14, K22, A24, P86, F21, A18, K15
    D76, K22, A24, P86, S87, F21, K15
    Epi#25
    R249, R247, E197, E195
    Epi#27
    D172, E195, E197, K265
    E197, E195, D172, K136
    D172, E197, E195, K170
    Epi#28
    A18, D14, Q19, K15, E271, K12, Q17, S87, D76
    V4, D14, Q17, K12, E271, K15, F21, A18, K22
    Epi#29
    L257, K265, L196, F261, E195
    G53, N97, L96, F50, E54
    Epi#30
    G146, L241, S242, H238, K237, P239, L235
    G146, L241, S236, H238, S242, P239, L235
    Epi#33
    K15, F21, P86, S87, A24, K27
    K27, Y91, V45, S89, A24, K22
    Epi#34
    V4, P5, T3, G80, P40, S38, T211
    V108, W113, T116, G118, R145, Y143, S244
    V26, P239, S242, G146, R145, T115, T116
    Epi#36
    A52, A56, A48, V51, G102, Y104, S105, V108, A138, A134
    A52, A56, A48, V51, G102, Y104, S103, V108, A134, A138
    Epi#37
    Y262, A194, L196, K265, Y256
    Y263, R186, L257, K265, Y256
    Y256, A254, L257, K265, Y262
    Epi#40
    R186, L257, A254, Y256, K265, S252
    R186, L257, G258, Y256, K265, S260
    Epi#41
    Y256, L257, S260
    Y256, L257, S259
    Epi#42
    L235, P239, S242, N248, R249, Q275
    L241, P239, S242, Q245, R249, Q275
    Epi#44
    S132, Q137, D140, Y143, A144, A138, T133
    V108, Q137, D140, Y143, A144, A138, T133
    S173, Q137, D140, Y143, A144, A138, T133
    Epi#48
    Q19, K15, P9, P5, V4
    E271, K15, P9, P5, V4
    Protease B:
    Epi#05
    SAS: 454, Size 24.86: G189, A188, R164, P127, G125, S99
    SAS: 452, Size 15.92: G189, A188, R164, P127, G125, S128
    SAS: 451, Size 24.86: G157, A188, R164, P127, G125, S99
    SAS: 449, Size 15.92: G157, A188, R164, P127, G125, S128
    SAS: 445, Size 23.31: G189, A166, R164, P127, G125, S99
    Epi#09
    SAS: 446, Size 15.76: T254, G189, A166, R164, A188, S158
    SAS: 312, Size 15.90: T22, G20, L21, R19, A15, S9
    Epi#10
    SAS: 460, Size 17.32: D175, N177, N179, S182, F183, G155, R180
    SAS: 437, Size 16.70: D211, N212, N153, S182, F183, G155, R180
    SAS: 424, Size 13.75: D175, N212, N153, S182, F183, G155, R180
    SAS: 417, Size 16.70: D211, N212, N153, S154, F183, G155, R180
    SAS: 404, Size 15.83: D175, N212, N153, S154, F183, G155, R180
    Epi#12
    SAS: 309, Size 13.46: P127, Y161, E134, P129
    SAS: 292, Size 9.37: R164, Y161, E134, P129
    SAS: 287, Size 18.66: P127, Y161, E134, N138
    SAS: 284, Size 16.85: P127, Y161, E134, N167
    SAS: 275, Size 11.53: S128, Y161, E134, P129
    Epi#17
    SAS: 275, Size 15.84: A188, S158, R164, S126
    SAS: 225, Size 12.79: A156, S158, R164, S126
    Epi#18
    SAS: 444, Size 16.32: S250, K245, S259, L256, A188, T254, L251
    SAS: 397, Size 14.14: S250, K245, S259, L256, G252, T254, L251
    SAS: 397, Size 14.14: S250, K245, S259, L251, G252, T254, L256
    SAS: 397, Size 14.14: S259, K245, S250, L251, G252, T254, L256
    SAS: 396, Size 21.52: S158, R164, S126, V102, G100, S99, L124
    Epi#19
    SAS: 295, Size 15.06: D175, W6, S9, Q12, R10
    SAS: 278, Size 21.23: E110, T141, S236, Q239, R241
    Epi#23
    SAS: 486, Size 19.88: R143, N114, E110, S139, Q135, A131
    SAS: 473, Size 18.68: R19, N18, E265, L21, Q230, P233
    SAS: 468, Size 15.74: R164, N167, E134, S139, Q135, A131
    SAS: 463, Size 13.77: R164, N167, E134, S130, Q135, A131
    SAS: 461, Size 21.98: R44, N42, E87, S24, Q230, P233
    Epi#28
    SAS: 520, Size 19.27: V102, Q107, W111, E110, Q135, S139, R143
    SAS: 492, Size 24.70: V102, Q107, F49, E53, Q57, G46, R44
    SAS: 480, Size 22.76: V50, Q107, W111, E110, Q135, S139, R143
    SAS: 452, Size 19.08: V50, Q107, F49, E53, Q57, G46, R44
    SAS: 441, Size 24.70: V102, Q107, E110, W111, F49, G46, R44
    Epi#29
    SAS: 239, Size 11.49: G20, N18, L21, E265
    SAS: 224, Size 11.49: G20, R19, L21, E265
    SAS: 179, Size 16.62: I4, P14, L21, E265
    SAS: 175, Size 11.49: G20, K231, L21, E265
    SAS: 153, Size 18.96: G25, Q230, L21, E265
    Epi#30
    SAS: 308, Size 24.27: G20, L21, A15, H17, S85, L73, P39
    Epi#31
    SAS: 363, Size 21.72: L256, R180, N178, R10, W6, V197, D211
    SAS: 352, Size 22.95: L251, R180, N178, R10, W6, V197, D211
    SAS: 350, Size 21.62: L256, R180, N178, R10, W6, V197, D175
    SAS: 339, Size 17.75: L251, R180, N178, R10, W6, V197, D175
    Epi#34
    SAS: 430, Size 18.33: V238, W235, S236, G144, R143, S139, S142
    SAS: 430, Size 18.33: V238, W235, S236, G144, R143, S142, S139
    SAS: 420, Size 13.98: V238, W235, S236, G144, R143, S142, T141
    SAS: 420, Size 13.98: V238, W235, S236, G144, R143, T141, S142
    SAS: 352, Size 18.33: V238, W235, S236, G144, R143, S139, T141
    Epi#37
    SAS: 415, Size 23.06: T254, A188, L256, R180, N177
    SAS: 374, Size 18.08: T254, A188, L256, R180, N179
    SAS: 335, Size 19.96: T254, A188, L256, R180, N178
    Epi#39
    SAS: 425, Size 16.00: A166, E134, R164, P127, G125, L124
    SAS: 421, Size 16.36: A131, E134, R164, P127, G125, L124
    SAS: 400, Size 16.00: A166, E134, R164, P129, G125, L124
    SAS: 396, Size 16.36: A131, E134, R164, P129, G125, L124
    SAS: 359, Size 16.00: A166, E134, T132, P129, G125, L124
    Epi#40
    SAS: 358, Size 15.76: A166, G189, Y186, A188, T254
    SAS: 352, Size 15.76: A166, G189, T254, A188, S158
    SAS: 326, Size 11.62: A96, G59, T56, P54, S55
    SAS: 322, Size 15.30: G98, G59, T56, P54, S55
    SAS: 318, Size 17.81: A188, G189, Y186, A156, S182
    Epi#42
    SAS: 528, Size 16.22: L21, P14, S9, Q12, H17, R19, R269
    Epi#44
    SAS: 401, Size 15.10: L256, R180, Y186, S158, A188, T254
    SAS: 393, Size 15.52: L256, R180, Y186, A188, G189, T254
    SAS: 390, Size 18.46: L251, R180, Y186, S158, A188, T254
    SAS: 382, Size 16.23: L251, R180, Y186, A188, G189, T254
    SAS: 376, Size 22.23: V197, R180, Y186, S158, A188, T254
    Epi#46
    SAS: 559, Size 12.63: A15, R269, R19, P14, N18, G20
    Epi#53
    SAS: 298, Size 9.48: W235, S234, Q230, K231
    SAS: 298, Size 18.05: W235, S234, Q239, K245
    SAS: 289, Size 9.48: W235, P233, Q230, K231
    SAS: 283, Size 9.61: W235, S234, Q239, K229
    SAS: 255, Size 14.51: W235, S236, Q239, K245
    ProteaseC:
    Epi#05
    SAS: 445, Size 23.34: G189, A166, R164, P127, G125, S99
    SAS: 445, Size 24.90: G189, A188, R164, P127, G125, S99
    SAS: 433, Size 24.90: G157, A188, R164, P127, G125, S99
    SAS: 427, Size 15.89: G189, A188, R164, P127, G125, S128
    SAS: 427, Size 15.50: G189, A166, R164, P127, G125, S128
    Epi#09
    SAS: 463, Size 15.74: T254, G189, A166, R164, A188, S158
    SAS: 425, Size 15.74: D191, G189, A166, R164, A188, T254
    SAS: 384, Size 13.57: D191, G189, A166, R164, A188, S158
    Epi#10
    SAS: 445, Size 17.28: D175, N177, N179, S182, F183, G155, R180
    SAS: 431, Size 13.75: D175, N212, N153, S182, F183, G155, R180
    SAS: 403, Size 15.83: D175, N212, N153, S154, F183, G155, R180
    SAS: 387, Size 16.14: D175, N178, N179, S182, F183, G155, R180
    SAS: 373, Size 16.76: D175, N212, N153, A156, F183, G155, R180
    Epi#12
    SAS: 292, Size 13.45: P127, Y161, E134, P129
    SAS: 287, Size 9.30: R44, Y89, E87, N42
    SAS: 284, Size 9.35: R164, Y161, E134, P129
    SAS: 282, Size 9.35: R164, Y165, E134, P129
    SAS: 272, Size 16.85: P127, Y161, E134, N167
    Epi#16
    SAS: 547, Size 20.59: R164, P129, Y165, G189, S158, N255, D191,
    A166, N167
    SAS: 543, Size 23.80: R164, P129, Y165, G189, S158, N255, D191,
    A166, N138
    Epi#17
    SAS: 267, Size 15.84: A188, S158, R164, S126
    SAS: 231, Size 12.82: A156, S158, R164, S126
    Epi#18
    SAS: 449, Size 16.85: S182, R180, L256, A188, T254, L251
    SAS: 426, Size 21.97: S126, R164, S158, A188, T254, L256
    SAS: 407, Size 15.92: S182, R180, L251, G252, T254, L256
    SAS: 407, Size 15.92: S182, R180, L256, G252, T254, L251
    SAS: 391, Size 18.26: S182, R180, L256, G252, S250, L251
    Epi#19
    SAS: 293, Size 15.04: D175, W6, S9, Q12, R10
    SAS: 291, Size 17.13: D191, N242, S236, Q239, R241
    SAS: 273, Size 21.24: E110, T141, S236, Q239, R241
    Epi#23
    SAS: 463, Size 19.84: R143, N114, E110, S139, Q135, A131
    SAS: 451, Size 15.68: R164, N167, E134, S139, Q135, A131
    SAS: 443, Size 21.95: R44, N42, E87, S24, Q230, P233
    SAS: 440, Size 22.70: R143, N115, E110, S139, Q135, A131
    SAS: 431, Size 15.11: R44, N42, E87, S85, L73, P39
    Epi#28
    SAS: 402, Size 18.79: G59, Q57, E53, F49, G46, R44
    SAS: 384, Size 20.81: A96, Q57, E53, F49, G46, R44
    SAS: 376, Size 18.79: A47, Q57, E53, F49, G46, R44
    Epi#31
    SAS: 348, Size 21.63: L256, R180, N178, R10, W6, V197, D175
    SAS: 342, Size 17.75: L251, R180, N178, R10, W6, V197, D175
    Epi#33
    SAS: 399, Size 18.88: Q107, Y102, P129, S126, R164
    SAS: 355, Size 15.95: Q135, Y165, P129, S126, R164
    Epi#34
    SAS: 424, Size 18.37: V238, W235, S236, G144, R143, S139, S142
    SAS: 424, Size 18.37: V238, W235, S236, G144, R143, S142, S139
    SAS: 408, Size 14.02: V238, W235, S236, G144, R143, S142, T141
    SAS: 408, Size 14.02: V238, W235, S236, G144, R143, T141, S142
    SAS: 346, Size 18.37: V238, W235, S236, G144, R143, T141, S139
    Epi#37
    SAS: 405, Size 23.05: T254, A188, L256, R180, N177
    SAS: 364, Size 18.08: T254, A188, L256, R180, N179
    SAS: 347, Size 19.96: T254, A188, L256, R180, N178
    Epi#40
    SAS: 368, Size 15.74: A166, G189, T254, A188, S158
    SAS: 362, Size 15.74: A166, G189, Y186, A188, T254
    SAS: 326, Size 17.80: A188, G189, Y186, A156, S182
    SAS: 326, Size 23.72: A166, G189, Y186, A156, S182
    SAS: 326, Size 17.80: G189, A188, Y186, A156, S182
    Epi#41
    SAS: 232, Size 19.49: P204, Y208, L211, V197, S210
    Epi#44
    SAS: 445, Size 22.71: V238, R241, D191, Y186, S158, A188, T254
    SAS: 429, Size 21.14: V238, R241, D191, Y186, A188, G189, T254
    SAS: 410, Size 22.71: V238, R241, D191, Y186, S158, G189, T254
    SAS: 404, Size 23.33: V238, R241, D191, Y257, S250, G252, T254
    SAS: 382, Size 23.33: V238, R241, D191, Y257, S253, G252, T254
    Epi#46
    SAS: 567, Size 12.67: A15, R269, R19, P14, N18, G20
    Epi#53
    SAS: 305, Size 9.43: W235, S234, Q230, K231
    SAS: 303, Size 9.53: W235, S234, Q239, K229
    SAS: 276, Size 9.43: W235, P233, Q230, K231
    SAS: 259, Size 9.43: W235, S234, Q230, K229
    SAS: 233, Size 9.53: W235, S236, Q239, K229
    ProteaseD:
    Epi#05
    SAS: 453, Size 24.94: G189, A188, R164, P127, G125, S99
    SAS: 449, Size 23.37: G189, A166, R164, P127, G125, S99
    SAS: 442, Size 24.94: G157, A188, R164, P127, G125, S99
    SAS: 439, Size 15.91: G189, A188, R164, P127, G125, S128
    SAS: 435, Size 15.50: G189, A166, R164, P127, G125, S128
    Epi#09
    SAS: 448, Size 15.77: T254, G189, A166, R164, A188, S158
    Epi#10
    SAS: 460, Size 17.32: D175, N177, N179, S182, F183, G155, R180
    SAS: 428, Size 13.76: D175, N212, N153, S182, F183, G155, R180
    SAS: 403, Size 15.83: D175, N212, N153, S154, F183, G155, R180
    SAS: 391, Size 16.15: D175, N178, N179, S182, F183, G155, R180
    SAS: 372, Size 16.77: D175, N212, N153, A156, F183, G155, R180
    Epi#12
    SAS: 302, Size 13.47: P127, Y161, E134, P129
    SAS: 290, Size 9.39: R164, Y161, E134, P129
    SAS: 282, Size 18.68: P127, Y161, E134, N138
    SAS: 280, Size 16.87: P127, Y161, E134, N167
    SAS: 270, Size 13.10: R164, Y161, E134, N138
    Epi#17
    SAS: 286, Size 15.87: A188, S158, R164, S126
    SAS: 250, Size 12.76: A156, S158, R164, S126
    Epi#18
    SAS: 446, Size 16.31: S250, K245, S259, L256, A188, T254, L251
    SAS: 406, Size 14.13: S250, K245, S259, L256, G252, T254, L251
    SAS: 406, Size 14.13: S250, K245, S259, L251, G252, T254, L256
    SAS: 406, Size 14.13: S259, K245, S250, L251, G252, T254, L256
    SAS: 388, Size 14.13: S250, K245, S259, L256, G252, T249, L251
    Epi#19
    SAS: 319, Size 15.07: D175, W6, S9, Q12, R10
    SAS: 276, Size 21.28: E110, T141, S236, Q239, R241
    Epi#23
    SAS: 497, Size 19.86: R143, N114, E110, S139, Q135, A131
    SAS: 487, Size 15.77: R164, N167, E134, S139, Q135, A131
    SAS: 478, Size 13.78: R164, N167, E134, S130, Q135, A131
    SAS: 477, Size 18.16: R143, N138, E134, S139, Q135, A131
    SAS: 472, Size 22.70: R143, N115, E110, S139, Q135, A131
    Epi#28
    SAS: 554, Size 22.17: A101, Q107, I102, E134, Q135, S139, R143
    SAS: 532, Size 19.36: I102, Q107, W111, E110, Q135, S139, R143
    SAS: 527, Size 22.79: V50, Q107, I102, E134, Q135, S139, R143
    SAS: 509, Size 24.76: I102, Q107, F49, E53, Q57, G46, R44
    SAS: 508, Size 22.17: A101, Q107, W111, E110, Q135, S139, R143
    Epi#31
    SAS: 355, Size 21.56: L256, R180, N178, R10, W6, V197, D175
    SAS: 352, Size 17.71: L251, R180, N178, R10, W6, V197, D175
    Epi#34
    SAS: 457, Size 18.37: V238, W235, S236, G144, R143, S139, S142
    SAS: 457, Size 18.37: V238, W235, S236, G144, R143, S142, S139
    SAS: 447, Size 14.02: V238, W235, S236, G144, R143, S142, T141
    SAS: 447, Size 14.02: V238, W235, S236, G144, R143, T141, S142
    SAS: 374, Size 18.37: V238, W235, S236, G144, R143, T141, S139
    Epi#37
    SAS: 397, Size 23.08: T254, A188, L256, R180, N177
    SAS: 361, Size 18.08: T254, A188, L256, R180, N179
    SAS: 328, Size 19.98: T254, A188, L256, R180, N178
    Epi#39
    SAS: 425, Size 16.36: A131, E134, R164, P127, G125, L124
    SAS: 423, Size 16.02: A166, E134, R164, P127, G125, L124
    SAS: 399, Size 16.36: A131, E134, R164, P129, G125, L124
    SAS: 397, Size 16.02: A166, E134, R164, P129, G125, L124
    SAS: 379, Size 16.36: A131, E134, T132, P129, G125, L124
    Epi#40
    SAS: 354, Size 15.77: A166, G189, T254, A188, S158
    SAS: 351, Size 15.77: A166, G189, Y186, A188, T254
    SAS: 334, Size 17.81: G189, A188, Y186, A156, S182
    SAS: 334, Size 17.81: A188, G189, Y186, A156, S182
    SAS: 330, Size 14.42: A166, G189, Y186, A188, S158
    Epi#41
    SAS: 217, Size 19.46: P204, Y208, L211, V197, S210
    Epi#44
    SAS: 407, Size 15.10: L256, R180, Y186, S158, A188, T254
    SAS: 404, Size 18.45: L251, R180, Y186, S158, A188, T254
    SAS: 387, Size 15.52: L256, R180, Y186, A188, G189, T254
    SAS: 384, Size 16.23: L251, R180, Y186, A188, G189, T254
    SAS: 373, Size 22.26: V197, R180, Y186, S158, A188, T254
    Epi#46
    SAS: 545, Size 12.69: A15, R269, R19, P14, N18, G20
    Epi#53
    SAS: 306, Size 18.06: W235, S234, Q239, K245
    SAS: 277, Size 9.52: W235, S234, Q239, K229
    SAS: 276, Size 9.46: W235, S234, Q230, K231
    SAS: 268, Size 9.46: W235, P233, Q230, K231
    SAS: 258, Size 14.50: W235, S236, Q239, K245
    ProteaseE:
    Epi#05
    SAS: 461, Size 15.49: G189, A166, R164, P127, G125, S128
    SAS: 459, Size 15.90: G189, A188, R164, P127, G125, S128
    SAS: 435, Size 15.49: G189, A166, R164, P127, G125, S126
    SAS: 433, Size 15.49: G189, A166, R164, P129, G125, S128
    SAS: 433, Size 15.86: G189, A188, R164, P127, G125, S126
    Epi#06
    SAS: 518, Size 14.10: G189, A188, D157, S158, R164, P127
    SAS: 490, Size 15.98: G189, A188, D157, S158, R164, P129
    SAS: 460, Size 14.60: G155, A156, D157, S158, R164, P127
    SAS: 432, Size 17.71: G155, A156, D157, S158, R164, P129
    Epi#09
    SAS: 482, Size 15.78: T254, G189, A166, R164, A188, S158
    SAS: 311, Size 15.91: T22, G20, L21, R19, A15, S9
    Epi#10
    SAS: 455, Size 17.26: D175, N177, N179, S182, F183, G155, R180
    SAS: 406, Size 13.76: D175, N212, N153, S182, F183, G155, R180
    SAS: 383, Size 16.16: D175, N178, N179, S182, F183, G155, R180
    SAS: 381, Size 15.82: D175, N212, N153, S154, F183, G155, R180
    SAS: 347, Size 16.78: D175, N212, N153, A156, F183, G155, R180
    Epi#12
    SAS: 310, Size 13.48: P127, Y161, E134, P129
    SAS: 306, Size 9.40: R164, Y161, E134, P129
    SAS: 297, Size 9.40: R164, Y165, E134, P129
    SAS: 285, Size 16.90: P127, Y161, E134, N167
    SAS: 281, Size 18.68: P127, Y161, E134, N138
    Epi#16
    SAS: 673, Size 19.67: R164, P127, Y161, G125, S126, S154, D157,
    A188, N255
    SAS: 664, Size 20.60: R164, P129, Y165, G189, S158, S154, D157,
    A188, N255
    SAS: 645, Size 20.60: R164, P129, Y161, G125, S126, S154, D157,
    A188, N255
    SAS: 636, Size 14.89: R164, P127, Y161, G125, S126, S154, D157,
    A156, N153
    SAS: 627, Size 17.25: R164, P129, Y165, G189, S158, S154, D157,
    A156, N153
    Epi#17
    SAS: 305, Size 15.86: A188, S158, R164, S126
    SAS: 270, Size 12.73: A156, S158, R164, S126
    Epi#18
    SAS: 590, Size 17.32: S250, K246, S259, L256, A188, T254, L251
    SAS: 551, Size 16.26: S259, K246, S250, L251, G252, T254, L256
    SAS: 551, Size 16.26: S250, K246, S259, L251, G252, T254, L256
    SAS: 551, Size 16.26: S250, K246, S259, L256, G252, T254, L251
    SAS: 518, Size 16.26: S250, K246, S259, L251, G252, S253, L256
    Epi#23
    SAS: 471, Size 19.86: R143, N114, E110, S139, Q135, A131
    SAS: 467, Size 13.75: R164, N167, E134, S130, Q135, A131
    SAS: 467, Size 15.76: R164, N167, E134, S139, Q135, A131
    SAS: 451, Size 22.69: R143, N115, E110, S139, Q135, A131
    SAS: 446, Size 19.99: R143, N138, E134, S130, Q135, A131
    Epi#28
    SAS: 505, Size 19.43: I102, Q107, W111, E110, Q135, S139, R143
    SAS: 500, Size 22.22: A101, Q107, W111, E110, Q135, S139, R143
    SAS: 499, Size 24.79: I102, Q107, F49, E53, Q57, G46, R44
    SAS: 494, Size 24.56: A101, Q107, F49, E53, Q57, G46, R44
    SAS: 441, Size 24.79: I102, Q107, E110, W111, F49, G46, R44
    Epi#29
    SAS: 216, Size 9.94: I43, R44, L41, E87
    SAS: 209, Size 10.85: L73, N42, L41, E87
    SAS: 200, Size 13.98: G46, R44, L41, E87
    SAS: 199, Size 11.98: G45, R44, L41, E87
    SAS: 197, Size 19.08: I77, N74, L41, E87
    Epi#30
    SAS: 318, Size 24.25: G20, L21, A15, H17, S85, L73, P39
    SAS: 277, Size 24.25: G20, L21, A15, H17, S85, L41, P39
    SAS: 258, Size 21.05: G20, L21, A15, H17, S85, L73, L41
    Epi#31
    SAS: 377, Size 21.62: L256, R180, N178, R10, W6, V197, D175
    SAS: 370, Size 17.72: L251, R180, N178, R10, W6, V197, D175
    Epi#33
    SAS: 388, Size 15.92: Q135, Y165, P129, S126, R164
    Epi#34
    SAS: 420, Size 18.35: V238, W235, S236, G144, R143, S139, S142
    SAS: 411, Size 13.98: V238, W235, S236, G144, R143, S142, T141
    SAS: 341, Size 18.35: V238, W235, S236, G144, R143, S139, T141
    Epi#37
    SAS: 412, Size 23.05: T254, A188, L256, R180, N177
    SAS: 378, Size 18.07: T254, A188, L256, R180, N179
    SAS: 340, Size 20.00: T254, A188, L256, R180, N178
    Epi#39
    SAS: 445, Size 16.04: A166, E134, R164, P127, G125, L124
    SAS: 432, Size 16.40: A131, E134, R164, P127, G125, L124
    SAS: 417, Size 16.04: A166, E134, R164, P129, G125, L124
    SAS: 404, Size 16.40: A131, E134, R164, P129, G125, L124
    SAS: 376, Size 16.04: A166, E134, T132, P129, G125, L124
    Epi#40
    SAS: 374, Size 15.78: A166, G189, T254, A188, S158
    SAS: 334, Size 15.78: A166, G189, Y186, A188, T254
    SAS: 317, Size 11.62: A96, G59, T56, P54, S55
    SAS: 312, Size 15.30: G98, G59, T56, P54, S55
    SAS: 307, Size 15.49: G189, A166, Y165, P129, S128
    Epi#41
    SAS: 234, Size 19.50: P204, Y208, L211, V197, S210
    SAS: 189, Size 19.50: P204, Y208, L211, V197, S215
    Epi#42
    SAS: 549, Size 16.42: L21, P14, S9, Q12, H17, R19, R269
    Epi#44
    SAS: 398, Size 15.10: L256, R180, Y186, S158, A188, T254
    SAS: 391, Size 18.47: L251, R180, Y186, S158, A188, T254
    SAS: 372, Size 15.51: L256, R180, Y186, A188, G189, T254
    SAS: 371, Size 12.26: L256, R180, Y257, S250, G252, T254
    SAS: 367, Size 15.51: L256, R180, Y186, S158, G189, T254
    Epi#46
    SAS: 575, Size 12.75: A15, R269, R19, P14, N18, G20
    Epi#47
    SAS: 491, Size 19.28: G45, E87, I43, R44, L41, N42, P39, S206
    Epi#53
    SAS: 202, Size 9.12: W235, P233, K231
    SAS: 199, Size 9.12: W235, S234, K231
    SAS: 182, Size 6.73: W235, P233, K229
    SAS: 179, Size 7.76: W235, S234, K229
    SAS: 131, Size 8.39: W235, S236, K229
    Properase:
    Epi#05
    SAS: 456, Size 15.94: G189, A188, R164, P127, G125, S128
    SAS: 453, Size 15.52: G189, A166, R164, P127, G125, S128
    SAS: 451, Size 15.94: G157, A188, R164, P127, G125, S128
    SAS: 427, Size 15.94: G189, A188, R164, P129, G125, S128
    SAS: 424, Size 15.52: G189, A166, R164, P129, G125, S128
    Epi#09
    SAS: 480, Size 15.73: T254, G189, A166, R164, A188, S158
    SAS: 302, Size 15.88: T22, G20, L21, R19, A15, S9
    Epi#10
    SAS: 470, Size 17.27: D175, N177, N179, S182, F183, G155, R180
    SAS: 446, Size 13.75: D175, N212, N153, S182, F183, G155, R180
    SAS: 420, Size 15.84: D175, N212, N153, S154, F183, G155, R180
    SAS: 396, Size 16.09: D175, N178, N179, S182, F183, G155, R180
    SAS: 380, Size 16.78: D175, N212, N153, A156, F183, G155, R180
    Epi#12
    SAS: 296, Size 9.36: R164, Y161, E134, P129
    SAS: 295, Size 13.45: P127, Y161, E134, P129
    SAS: 291, Size 9.36: R164, Y165, E134, P129
    SAS: 271, Size 14.70: R164, Y161, E134, N102
    SAS: 270, Size 13.45: P127, Y161, E134, N102
    Epi#17
    SAS: 283, Size 15.87: A188, S158, R164, S126
    SAS: 241, Size 12.73: A156, S158, R164, S126
    Epi#18
    SAS: 474, Size 16.26: S250, K245, S259, L256, A188, T254, L251
    SAS: 435, Size 14.14: S250, K245, S259, L256, G252, T254, L251
    SAS: 398, Size 14.14: S259, K245, S250, L251, G252, S253, L256
    Epi#19
    SAS: 260, Size 21.26: E110, T141, S236, Q239, R241
    Epi#23
    SAS: 491, Size 19.86: R143, N114, E110, S139, Q135, A131
    SAS: 482, Size 15.76: R164, N167, E134, S139, Q135, A131
    SAS: 465, Size 22.69: R143, N115, E110, S139, Q135, A131
    SAS: 462, Size 18.17: R143, N138, E134, S139, Q135, A131
    SAS: 439, Size 18.17: R143, N138, E110, S139, Q135, A131
    Epi#28
    SAS: 445, Size 22.79: V50, Q107, W111, E110, Q135, S139, R143
    SAS: 426, Size 19.06: V50, Q107, F49, E53, Q57, G46, R44
    SAS: 370, Size 19.06: V50, Q107, E110, W111, F49, G46, R44
    Epi#31
    SAS: 347, Size 21.62: L256, R180, N178, R10, W6, V197, D175
    SAS: 339, Size 17.74: L251, R180, N178, R10, W6, V197, D175
    Epi#33
    SAS: 368, Size 15.95: Q135, Y165, P129, S126, R164
    Epi#34
    SAS: 445, Size 18.39: V238, W235, S236, G144, R143, S139, S142
    SAS: 436, Size 14.07: V238, W235, S236, G144, R143, S142, T141
    SAS: 358, Size 18.39: V238, W235, S236, G144, R143, T141, S139
    Epi#37
    SAS: 415, Size 23.03: T254, A188, L256, R180, N177
    SAS: 374, Size 18.04: T254, A188, L256, R180, N179
    SAS: 341, Size 19.93: T254, A188, L256, R180, N178
    Epi#39
    SAS: 323, Size 11.55: A15, E265, H17, R19, P14, G20, L21
    SAS: 238, Size 12.13: A15, E265, H17, T22, P14, G20, L21
    Epi#40
    SAS: 370, Size 15.73: A166, G189, T254, A188, S158
    SAS: 360, Size 15.73: A166, G189, Y186, A188, T254
    SAS: 324, Size 17.80: A188, G189, Y186, A156, S182
    SAS: 321, Size 23.71: A166, G189, Y186, A156, S182
    Epi#41
    SAS: 228, Size 19.53: P204, Y208, L211, V197, S210
    Epi#42
    SAS: 554, Size 16.31: L21, P14, S9, Q12, H17, R19, R269
    Epi#44
    SAS: 406, Size 15.06: L256, R180, Y186, S158, A188, T254
    SAS: 398, Size 18.38: L251, R180, Y186, S158, A188, T254
    SAS: 395, Size 12.22: L256, R180, Y257, S250, G252, T254
    SAS: 392, Size 15.49: L256, R180, Y186, A188, G189, T254
    SAS: 387, Size 12.22: L251, R180, Y257, S250, G252, T254
    Epi#46
    SAS: 581, Size 12.65: A15, R269, R19, P14, N18, G20
    Epi#53
    SAS: 297, Size 18.06: W235, S234, Q239, K245
    SAS: 283, Size 9.54: W235, S234, Q239, K229
    SAS: 250, Size 9.46: W235, S234, Q230, K231
    SAS: 249, Size 14.49: W235, S236, Q239, K245
    SAS: 247, Size 9.46: W235, P233, Q230, K231
    Relase:
    Epi#05
    SAS: 461, Size 17.25: G158, A189, R165, P128, G126, S129
    SAS: 439, Size 17.22: G158, A189, R165, P128, G126, S127
    SAS: 436, Size 17.25: G158, A189, S159, P128, G126, S129
    SAS: 420, Size 17.25: G158, A189, R165, P130, G126, S129
    SAS: 414, Size 17.22: G158, A189, S159, P128, G126, S127
    Epi#09
    SAS: 510, Size 22.37: T22, G20, R19, A15, R270, A267, T250
    SAS: 501, Size 22.37: L21, G20, R19, A15, R270, A267, T250
    Epi#10
    SAS: 458, Size 17.50: D176, N178, N180, S183, F184, G156, R181
    SAS: 424, Size 13.68: D176, N213, N154, S183, F184, G156, R181
    SAS: 407, Size 15.87: D176, N213, N154, S155, F184, G156, R181
    SAS: 392, Size 16.18: D176, N179, N180, S183, F184, G156, R181
    SAS: 362, Size 16.73: D176, N213, N154, A157, F184, G156, R181
    Epi#12
    SAS: 323, Size 9.38: R45, Y90, E88, N43
    SAS: 312, Size 13.53: P128, Y162, E135, P130
    SAS: 302, Size 9.46: R165, Y162, E135, P130
    SAS: 296, Size 9.46: R165, Y166, E135, P130
    SAS: 295, Size 13.19: T255, Y187, E190, S159
    Epi#18
    SAS: 431, Size 15.20: S251, K246, S260, L257, A189, T255, L252
    SAS: 398, Size 14.35: S251, K246, S260, L252, G253, T255, L257
    SAS: 378, Size 14.35: S251, K246, S260, L257, G253, T250, L252
    Epi#19
    SAS: 285, Size 21.53: E111, T142, S237, Q240, R242
    SAS: 275, Size 12.58: D119, T142, S237, Q240, R242
    Epi#23
    SAS: 512, Size 22.29: R45, N43, E88, S24, Q231, P234
    SAS: 476, Size 19.71: R144, N115, E111, S140, Q136, A132
    SAS: 460, Size 13.83: R165, N168, E135, S131, Q136, A132
    SAS: 455, Size 20.11: R144, N139, E135, S131, Q136, A132
    SAS: 452, Size 15.83: R165, N168, E135, S140, Q136, A132
    Epi#25
    SAS: 293, Size 13.93: R45, K27, D119, E88
    Epi#28
    SAS: 502, Size 19.99: V103, Q108, W112, E111, Q136, S140, R144
    SAS: 476, Size 21.74: V51, Q108, F50, E54, Q58, S37, R45
    SAS: 472, Size 24.93: V103, Q108, F50, E54, Q58, G47, R45
    SAS: 469, Size 23.18: V51, Q108, W112, E111, Q136, S140, R144
    SAS: 439, Size 19.16: V51, Q108, F50, E54, Q58, G47, R45
    Epi#31
    SAS: 354, Size 21.73: L257, R181, N179, R10, W6, V198, D176
    SAS: 348, Size 17.85: L252, R181, N179, R10, W6, V198, D176
    Epi#33
    SAS: 396, Size 22.75: Q201, Y204, P205, S37, R45
    SAS: 379, Size 22.75: Q201, Y209, P205, S37, R45
    SAS: 357, Size 18.39: H63, Y204, P205, S37, R45
    Epi#34
    SAS: 466, Size 13.97: V239, W236, S237, G145, R144, S143, T142
    SAS: 463, Size 18.37: V239, W236, S237, G145, R144, S140, S143
    SAS: 387, Size 18.37: V239, W236, S237, G145, R144, S140, T142
    Epi#36
    SAS: 206, Size 22.37: T250, A267, A15, G20, T22
    Epi#37
    SAS: 400, Size 22.59: T255, A189, L257, R181, N178
    SAS: 359, Size 17.59: T255, A189, L257, R181, N180
    SAS: 334, Size 19.35: T255, A189, L257, R181, N179
    Epi#39
    SAS: 464, Size 16.36: A167, E135, R165, P128, G126, L125
    SAS: 444, Size 16.52: A132, E135, R165, P128, G126, L125
    SAS: 441, Size 16.36: A167, E190, R165, P128, G126, L125
    SAS: 441, Size 18.98: A189, E190, R165, P128, G126, L125
    SAS: 423, Size 16.36: A167, E135, R165, P130, G126, L125
    Epi#40
    SAS: 324, Size 11.66: A97, G60, T57, P55, S56
    SAS: 316, Size 17.09: G158, A189, Y187, A157, S183
    SAS: 307, Size 14.92: G158, A157, Y187, A189, T255
    SAS: 307, Size 15.34: G99, G60, T57, P55, S56
    Epi#41
    SAS: 222, Size 19.74: P205, Y209, L212, V198, S211
    Epi#42
    SAS: 544, Size 16.22: L21, P14, S9, Q12, H17, R19, R270
    Epi#44
    SAS: 421, Size 14.87: L257, R181, Y187, S159, A189, T255
    SAS: 415, Size 18.81: L252, R181, Y187, S159, A189, T255
    SAS: 389, Size 22.36: V198, R181, Y187, S159, A189, T255
    SAS: 389, Size 21.81: I44, R45, Y90, A48, V51, P52
    SAS: 386, Size 19.16: I44, R45, Y90, A48, V51, P55
    Epi#46
    SAS: 557, Size 14.54: A267, R270, R19, P14, N18, G20
    SAS: 553, Size 12.63: A15, R270, R19, P14, N18, G20
    SAS: 540, Size 13.10: A267, R270, R19, P14, N18, A15
    SAS: 444, Size 14.54: A267, R270, R19, P14, G20, A15
    Epi#47
    SAS: 627, Size 16.22: A267, R270, A15, R19, L21, N18, P14, S9
    SAS: 436, Size 15.11: A267, E266, A15, R19, L21, N18, P14, S9
    Epi#51
    SAS: 545, Size 21.66: L21, R19, H17, D75, S77, I78, S3, W6
    SAS: 485, Size 21.66: L21, R19, H17, D75, Q2, I78, S3, W6
    Epi#53
    SAS: 328, Size 9.43: W236, S235, Q231, K232
    SAS: 316, Size 9.43: W236, P234, Q231, K232
    SAS: 301, Size 18.21: W236, S235, Q240, K246
    SAS: 246, Size 14.68: W236, S237, Q240, K246

    “SAS” is solvent accessible surface.

    “Size” is the total suface area of the epitope in Å2.
  • Example 12
  • The object of this example is to provide evidence showing that subtilisins with an homology to BPN′ of as low as 44,8% reveal a similar epitope distribution as BPN′.
  • Alcalase, Protease B, Savinase, Esperase, and PD498 (which range from 44.8% to 69.5% in sequence identity to BPN′) were epitope mapped as described in the above example, and compared with epitope mapped BPN′ (FIG. 1).
  • The data in FIG. 1 show a significant overlap between the areas on the primary structure of the respective proteases. Overall, 6 regions were identified: 1-20, 35-65, 95-115, 130-145, 170-220, and 260-270.
  • Even better overlap between the epitope sequences can be found among proteins of higher sequence identity, such as within the Savinase-like subtilisins with more than 81% identity, preferably more than 85%, more preferably more than 90%, even more preferably more than 96% or most preferably more than 98% identity.
  • Example 13 Wash Performance
  • The following example provides results from a number of washing tests that were conducted under the conditions indicated
    TABLE 9
    Experimental conditions for evaluation of Subtilisin variants I44V.
    Detergent OMO Acao
    Detergent dose 2.5 g/l
    PH 10.5
    Wash time 14 min.
    Temperature 25° C.
    Water hardness 9°dH
    Enzymes Subtilisin variant I44V
    Enzyme conc. 10 nM
    Test system 150 ml glass beakers with a stirring rod
    Textile/volume 5 textile pieces (Ø 2.5 cm) in 50 ml detergent
    Test material EMPA117 from Center for Testmaterials,
    Holland
  • TABLE 10
    Experimental conditions for evaluation of Subtilisin variants Q12D.
    Detergent Persil Powder
    Detergent dose 4 g/l
    PH 10.5
    Wash time 20 min.
    Temperature 30° C.
    Water hardness
    18°dH
    Enzymes Subtilisin variant Q12D
    Enzyme conc. 10 nM
    Test system 150 ml glass beakers with a stirring rod
    Textile/volume 5 textile pieces (Ø 2.5 cm) in 50 ml detergent
    Test material EMPA116 from Center for Testmaterials,
    Holland
  • TABLE 11
    Experimental conditions for evaluation of Subtilisin variants Q12D.
    Detergent Tide
    Detergent dose 1 g/l
    PH 10.5
    Wash time 10 min.
    Temperature 25° C.
    Water hardness
    6°dH
    Enzymes Subtilisin variant Q12D
    Enzyme conc. 10 nM
    Test system 150 ml glass beakers with a stirring rod
    Textile/volume 5 textile pieces (Ø 2.5 cm) in 50 ml detergent
    Test material EMPA117 from Center for Testmaterials,
    Holland
  • pH is adjusted to 10.5 which is within the normal range for a powder detergent.
  • Water hardness was adjusted by adding CaCl2 and MgCl2 (Ca2+:Mg2+=2:1) to deionized water (see also Surfactants in Consumer Products—Theory, Technology and Application, Springer Verlag 1986). pH of the detergent solution was adjusted to pH 10.5 by addition of HCl.
  • Measurement of reflectance (R) on the test material was done at 460 nm using a Macbeth ColorEye 7000 photometer. The measurements were done according to the manufacturers protocol.
  • The wash performance of the variants was evaluated by calculating a performance factor:
    P=(R Variant −R Blank)/(R Savinase −R Blank)
    • P: Performance factor
    • RVariant: Reflectance of test material washed with variant
    • RSavinase: Reflectance of test material washed with Savinase®
    • RBlank: Reflectance of test material washed with no enzyme
  • The variants all have improved wash performance compared to Savinase®—i.e. P>1.
  • The variants can be divided into improvement classes designated with capital letters:
    • Class A: 1<P≦1.5
    • Class B: 1.5<P≦2
    • Class C: P>2
  • TABLE 12
    Subtilisin variants and improvement classes.
    Improvement class Variants
    C I44V, Q12D
  • As it can be seen from Table 12 SAVINASE® variants of the invention exhibits an improvement in wash performance.

Claims (134)

1. A method of selecting a protein variant having modified immunogenicity as compared to a parent protein, comprising the steps of:
(a) obtaining antibody binding peptide sequences,
(b) using the sequences to localise epitope sequences on the 3-dimensional structure of the parent protein,
(c) defining an epitope area including amino acids situated within 5 Å from the epitope amino acids constituting the epitope sequence,
(d) changing one or more of the amino acids defining the epitope area of the parent protein by genetic engineering mutations of a DNA sequence encoding the parent protein,
(e) introducing the mutated DNA sequence into a suitable host, culturing said host and expressing the protein variant, and
(f) evaluating the immunogenicity of the protein variant using the parent protein as reference.
2. The method of claim 1, wherein the sequences of step a) are obtained by screening a random peptide display package library with antibodies raised against any protein of interest and sequencing the amino acid sequence of the antibody binding peptide, or the DNA sequence encoding the antibody binding peptide.
3. The method of claim 2, wherein antibodies for screening the random peptide display package library are raised against the parent protein.
4. The method of claim 2, wherein the peptide display package library is a phage display library.
5. The method of claim 2, wherein the peptides of the peptide display package library are oligopeptides having from 5 to 25 amino acids.
6. The method of claim 1, wherein the antibody binding peptide sequences of step a) are obtained by screening a library of known peptides related to the primary sequence of any protein of interest, with antibodies raised against the protein of interest.
7. The method of claim 1, wherein epitope patterns are identified by sequence alignment of ntibody binding peptide sequences and these epitope patterns are used to quide localisation of pitope sequences on the 3-dimensional structure of the parent protein.
8. The method of claim 1, wherein the epitope area of step c) equals the epitope sequence.
9. The method of claim 1, wherein hot spot amino acids of the parent protein are identified.
10. The method of claim 1, wherein the epitope area is changed by substituting, adding and/or deleting at least one amino acid of the epitope area.
11. The method of claim 10, wherein the epitope area is changed by substituting, adding and/or deleting at least one hot spot amino acid.
12. The method of claim 10, wherein amino acids in the epitope area are changed by substituting and/or inserting at least one amino acid by an amino acid which render the substituted and/or inserted amino acid a target for covalent conjugation to an activated polymer.
13. The method of claim 12, wherein the amino acid for substitution and/or insertion is selected from the group consisting of K, C, D, E.
14. The method of claim 12, wherein the molecule for covalent conjugation is selected from the group of activated synthetic or natural polymers.
15. The method of claim 14, wherein the activated synthetic polymer is a polyethylene glycol.
16. The method of claim 1, wherein the immunogenicity is measured by competitive ELISA.
17. The method of claim 1, wherein the protein variant has reduced allergenicity.
18. The method of claim 17, wherein the allergenicity of the protein variant is below 75%, preferably below 50%, more preferably below 25% of the allergenicity of the parent protein.
19. The method of claim 1, wherein the parent protein is an enzyme or an environmental allergen or a pharmaceutical protein.
20. The method of claim 19, wherein the enzyme is selected from the group consisting of glycosyl hydrolases, carbohydrases, peroxidases, proteases, lipolytic enzymes, phytases, polysaccharide lyases, oxidoreductases, transglutaminases and glucoseisomerases.
21. The method of claim 19, wherein the environmental allergen is selected from the group consisting of pollen, dust mites, mammals, venoms, fungi, food allergens or other plant allergens.
22. A protein variant obtainable by a method of claim 1.
23. A protein variant, wherein the amino acid sequence of the protein variant differs from the amino acid sequence of the parent protein with respect to at least one epitope area of the parent protein.
24. The protein variant of claim 23 having modified immunogenicity as compared to its parent protein.
25. A protein variant of claim 23, wherein the epitope areas are defined on the parent protein structure by being localised less than 5 Å from any of the following epitope patterns: P>S/T D P G; P>>D A G; >P>R D T G; P>S/T D P G; >R Y>K/R; >R S A; >G>>A G; V H>G >; A>I D P R/K; A R>A; Q>Y>D>; >P>>A P>S; R/K R F>N; D/E Q I F F T; A>>>>Y P>; L>G R S; R P P R; >E Y; >P>>P A P>S; >K L>>; K Q S; >K L>>; Y I>K L; R Q>>D/E; N>>E L.
26. The protein variant of claim 22, wherein the epitope areas correspond to antibody binding peptide sequences reactive to antibodies raised against the parent protein.
27. The protein variant of claim 22, wherein the epitope pattern is a IgE epitope pattern.
28. The protein variant of claim 22, wherein at least one hot spot amino acid is substituted or deleted.
29. The protein variant of claim 22, wherein the allergenicity of the protein variant is below 75%, preferably below 50%, more preferably below 25% of the allergenicity of the parent protein.
30. The protein variant of claim 22, wherein the protein variant is an environmental allergen, preferable an allergen selected from the group consisting of pollen, dust mites, mammals, venoms, fungi, food allergens or other plant allergens.
31. The protein variant of claim 22, wherein the protein variant is an antifungal peptide or antimicrobial peptide.
32. The protein variant of claim 30, wherein the allergen is pollen allergen comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 6:
Position T 10 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position V 12 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position P 14 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position A 16 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 17 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position K 20 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position L 24 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position F 30 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position P 31 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position K 32 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position A 34 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 35 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position Q 36 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position A 37 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 39 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position S 40 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position E 42 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 57 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, T, V, W, Y; Position F 58 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 59 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position E 60 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 61 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position L 62 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position P 63 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position F 64 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 65 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position T 77 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position F 79 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 90 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position D 93 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position V 105 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position A 106 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position T 107 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position D 109 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 110 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 123 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position E 127 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 129 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position E 131 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 136 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position G 140 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position L 143 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position R 145 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position S 149 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position Y 150 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position L 152 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position A 153 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 156 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 158 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W.
33. The protein variant of claim 32, wherein the pollen allergen comprises one or more of the following substitutions:
position P31 to A, G, L, or S; position A34 to D, E, F, H, K, N, P, Q, R, W, or Y; position P35 to A, G, L, or S; position A37 to D, E, F, H, K, N, P, Q, R, W, or Y; position S39 to D, E, F, H, K, N, P, Q, R, W, or Y; position S40 to D, E, F, H, K, N, P, Q, R, W, or Y; position P59 to A, G, L, or S; position L62 to D, E, F, H, K, N, P, Q, R, W, or Y; position P63 to A, G, L, or S.
34. The allergen of claim 32, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 6.
35. The pollen allergen of claim 34, wherein the allergen has the amino acid sequence of SEQ ID NO: 6.
36. The protein variant of claim 30, wherein the allergen is mite allergen comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 7:
Position D 1 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Q 2 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position N 11 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position E 12 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 14 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position K 15 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position D 19 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 20 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position H 30 to A, C, D, E, F, G, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 31 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position G 32 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 34 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position T 36 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position L 37 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position E 38 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position A 39 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position L 40 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position D 59 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position L 61 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position E 62 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 64 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position N 71 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position H 74 to A, C, D, E, F, G, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position F 75 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 79 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position Q 85 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position D 87 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 90 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position T 91 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position W 92 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, Y; Position N 93 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position P 95 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position K 96 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position I 97 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; Position A 98 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 99 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position S 101 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position E 102 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position T 123 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position K 126 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position R 128 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position D 129 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y.
37. The mite allergen of claims 36, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 7.
38. The mite allergen of claim 37, wherein the allergen has the amino acid sequence of SEQ ID NO: 7.
39. The protein variant of claim 30, wherein the allergen is mite allergen comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 8:
Position L 17 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position P 19 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position G 20 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 26 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position I 28 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; Position H 30 to A, C, D, E, F, G, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 31 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position P 34 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position F 35 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Q 36 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position K 55 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position A 56 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 57 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position D 59 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 60 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position L 61 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position E 62 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 64 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 66 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position D 69 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 89 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 90 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position T 91 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position W 92 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, Y; Position P 95 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position K 96 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position I 97 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 99 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position K 100 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position E 102 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position N 103 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position T 123 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position A 125 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 128 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y.
40. The mite allergen of claim 39, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 8.
41. The mite allergen of claim 40, wherein the allergen has the amino acid sequence of SEQ ID NO: 8.
42. The protein variant of claim 30, wherein the allergen comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 9:
Position V 1 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position E 9 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 10 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position N 13 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position E 14 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 15 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position H 16 to A, C, D, E, F, G, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position A 18 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 34 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position H 36 to A, C, D, E, F, G, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 37 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 38 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position W 41 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, Y; Position V 42 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position A 43 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position F 54 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 55 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 56 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position E 57 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 59 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position L 60 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position Q 61 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position P 63 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position R 67 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position L 69 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position D 79 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 84 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 85 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position T 87 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position P 94 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y.
43. The allergen of claims 42, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 9.
44. The allergen of claim 43, wherein the allergen has the amino acid sequence of SEQ ID NO: 9.
45. The protein variant of claim 30, wherein the allergen comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 12:
Position I 1 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 18 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 41 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 43 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 65 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 70 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position K 113 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position G 114 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 116 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position P 119 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position E 120 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position L 122 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position K 124 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position Q 126 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position Q 127 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position S 130 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position R 132 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position I 139 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; Position I 143 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y.
46. The allergen of claim 45, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 12.
47. The allergen of claim 46, wherein the allergen has the amino acid sequence of SEQ ID NO: 12.
48. The protein variant of claim 30, wherein the allergen is a mammal allergen comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 13:
Position S 9 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position S 12 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position Y 16 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position D 23 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position V 40 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position R 42 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position A 43 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position L 44 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position Y 50 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position D 69 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position N 80 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position Y 84 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position P 110 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position Q 112 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position E 120 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 121 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position D 122 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 129 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position K 133 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position G 139 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 142 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position Q 156 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position L 157 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position R 158 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position G 159 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y.
49. The allergen of claim 48, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 13.
50. The allergen of claim 49, wherein the allergen has the amino acid sequence of SEQ ID NO: 13.
51. The protein variant of claim 30, wherein the allergen comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 15:
Position K 1 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position S 24 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position E 35 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 45 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position T 47 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position D 52 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 53 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position N 59 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position R 61 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position W 62 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, Y; Position W 63 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, Y; Position N 65 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position D 66 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 67 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 70 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position S 72 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position R 73 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position L 75 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position I 78 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 79 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position S 81 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position A 82 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position L 84 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position T 118 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position R 125 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position G 126 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 128 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position L 129 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y.
52. The allergen of claim 51, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 15.
53. The allergen of claim 52, wherein the allergen has the amino acid sequence of SEQ ID NO: 15.
54. The protein variant of claim 30, wherein the allergen comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 16:
Position T 4 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position D 28 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position V 31 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position Q 40 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position F 41 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 42 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position D 44 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 45 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position A 47 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position A 48 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 51 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position D 54 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 58 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position P 61 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position T 62 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position H 65 to A, C, D, E, F, G, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 68 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 70 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position D 143 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 146 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 148 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position S 173 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position A 178 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 181 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position D 184 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 185 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 186 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position G 187 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 188 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position A 190 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position T 192 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position V 203 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position I 204 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 207 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 208 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position G 209 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 213 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position K 215 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position D 236 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 238 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position T 240 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position P 241 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position G 242 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y.
55. The allergen of claim 54, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 16.
56. The allergen of claim 55, wherein the allergen has the amino acid sequence of SEQ ID NO: 16.
57. The protein variant of claim 30, wherein the allergen comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 17:
Position A 33 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position A 36 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position T 38 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position P 54 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position R 56 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position A 57 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 58 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position V 68 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position L 70 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position R 71 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position Y 78 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position K 80 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position K 81 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position S 83 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position A 84 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 102 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 103 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position P 106 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position E 114 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 118 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 119 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position I 121 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y.
58. The allergen of claim 57, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 17.
59. The allergen of claim 58, wherein the allergen has the amino acid sequence of SEQ ID NO: 17.
60. The protein variant of claim 30, wherein the allergen comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 18:
Position W 2 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, Y; Position D 13 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 15 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 16 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 28 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position V 31 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position Q 34 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position Q 40 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position L 41 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position P 43 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position Q 44 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position D 47 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 50 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position K 51 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position E 54 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 57 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position A 60 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position T 62 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position G 67 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 68 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 69 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 71 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position I 74 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Q 75 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position Q 78 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position R 83 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position K 85 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position G 87 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 88 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position N 97 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position D 106 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 108 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position T 110 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position R 120 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position D 123 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 124 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position E 127 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 129 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y.
61. The allergen of claim 60, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 18.
62. The allergen of claim 61, wherein the allergen has the amino acid sequence of SEQ ID NO: 18.
63. The protein variant of claim 30, wherein the allergen comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 19:
Position T 28 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position T 31 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position A 33 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 34 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position A 36 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position T 53 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position A 54 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 56 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position G 64 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position T 65 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position R 66 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position V 68 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position R 71 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position D 74 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 78 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position S 83 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position A 84 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position N 101 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position E 102 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 103 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position Q 105 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position P 106 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position T 108 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position K 115 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 119 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position T 133 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position V 136 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position G 137 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 150 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position T 153 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position A 158 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position A 161 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position A 169 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 175 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position D 176 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 181 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position D 199 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 200 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position K 206 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position G 207 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 208 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position A 209 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 215 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position E 227 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 228 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position I 229 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 231 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position G 232 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position T 233 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position N 236 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position E 239 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 243 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 244 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position I 246 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 247 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Q 248 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position G 249 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y.
64. The allergen of claim 63, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 19.
65. The allergen of claim 64, wherein the allergen has the amino acid sequence of SEQ ID NO: 19.
66. The protein variant of claim 30, wherein the allergen comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 20:
Position S 1 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position Y 5 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position E 8 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position H 9 to A, C, D, E, F, G, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position L 12 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position E 47 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 48 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 70 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position A 71 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position R 76 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position K 78 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position G 80 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 81 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position K 88 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position G 90 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Q 91 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position E 99 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 100 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 101 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position V 102 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position T 103 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position P 104 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position G 105 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Q 106 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position E 112 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 116 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 117 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position I 119 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 120 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Q 121 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position G 122 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position L 123 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y.
67. The allergen of claim 66, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 20.
68. The allergen of claim 67, wherein the allergen has the amino acid sequence of SEQ ID NO: 20.
69. The protein variant of claim 30, wherein the allergen comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 21:
Position L 4 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position Y 6 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position Y 17 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position S 20 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position S 31 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position K 32 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position A 33 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 37 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y.
70. The allergen of claim 69, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 21.
71. The allergen of claim 70, wherein the allergen has the amino acid sequence of SEQ ID NO: 21.
72. The protein variant of claim 30, wherein the allergen comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 22:
Position N 6 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position C 9 to A, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 23 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 24 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position G 25 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 26 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position L 27 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position K 28 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position P 29 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position K 34 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position V 35 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position Y 39 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position G 40 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position L 41 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position K 43 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position E 45 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Q 47 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position D 48 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position L 50 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position K 51 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position E 52 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 55 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Q 58 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position K 59 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position R 62 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position G 71 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 72 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position P 74 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position P 75 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position V 83 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; Position N 85 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position D 86 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 87 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 90 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position Q 93 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position L 120 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Position T 121 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position G 122 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position S 123 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position T 124 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position A 125 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position A 126 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position Y 128 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position D 130 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position D 140 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position P 147 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position K 148 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position K 150 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position S 152 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position G 153 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position F 156 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 158 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position H 161 to A, C, D, E, F, G, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position I 181 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 183 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position K 184 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position W 185 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, Y; Position H 186 to A, C, D, E, F, G, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position N 199 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position K 201 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y Position N 202 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position E 203 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position E 204 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position T 208 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y.
73. The allergen of claim 72, wherein the allergen has at least 81%, preferably at least 85%, more preferably at least 90%, even more preferably at least 96%, most preferably at least 98% homology to SEQ ID NO: 22.
74. The allergen of claim 73, wherein the allergen has the amino acid sequence of SEQ ID NO: 22.
75. The protein variant of claim 22, wherein the protein variant is an enzyme.
76. The protein variant of claim 75, wherein the enzyme is a protease, a lipolytic enzyme, a carbohydrase or a oxidoreductase.
77. The protein variant of claim 76, wherein the protease is a subtilisin comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 10:
Position  −6 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion; Position  −5 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion; Position  −4 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion; Position  −2 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion; Position  3a to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion; Position  28a to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion; Position  44a to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion; Position  44b to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion; Position 139 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion; Position 148 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion; Position 149 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion; Position 264a to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion.
78. The protein variant of claim 76, wherein the protease is a subtilisin comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 10:
Position −1 to G, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, H; Position 1 to V, L, I, W, M, F, Y, S, T, R; Position 2 to G, V, I, M, F, N, Q, Y, S, T, H; Position 3 to W, M, F, N, Q, Y, S, D, E, R, H; Position 4 to V, L, W, M, F, Y, R; Position 5 to V, L, I, W, M, F, N, Q, Y, T, R, H; Position 6 to G, V, L, I, W, P, M, N, Q, T, D, E, R, H; Position 9 to G, V, L, I, W, P, M, F, Q, Y, S, T, R, H; Position 10 to G, A, V, I, W, P, M, N, Q, Y, S, T, D, E, R; Position 12 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E; Position 14 to V, L, I, W, P, M, F, N, Q, Y, T, R, H; Position 15 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, E, H; Position 17 to G, A, V, I, W, P, M, F, Y, H; Position 18 to G, A, L, I, W, P, M, F, N, Q, Y, T, D, E, H; Position 19 to A, V, I, W, M, F, N, Y, S, T, D, R, H; Position 20 to G, V, L, I, W, M, F, N, Q, Y, S, T, D, E; Position 21 to G, V, I, W, N, Q, Y, S, T, D, E, R, H; Position 22 to G, V, L, I, W, M, F, Y, S, T; Position 24 to G, V, L, I, W, M, F, N, Q, Y, S, D, E, R; Position 25 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H; Position 27 to G, L, I, W, P, M, F, Y, T, H; Position 38 to V, L, I, W, M, F, N, Q, Y, T, H; Position 39 to G, A, V, L, I, W, M, F, N, Q, Y, T, D, E, R, H; Position 40 to V, L, I, W, M, F, N, Q, Y, T, R, H; Position 42 to G, A, L, W, C, M, F, N, Q, Y, S, T, D, E, R, H; Position 43 to G, L, H; Position 44 to G, V, L, I, W, P, M, F, Y, S, T; Position 45 to G, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H; Position 46 to G, A, L, I, W, P, M, F, Y, H; Position 47 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H; Position 48 to A, L, I, P, M, F, N, Y, D, H; Position 49 to G, A, V, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H; Position 50 to G, A, W, M, N, Q, Y, S, T, D, E, H; Position 51 to V, L, I, W, M, F, N, Y, R; Position 52 to V, L, I, W, M, F, Y, S, T, R; Position 53 to A, V, L, I, W, M, F, N, Q, Y, S, D, E, H; Position 54 to V, L, I, W, M, F, S, R; Position 55 to G, A, V, L, I, W, C, M, F, N, Q, Y, T, D, E, R, K, H; Position 56 to G, V, L, I, W, M, F, N, Q, Y, S, T, H; Position 57 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 58 to L, W, M, F, N, Y, R; Position 59 to A, V, L, I, C, T, H; Position 61 to V, L, I, W, M, F, Y; Position 62 to G, A, L, W, M, F, N, Y, R; Position 64 to G, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 75 to L; Position 79 to I; Position 80 to G; Position 87 to A, V, L, I, W, M, F, Q, Y, S, T, D, E, H; Position 89 to G, V, L, I, W, P, F, N, Y, T, E; Position 91 to G, A, V, L, I, W, P, M, N, Y, S, T, D, E, R, H; Position 98 to A; Position 99 to V, L, I, W, M, F, Q, Y, H; Position 100 to G, V, L, I, W, M, F, Y, R, H; Position 101 to V, I, W, M, F, N, Q, Y, H; Position 102 to V, L, I, W, M, F, Y, R, H, G; Position 108 to I; Position 109 to N; Position 112 to E Position 113 to W; Position 115 to I; Position 117 to N; Position 118 to N; Position 126 to L; Position 127 to G, A, V, I, W, M, F, Y, R, H, L; Position 128 to I, W; Position 129 to W; Position 130 to W, F, Y, R; Position 131 to W, Y, R; Position 132 to L, W, M, F, Y, S, H; Position 133 to A, L, I, W, M, F, Y, R; Position 134 to L, I, W, F, N, Q, Y, R, H; Position 136 to G, A, W, P, N, Y, S, T, D, E, H; Position 137 to G, A, V, I, W, P, M, N, Y, H; Position 140 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, H; Position 141 to G, V, L, I, W, P, M, F, Q, S, D, E, H; Position 143 to V, L, I, P, M, F, N, Y, R; Position 144 to L, W, P, M, F, N, Q, Y, S, D, E, R, H; Position 145 to G, V, L, I, W, M, F, Q, Y, D, E, R, H; Position 146 to G, A, W, L, I, W, M, F, N, Q, Y, T, D, E, R, H; Position 155 to V, L, I, W, M, F, Y, R; Position 156 to V, I, W, F, R; Position 157 to G, A, V, L, I, W, M, F, Y, T, R, H; Position 158 to V, L, I, W, M, F, Y; Position 159 to A, W, M, Y, T, R, H; Position 160 to W, M, F, Y, R, H; Position 161 to I, W, M, F, Y, H; Position 167 to R, K; Position 171 to D; Position 172 to G, A, V, L, I, S, T, H; Position 173 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, E, H; Position 181 to G, A, V, L, I, W, C, M, F, Q, Y, T, D, R, K, H; Position 182 to A, V, L, I, W, C, M, F, N, Q, Y, S, T, D, E, H; Position 183 to G, A, V, L, W, C, M, F, N, Q, Y, S, T, E, R, H; Position 184 to A, V, L, I, W, C, M, F, N, Q, Y, T, E, H; Position 185 to G, A, V, L, I, W, C, M, F, N, Q, Y, T, E, H; Position 186 to G, A, V, L, W, M, F, N, Q, Y, S, T, D, E, R, H; Position 188 to G, A, V, L, W, F, S, R, K; Position 189 to W, F; Position 191 to A, V, L, I, W, M, F, Y, T, R, H; Position 192 to G, L, I, W, M, N, Q, Y, S, T, D, R, H; Position 194 to W, N, Q, Y, D, H; Position 195 to W, P, Y; Position 196 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H; Position 203 to V, F, Y, R, H; Position 204 to I, W, M, Y, H; Position 206 to F; Position 209 to Y, R; Position 210 to W, F, Y; Position 211 to L, W, M, F, Y, H; Position 212 to V, L, I, W, M, F, Y, T, R, H; Position 214 to W, Y, R; Position 215 to A, L, I, W, M, F, Y; Position 216 to A, L, I, W, M, F, Y, R; Position 217 to W, R; Position 218 to G, A, L, W, P, M, F, Y, R, H; Position 221 to S; Position 236 to S; Position 240 to N; Position 241 to W; Position 243 to N; Position 245 to Q; Position 247 to G, V, I, W, P, F, Y, S, T, R; Position 248 to W, P, F, Y, E, R, H; Position 249 to L, W, P, F, S, D, E, H; Position 251 to G, L, I, W, P, M, F, Y, H; Position 252 to G, A, W, P, N, Q, Y, T, E, R, H; Position 254 to G, V, L, I, W, M, F, N, Q, Y, S, D, E, R, H; Position 255 to G, L, W, M, F, N, Y, T, D, H; Position 256 to G, A, V, L, I, W, M, F, Q, Y, S, T, D, H; Position 257 to G, A, L, I, W, C, M, F, N, Q, Y, S, T, D, E, K, H; Position 258 to G, A, V, L, I, W, C, M, F, N, Q, Y, S, T, E, K, H; Position 259 to A, V, I, W, M, F, N, Q, Y, S, T, E, R; Position 260 to L, I, W, M, F, Y, T, H; Position 261 to L, N, S, H; Position 262 to G, A, V, L, I, W, P, F, N, Q, Y, T, D, E, R, H; Position 263 to G, A, V, L, I, P, C, M, N, Q, Y, S, T, R, K; Position 265 to V, L, I, W, M, F, Y; Position 269 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, E, R, H; Position 271 to A, L, I, W, P, M, F, N, Y, S, T, R, H; Position 272 to G, A, V, L, I, W, P, M, F, N, Q, Y, T, D, E, H; Position 275 to G, A, V, L, I, W, M, F, N, Y, T, D.
79. The protein variant of claim 76, wherein the protease is a subtilisin comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 10:
Position −1 to Deletion; Position 9 to Insertion, deletion; Position 10 to Insertion, deletion; Position 12 to Insertion, deletion; Position 14 to Insertion, deletion; Position 15 to Insertion, deletion; Position 17 to Insertion, deletion; Position 18 to Insertion, deletion; Position 19 to Insertion, deletion; Position 20 to Insertion, deletion; Position 21 to Insertion, deletion; Position 22 to Insertion, deletion; Position 24 to Insertion, deletion; Position 25 to Insertion, deletion; Position 46 to Insertion, deletion; Position 47 to Insertion, deletion; Position 48 to Insertion, deletion; Position 49 to Insertion, deletion; Position 50 to Insertion, deletion; Position 51 to Insertion, deletion; Position 52 to Insertion, deletion; Position 53 to Insertion, deletion; Position 54 to Insertion, deletion; Position 55 to Insertion, deletion; Position 58 to Insertion, deletion; Position 59 to Insertion, deletion; Position 61 to Insertion, deletion; Position 64 to Insertion, deletion; Position 78 to Insertion: Position 80 to Insertion; Position 91 to Insertion, deletion; Position 98 to Deletion; Position 99 to Deletion; Position 102 to Deletion; Position 105 to Insertion; Position 108 to Insertion; Position 109 to Insertion; Position 112 to Insertion; Position 113 to Insertion; Position 115 to Insertion; Position 116 to Insertion; Position 117 to Insertion; Position 118 to Insertion; Position 131 to Deletion; Position 134 to Insertion, deletion; Position 136 to Insertion, deletion; Position 137 to Insertion, deletion; Position 140 to Insertion, deletion; Position 141 to Insertion, deletion; Position 143 to Insertion, deletion; Position 144 to Insertion, deletion; Position 145 to Insertion, deletion; Position 146 to Insertion, deletion; Position 171 to Deletion; Position 172 to Deletion; Position 173 to Deletion; Position 181 to Deletion; Position 182 to Deletion; Position 183 to Deletion; Position 184 to Deletion; Position 185 to Deletion; Position 186 to Deletion; Position 188 to Deletion; Position 189 to Deletion; Position 191 to Deletion; Position 192 to Deletion; Position 195 to Deletion; Position 196 to Insertion, deletion; Position 221 to Insertion; Position 236 to Insertion; Position 237 to Insertion; Position 238 to Insertion; Position 239 to Insertion; Position 240 to Insertion; Position 241 to Insertion; Position 242 to Insertion; Position 243 to Insertion; Position 244 to Insertion; Position 245 to Insertion; Position 247 to Insertion, deletion; Position 248 to Insertion, deletion; Position 249 to Insertion, deletion; Position 251 to Insertion, deletion; Position 252 to Insertion, deletion; Position 254 to Insertion, deletion; Position 255 to Insertion, deletion; Position 256 to Insertion, deletion; Position 257 to Insertion, deletion; Position 258 to Insertion, deletion; Position 259 to Insertion, deletion; Position 260 to Insertion, deletion; Position 261 to Insertion, deletion; Position 262 to Insertion, deletion; Position 263 to Insertion, deletion; Position 265 to Insertion, deletion; Position 269 to Insertion, deletion; Position 271 to Insertion, deletion; Position 272 to Insertion, deletion; Position 275 to Insertion, deletion.
80. The protein variant of claim 76, wherein the protease is a subtilisin comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 10:
Position 7 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H; Position 8 to G, A, L, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 13 to G, L, I, W, P, M, F, N, Q, Y, S, D, E, H; Position 16 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, D, E, R, H; Position 23 to G, A, V, L, I, W, M, F, Y, E, R, H; Position 26 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H; Position 28 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 29 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 33 to V, L, I, W, C, M, F, N, Q, Y, R, H; Position 35 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 36 to V, L, I, W, P, M, F, N, Y, S, T, R, H; Position 37 to L, I, W, M, F, N, Q, Y, S, R, H; Position 41 to G, V, L, I, W, M, F, N, Q, Y, S, T, R, H; Position 60 to G, A, V, L, I, W, C, M, F, Q, Y, T, D, R, K, H; Position 63 to G, A, V, L, I, W, M, F, Y, T, R, H; Position 73 to A; Position 74 to A; Position 81 to V; Position 82 to L; Position 86 to G, A, V, L, I, W, M, F, N, Q, Y, T, D, E, R, H; Position 88 to A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H; Position 92 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 93 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 94 to G, V, L, I, W, P, M, F, N, Y, T, D, E, K, H; Position 96 to L, W, F, Y, R, K; Position 97 to V, L, W, C, M, F, Y, H; Position 111 to I; Position 114 to A; Position 119 to M; Position 124 to M; Position 135 to G, L, P, C, N, Q, T, R, H; Position 138 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H; Position 142 to G, A, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 147 to G, A, V, L, W, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 151 to G, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 162 to I, W, F, Y, R; Position 163 to V, W, M, F, H; Position 168 to G, V, L, I, W, C, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 169 to C, E, F, G, H, I, K, L, M, N, Q, R, T, V, W, Y; Position 174 to G, A, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 176 to G, A, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 179 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 187 to A, V, L, I, W, M, F, Y, R; Position 190 to G, A, V, L, I, W, C, M, F, N, Q, Y, S, T, R, K, H; Position 193 to G, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H; Position 197 to G, V, L, I, W, P, M, F, Q, Y, S, T, H; Position 198 to G, A, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 205 to W, F, Y, R, K; Position 208 to A, V, L, I, W, C, M, F, Y, T, R, K, H; Position 219 to G, A, V, L, I, W, F, Y, R, H; Position 222 to M; Position 232 to A; Position 233 to L; Position 234 to I; Position 250 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H; Position 267 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H; Position 268 to G, V, L, I, W, C, M, N, Q, Y, S, T, D, E, R, K, H; Position 270 to G, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 273 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H; Position 274 to W, P, M, F, N, Q, Y, T, D, E, R, H.
81. The protein variant of claim 76, wherein the protease is a subtilisin comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 10:
Position 13 to Insertion, deletion; Position 16 to Insertion, deletion; Position 23 to Insertion, deletion; Position 26 to Insertion, deletion; Position 28 to Insertion, deletion; Position 29 to Insertion, deletion; Position 35 to Deletion; Position 60 to Insertion, deletion; Position 63 to Insertion; Position 81 to Insertion; Position 82 to Insertion; Position 92 to Insertion, deletion; Position 93 to Insertion, deletion; Position 94 to Insertion, deletion; Position 96 to Deletion, Position 106 to Insertion, Position 111 to Insertion, Position 114 to Insertion, Position 119 to Insertion, Position 124 to Insertion, Position 138 to Insertion, deletion; Position 142 to Insertion, deletion; Position 147 to Insertion, deletion; Position 151 to Insertion, deletion; Position 174 to Insertion, deletion; Position 176 to Insertion, deletion; Position 179 to Insertion, deletion; Position 187 to Deletion; Position 190 to Deletion; Position 193 to Deletion; Position 197 to Insertion, deletion; Position 198 to Insertion, deletion; Position 232 to Insertion, Position 233 to Insertion, Position 234 to Insertion, Position 246 to Insertion, Position 250 to Insertion, deletion; Position 267 to Insertion, deletion; Position 268 to Insertion, deletion; Position 270 to Insertion, deletion; Position 273 to Insertion, deletion.
82. The protein variant of claim 76, wherein the protease is a savinase-like subtilisin comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 10:
Position 2 to G, V, I, M, F, N, Q, Y, S, T, H, Position 3 to W, M, F, N, Q, Y, S, D, E, R, H, Position 4 to V, L, W, M, F, Y, R, Position 6 to G, V, L, I, W, P, M, N, Q, T, D, E, R, H, Position 9 to G, V, L, I, W, P, M, F, Q, Y, S, T, R, H, insertion, deletion, Position 10 to G, A, V, I, W, P, M, N, Q, Y, S, T, D, E, R, insertion, deletion, Position 12 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, insertion, deletion, Position 14 to V, L, I, W, P, M, F, N, Q, Y, T, R, H, insertion, deletion, Position 15 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, E, H, insertion, deletion, Position 17 to G, A, V, I, W, P, M, F, Y, H, insertion, deletion, Position 18 to G, A, L, I, W, P, M, F, N, Q, Y, T, D, E, H, insertion, deletion, Position 19 to A, V, I, W, M, F, N, Y, S, T, D, R, H, insertion, deletion, Position 20 to G, V, L, I, W, M, F, N, Q, Y, S, T, D, E, insertion, deletion, Position 21 to G, V, I, W, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 22 to G, V, L, I, W, M, F, Y, S, T, insertion, deletion, Position 24 to G, V, L, I, W, M, F, N, Q, Y, S, D, E, R, insertion, deletion, Position 25 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 27 to G, L, I, W, P, M, F, Y, T, H, Position 37 to L, I, W, M, F, N, Q, Y, S, R, H, Position 40 to V, L, I, W, M, F, N, Q, Y, T, R, H, Position 42 to G, A, L, W, C, M, F, N, Q, Y, S, T, D, E, R, H, Position 43 to G, L, H, Position 44 to G, V, L, I, W, P, M, F, Y, S, T, Position 45 to G, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, Position 46 to G, A, L, I, W, P, M, F, Y, H, insertion, deletion, Position 47 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 48 to A, L, I, P, M, F, N, Y, D, H, insertion, deletion, Position 50 to G, A, W, M, N, Q, Y, S, T, D, E, H, insertion, deletion, Position 51 to V, L, I, W, M, F, N, Y, R, deletion, insertion, Position 54 to V, L, I, W, M, F, S, R, deletion, insertion, Position 55 to G, A, V, L, I, W, C, M, F, N, Q, Y, T, D, E, R, K, H, deletion, insertion, Position 57 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, K, H, Position 58 to L, W, M, F, N, Y, R, insertion, deletion, Position 59 to A, V, L, I, C, T, H, insertion, deletion, Position 61 to V, L, I, W, M, F, Y, insertion, deletion, Position 64 to G, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 75 to L, Position 78 to insertion, Position 79 to I, Position 87 to A, V, L, I, W, M, F, Q, Y, S, T, D, E, H, Position 89 to G, V, L, I, W, P, F, N, Y, T, E, Position 91 to G, A, V, L, I, W, P, M, N, Y, S, T, D, E, R, H, insertion, deletion, Position 98 to A, deletion, Position 100 to G, V, L, I, W, M, F, Y, R, H, Position 101 to V, I, W, M, F, N, Q, Y, H, Position 102 to V, L, I, W, M, F, Y, R, H, G, deletion, Position 109 to N, insertion, Position 112 to E, insertion, Position 113 to W, insertion, Position 116 to insertion, Position 117 to N, insertion, Position 126 to L, Position 127 to G, A, V, I, W, M, F, Y, R, H, L, Position 128 to I, W, Position 129 to W, Position 130 to W, F, Y, R, Position 131 to W, Y, R, deletion, Position 132 to L, W, M, F, Y, S, H, Position 133 to A, L, I, W, M, F, Y, R, Position 134 to L, I, W, F, N, Q, Y, R, H, insertion, deletion, Position 136 to G, A, W, P, N, Y, S, T, D, E, H, insertion, deletion, Position 137 to G, A, V, I, W, P, M, N, Y, H, insertion, deletion, Position 140 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, H, insertion, deletion, Position 141 to G, V, L, I, W, P, M, F, Q, S, D, E, H, insertion, deletion, Position 143 to V, L, I, P, M, F, N, Y, R, insertion, deletion, Position 144 to L, W, P, M, F, N, Q, Y, S, D, E, R, H, insertion, deletion, Position 145 to G, V, L, I, W, M, F, Q, Y, D, E, R, H, insertion, deletion, Position 146 to G, A, W, L, I, W, M, F, N, Q, Y, T, D, E, R, H, insertion, deletion, Position 155 to V, L, I, W, M, F, Y, R, Position 156 to V, I, W, F, R, Position 157 to G, A, V, L, I, W, M, F, Y, T, R, H, Position 158 to V, L, I, W, M, F, Y, Position 160 to W, M, F, Y, R, H, Position 161 to I, W, M, F, Y, H, Position 167 to R, K, Position 170 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 171 to D, deletion, Position 172 to G, A, V, L, I, S, T, H, deletion, Position 173 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, E, H, deletion, Position 181 to G, A, V, L, I, W, C, M, F, Q, Y, T, D, R, K, H, deletion, Position 183 to G, A, V, L, W, C, M, F, N, Q, Y, S, T, E, R, H, deletion, Position 184 to A, V, L, I, W, C, M, F, N, Q, Y, T, E, H, deletion, Position 185 to G, A, V, L, I, W, C, M, F, N, Q, Y, T, E, H, deletion, Position 186 to G, A, V, L, W, M, F, N, Q, Y, S, T, D, E, R, H, deletion, Position 188 to G, A, V, L, W, F, S, R, K, deletion, Position 189 to W, F, deletion, Position 191 to A, V, L, I, W, M, F, Y, T, R, H, deletion, Position 192 to G, L, I, W, M, N, Q, Y, S, T, D, R, H, deletion, Position 194 to W, N, Q, Y, D, H, Position 195 to W, P, Y, deletion, Position 197 to G, V, L, I, W, P, M, F, Q, Y, S, T, H, insertion, deletion, Position 203 to V, F, Y, R, H, Position 206 to F, Position 209 to Y, R, Position 210 to W, F, Y, Position 212 to V, L, I, W, M, F, Y, T, R, H, Position 214 to W, Y, R, Position 216 to A, L, I, W, M, F, Y, R, Position 217 to W, R, Position 218 to G, A, L, W, P, M, F, Y, R, H, Position 221 to S, insertion, Position 236 to S, insertion, Position 237 to insertion, Position 239 to insertion, Position 240 to N, insertion, Position 241 to W, insertion, Position 242 to insertion, Position 244 to insertion, Position 245 to Q, insertion, Position 247 to G, V, I, W, P, F, Y, S, T, R, insertion, deletion, Position 248 to W, P, F, Y, E, R, H, insertion, deletion, Position 251 to G, L, I, W, P, M, F, Y, H, insertion, deletion, Position 252 to G, A, W, P, N, Q, Y, T, E, R, H, insertion, deletion, Position 255 to G, L, W, M, F, N, Y, T, D, H, insertion, deletion, Position 256 to G, A, V, L, I, W, M, F, Q, Y, S, T, D, H, insertion, deletion, Position 257 to G, A, L, I, W, C, M, F, N, Q, Y, S, T, D, E, K, H, insertion, deletion, Position 258 to G, A, V, L, I, W, C, M, F, N, Q, Y, S, T, E, K, H, insertion, deletion, Position 259 to A, V, I, W, M, F, N, Q, Y, S, T, E, R, insertion, deletion, Position 260 to L, I, W, M, F, Y, T, H, insertion, deletion, Position 261 to L, N, S, H, insertion, deletion, Position 262 to G, A, V, L, I, W, P, F, N, Q, Y, T, D, E, R, H, insertion, deletion, Position 263 to G, A, V, L, I, P, C, M, N, Q, Y, S, T, R, K, insertion, deletion, Position 265 to V, L, I, W, M, F, Y, insertion, deletion, Position 271 to A, L, I, W, P, M, F, N, Y, S, T, R, H, insertion, deletion, Position 272 to G, A, V, L, I, W, P, M, F, N, Q, Y, T, D, E, H, insertion, deletion, Position 275 to G, A, V, L, I, W, M, F, N, Y, T, D, insertion, deletion.
83. The protein variant of claim 82, wherein the savinase-like subtilisin comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 10:
Position 6 to G, V, L, I, W, P, M, N, Q, T, D, E, R, H, Position 9 to G, V, L, I, W, P, M, F, Q, Y, S, T, R, H, insertion, deletion, Position 10 to G, A, V, I, W, P, M, N, Q, Y, S, T, D, E, R, insertion, deletion, Position 14 to V, L, I, W, P, M, F, N, Q, Y, T, R, H, insertion, deletion, Position 15 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, E, H, insertion, deletion, Position 17 to G, A, V, I, W, P, M, F, Y, H, insertion, deletion, Position 18 to G, A, L, I, W, P, M, F, N, Q, Y, T, D, E, H, insertion, deletion, Position 19 to A, V, I, W, M, F, N, Y, S, T, D, R, H, insertion, deletion, Position 20 to G, V, L, I, W, M, F, N, Q, Y, S, T, D, E, insertion, deletion, Position 21 to G, V, I, W, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 37 to L, I, W, M, F, N, Q, Y, S, R, H, Position 43 to G, L, H, Position 45 to G, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, Position 47 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 50 to G, A, W, M, N, Q, Y, S, T, D, E, H, insertion, deletion, Position 51 to V, L, I, W, M, F, N, Y, R, deletion, insertion, Position 54 to V, L, I, W, M, F, S, R, deletion, insertion, Position 59 to A, V, L, I, C, T, H, insertion, deletion, Position 89 to G, V, L, I, W, P, F, N, Y, T, E, Position 91 to G, A, V, L, I, W, P, M, N, Y, S, T, D, E, R, H, insertion, deletion, Position 101 to V, I, W, M, F, N, Q, Y, H, Position 109 to N, insertion, Position 112 to E, insertion, Position 113 to W, insertion, Position 127 to G, A, V, I, W, M, F, Y, R, H, L, Position 128 to I, W, Position 129 to W, Position 130 to W, F, Y, R, Position 131 to W, Y, R, deletion, Position 133 to A, L, I, W, M, F, Y, R, Position 136 to G, A, W, P, N, Y, S, T, D, E, H, insertion, deletion, Position 137 to G, A, V, I, W, P, M, N, Y, H, insertion, deletion, Position 140 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, H, insertion, deletion, Position 141 to G, V, L, I, W, P, M, F, Q, S, D, E, H, insertion, deletion, Position 143 to V, L, I, P, M, F, N, Y, R, insertion, deletion, Position 144 to L, W, P, M, F, N, Q, Y, S, D, E, R, H, insertion, deletion, Position 145 to G, V, L, I, W, M, F, Q, Y, D, E, R, H, insertion, deletion, Position 146 to G, A, W, L, I, W, M, F, N, Q, Y, T, D, E, R, H, insertion, deletion, Position 155 to V, L, I, W, M, F, Y, R, Position 157 to G, A, V, L, I, W, M, F, Y, T, R, H, Position 158 to V, L, I, W, M, F, Y, Position 160 to W, M, F, Y, R, H, Position 161 to I, W, M, F, Y, H, Position 167 to R, K, Position 170 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 171 to D, deletion, Position 172 to G, A, V, L, I, S, T, H, deletion, Position 173 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, E, H, deletion, Position 181 to G, A, V, L, I, W, C, M, F, Q, Y, T, D, R, K, H, deletion, Position 184 to A, V, L, I, W, C, M, F, N, Q, Y, T, E, H, deletion, Position 185 to G, A, V, L, I, W, C, M, F, N, Q, Y, T, E, H, deletion, Position 186 to G, A, V, L, W, M, F, N, Q, Y, S, T, D, E, R, H, deletion, Position 188 to G, A, V, L, W, F, S, R, K, deletion, Position 189 to W, F, deletion, Position 192 to G, L, I, W, M, N, Q, Y, S, T, D, R, H, deletion, Position 194 to W, N, Q, Y, D, H, Position 195 to W, P, Y, deletion, Position 197 to G, V, L, I, W, P, M, F, Q, Y, S, T, H, insertion, deletion, Position 203 to V, F, Y, R, H, Position 210 to W, F, Y, Position 218 to G, A, L, W, P, M, F, Y, R, H, Position 236 to S, insertion, Position 237 to insertion, Position 239 to insertion, Position 240 to N, insertion, Position 241 to W, insertion, Position 242 to insertion, Position 244 to insertion, Position 245 to Q, insertion, Position 247 to G, V, I, W, P, F, Y, S, T, R, insertion, deletion, Position 251 to G, L, I, W, P, M, F, Y, H, insertion, deletion, Position 255 to G, L, W, M, F, N, Y, T, D, H, insertion, deletion, Position 256 to G, A, V, L, I, W, M, F, Q, Y, S, T, D, H, insertion, deletion, Position 257 to G, A, L, I, W, C, M, F, N, Q, Y, S, T, D, E, K, H, insertion, deletion, Position 258 to G, A, V, L, I, W, C, M, F, N, Q, Y, S, T, E, K, H, insertion, deletion, Position 260 to L, I, W, M, F, Y, T, H, insertion, deletion, Position 262 to G, A, V, L, I, W, P, F, N, Q, Y, T, D, E, R, H, insertion, deletion, Position 265 to V, L, I, W, M, F, Y, insertion, deletion, Position 271 to A, L, I, W, P, M, F, N, Y, S, T, R, H, insertion, deletion, Position 272 to G, A, V, L, I, W, P, M, F, N, Q, Y, T, D, E, H, insertion, deletion, Position 275 to G, A, V, L, I, W, M, F, N, Y, T, D, insertion, deletion.
84. The savinase-like subtilisin of claim 82, wherein the subtilisin has at least 81%, preferably at least 96%, more preferably at least 98%, most preferably at least 99% homology to SEQ ID NO: 24.
85. The savinase-like subtilisin of claim 84, wherein the subtilisin has any of the amino acid sequence of SEQ ID NO: 24, 26, 27, 28, 29, 30, 31, 32, 34, 35.
86. The protein variant of claim 76, wherein the protease is a savinase-like subtilisin comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 10:
Position 8 to G, A, L, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, Position 16 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, D, E, R, H, insertion, deletion, Position 23 to G, A, V, L, I, W, M, F, Y, E, R, H, insertion, deletion, Position 26 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 35 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, K, H, deletion, Position 38 to V, L, I, W, M, F, N, Q, Y, T, H, Position 39 to G, A, V, L, I, W, M, F, N, Q, Y, T, D, E, R, H, Position 41 to G, V, L, I, W, M, F, N, Q, Y, S, T, R, H, Position 60 to G, A, V, L, I, W, C, M, F, Q, Y, T, D, R, K, H, insertion, deletion, Position 73 to A, Position 74 to A, Position 80 to G, insertion, Position 81 to V, insertion, Position 86 to G, A, V, L, I, W, M, F, N, Q, Y, T, D, E, R, H, Position 88 to A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H, Position 90 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion, Position 93 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 108 to I, insertion, Position 111 to I, insertion, Position 124 to M, insertion, Position 135 to G, L, P, C, N, Q, T, R, H, Position 142 to G, A, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 147 to G, A, V, L, W, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 148 to G, A, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 149 to G, A, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 151 to G, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 163 to V, W, M, F, H, Position 168 to G, V, L, I, W, C, M, F, N, Q, Y, S, T, D, E, R, K, H, Position 169 to C, E, F, G, H, I, K, L, M, N, Q, R, T, V, W, Y, Position 174 to G, A, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 179 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 190 to G, A, V, L, I, W, C, M, F, N, Q, Y, S, T, R, K, H, deletion, Position 193 to G, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H, deletion, Position 196 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 208 to A, V, L, I, W, C, M, F, Y, T, R, K, H, Position 213 to N, oN, E, Position 215 to A, L, I, W, M, F, Y, Position 232 to A, insertion, Position 233 to L, insertion, Position 234 to I, insertion, Position 246 to insertion, Position 250 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 254 to G, V, L, I, W, M, F, N, Q, Y, S, D, E, R, H, insertion, deletion, Position 267 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 268 to G, V, L, I, W, C, M, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 269 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, E, R, H, insertion, deletion, Position 273 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion,
87. The savinase-like subtilisin of claim 86, wherein the subtilisin has at least 81%, preferably at least 96%, more preferably at least 98%, most preferably at least 99% homology to SEQ ID NO: 24.
88. The savinase-like subtilisin of claim 87, wherein the subtilisin has any of the amino acid sequence of SEQ ID NO: 24, 26, 27, 28, 29, 30, 31, 32, 34, 35.
89. The protein variant of claim 76 havingmodified immunogenicity as compared to its parent protein having at least 81% homolgy to SEQ ID NO: 25 comprising one or more of the following substitions corresponding to any of the following in SEQ ID NO: 25:
Position 21 to G, V, I, W, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 27 to G, L, I, W, P, M, F, Y, T, H, Position 50 to G, A, W, M, N, Q, Y, S, T, D, E, H, insertion, deletion, Position 52 to V, L, I, W, M, F, Y, S, T, R, deletion, insertion, Position 55 to G, A, V, L, I, W, C, M, F, N, Q, Y, T, D, E, R, K, H, deletion, insertion, Position 129 to W, Position 133 to A, L, I, W, M, F, Y, R, Position 172 to G, A, V, L, I, S, T, H, deletion, Position 186 to G, A, V, L, W, M, F, N, Q, Y, S, T, D, E, R, H, deletion, Position 194 to W, N, Q, Y, D, H, Position 195 to W, P, Y, deletion, Position 197 to G, V, L, I, W, P, M, F, Q, Y, S, T, H, insertion, deletion, Position 242 to insertion, Position 249 to L, W, P, F, S, D, E, H, insertion, deletion, Position 252 to G, A, W, P, N, Q, Y, T, E, R, H, insertion, deletion, Position 254 to G, V, L, I, W, M, F, N, Q, Y, S, D, E, R, H, insertion, deletion, Position 257 to G, A, L, I, W, C, M, F, N, Q, Y, S, T, D, E, K, H, insertion, deletion, Position 260 to L, I, W, M, F, Y, T, H, insertion, deletion, Position 265 to V, L, I, W, M, F, Y, insertion, deletion,
with the proviso that the amino acids of the parent enzyme are substituted to another amino acid.
90. The protein variant of claim 76 having modified immunogenicity as compared to its parent protein having at least 81% homology to SEQ ID NO: 10 comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 10:
Position 4 to V, L, W, M, F, Y, R, Position 38 to V, L, I, W, M, F, N, Q, Y, T, H, Position 40 to V, L, I, W, M, F, N, Q, Y, T, R, H, Position 43 to G, L, H, Position 47 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 49 to G, A, V, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 54 to V, L, I, W, M, F, S, R, deletion, insertion, Position 96 to L, W, F, Y, R, K, deletion, Position 99 to V, L, I, W, M, F, Q, Y, H, deletion, Position 113 to W, insertion, Position 131 to W, Y, R, deletion, Position 133 to A, L, I, W, M, F, Y, R, Position 137 to G, A, V, I, W, P, M, N, Y, H, insertion, deletion, Position 141 to G, V, L, I, W, P, M, F, Q, S, D, E, H, insertion, deletion, Position 144 to L, W, P, M, F, N, Q, Y, S, D, E, R, H, insertion, deletion, Position 170 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 173 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, E, H, deletion, Position 181 to G, A, V, L, I, W, C, M, F, Q, Y, T, D, R, K, H, deletion, Position 185 to G, A, V, L, I, W, C, M, F, N, Q, Y, T, E, H, deletion, Position 186 to G, A, V, L, W, M, F, N, Q, Y, S, T, D, E, R, H, deletion, Position 188 to G, A, V, L, W, F, S, R, K, deletion, Position 194 to W, N, Q, Y, D, H, Position 203 to V, F, Y, R, H, Position 210 to W, F, Y, Position 211 to L, W, M, F, Y, H, Position 257 to G, A, L, I, W, C, M, F, N, Q, Y, S, T, D, E, K, H, insertion, deletion, Position 261 to L, N, S, H, insertion, deletion, Position 262 to G, A, V, L, I, W, P, F, N, Q, Y, T, D, E, R, H, insertion, deletion, Position 265 to V, L, I, W, M, F, Y, insertion, deletion.
with the proviso that the amino acids of the parent enzyme are substituted to another amino acid.
91. The protein variant of claim 76 having modified immunogenicity as compared to its parent protein having at least 81% homology to SEQ ID NO: 11 comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 11:
Position 38 to V, L, I, W, M, F, N, Q, Y, T, H, Position 40 to V, L, I, W, M, F, N, Q, Y, T, R, H, Position 45 to G, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, Position 47 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 49 to G, A, V, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 50 to G, A, W, M, N, Q, Y, S, T, D, E, H, insertion, deletion, Position 52 to V, L, I, W, M, F, Y, S, T, R, deletion, insertion, Position 53 to A, V, L, I, W, M, F, N, Q, Y, S, D, E, H, deletion, insertion, Position 56 to G, V, L, I, W, M, F, N, Q, Y, S, T, H, Position 58 to L, W, M, F, N, Y, R, insertion, deletion, Position 96 to L, W, F, Y, R, K, deletion, Position 97 to V, L, W, C, M, F, Y, H, Position 98 to A, deletion, Position 105 to insertion, Position 109 to N, insertion, Position 113 to W, insertion, Position 115 to I, insertion, Position 133 to A, L, I, W, M, F, Y, R, Position 136 to G, A, W, P, N, Y, S, T, D, E, H, insertion, deletion, Position 137 to G, A, V, I, W, P, M, N, Y, H, insertion, deletion, Position 141 to G, V, L, I, W, P, M, F, Q, S, D, E, H, insertion, deletion, Position 158 to V, L, I, W, M, F, Y, Position 159 to A, W, M, Y, T, R, H, Position 172 to G, A, V, L, I, S, T, H, deletion, Position 186 to G, A, V, L, W, M, F, N, Q, Y, S, T, D, E, R, H, deletion, Position 189 to W, F, deletion, Position 192 to G, L, I, W, M, N, Q, Y, S, T, D, R, H, deletion, Position 195 to W, P, Y, deletion, Position 197 to G, V, L, I, W, P, M, F, Q, Y, S, T, H, insertion, deletion, Position 257 to G, A, L, I, W, C, M, F, N, Q, Y, S, T, D, E, K, H, insertion, deletion, Position 261 to L, N, S, H, insertion, deletion, Position 265 to V, L, I, W, M, F, Y, insertion, deletion,
with the proviso that the amino acids of the parent enzyme are substituted to another amino acid.
92. The protein variant of claim 76 having modified immunogenicity as compared to its parent protein having at least 81% homology to SEQ ID NO: 33 comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 33:
Position −6 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, Y, insertion, deletion, Position −5 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y, insertion, deletion, Position −4 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y, insertion, deletion, Position −2 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion, Position −1 to G, V, L, I, W, C, M, F, N, Q, Y, S, T, D, E, R, H, deletion, Position 1 to V, L, I, W, M, F, Y, S, T, R, Position 2 to G, V, I, M, F, N, Q, Y, S, T, H, Position 3a to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion, Position 5 to V, L, I, W, M, F, N, Q, Y, T, R, H, Position 6 to G, V, L, I, W, P, M, N, Q, T, D, E, R, H, Position 7 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, Position 8 to G, A, L, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, Position 10 to G, A, V, I, W, P, M, N, Q, Y, S, T, D, E, R, insertion, deletion, Position 12 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, insertion, deletion, Position 13 to G, L, I, W, P, M, F, N, Q, Y, S, D, E, H, insertion, deletion, Position 14 to V, L, I, W, P, M, F, N, Q, Y, T, R, H, insertion, deletion, Position 15 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, E, H, insertion, deletion, Position 16 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, D, E, R, H, insertion, deletion, Position 17 to G, A, V, I, W, P, M, F, Y, H, insertion, deletion, Position 18 to G, A, L, I, W, P, M, F, N, Q, Y, T, D, E, H, insertion, deletion, Position 19 to A, V, I, W, M, F, N, Y, S, T, D, R, H, insertion, deletion, Position 21 to G, V, I, W, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 22 to G, V, L, I, W, M, F, Y, S, T, insertion, deletion, Position 23 to G, A, V, L, I, W, M, F, Y, E, R, H, insertion, deletion, Position 24 to G, V, L, I, W, M, F, N, Q, Y, S, D, E, R, insertion, deletion, Position 25 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 26 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 27 to G, L, I, W, P, M, F, Y, T, H, Position 28 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 28a to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion, Position 29 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 33 to V, L, I, W, C, M, F, N, Q, Y, R, H, Position 35 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, K, H, deletion, Position 37 to L, I, W, M, F, N, Q, Y, S, R, H, Position 40 to V, L, I, W, M, F, N, Q, Y, T, R, H, Position 42 to G, A, L, W, C, M, F, N, Q, Y, S, T, D, E, R, H, Position 43 to G, L, H, Position 44 to G, V, L, I, W, P, M, F, Y, S, T, Position 44a to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion, Position 44b to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion, Position 46 to G, A, L, I, W, P, M, F, Y, H, insertion, deletion, Position 48 to A, L, I, P, M, F, N, Y, D, H, insertion, deletion, Position 51 to V, L, I, W, M, F, N, Y, R, deletion, insertion, Position 52 to V, L, I, W, M, F, Y, S, T, R, deletion, insertion, Position 53 to A, V, L, I, W, M, F, N, Q, Y, S, D, E, H, deletion, insertion, Position 55 to G, A, V, L, I, W, C, M, F, N, Q, Y, T, D, E, R, K, H, deletion, insertion, Position 56 to G, V, L, I, W, M, F, N, Q, Y, S, T, H, Position 57 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, K, H, Position 58 to L, W, M, F, N, Y, R, insertion, deletion, Position 61 to V, L, I, W, M, F, Y, insertion, deletion, Position 64 to G, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 75 to L, Position 81 to insertion, Position 86 to G, A, V, L, I, W, M, F, N, Q, Y, T, D, E, R, H, Position 87 to A, V, L, I, W, M, F, Q, Y, S, T, D, E, H, Position 88 to A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H, Position 89 to G, V, L, I, W, P, F, N, Y, T, E, Position 91 to G, A, V, L, I, W, P, M, N, Y, S, T, D, E, R, H, insertion, deletion, Position 92 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 94 to G, V, L, I, W, P, M, F, N, Y, T, D, E, K, H, insertion, deletion, Position 96 to L, W, F, Y, R, K, deletion, Position 97 to V, L, W, C, M, F, Y, H, Position 98 to deletion, Position 101 to V, I, W, M, F, N, Q, Y, H, Position 102 to V, L, I, W, M, F, Y, R, H, G, deletion, Position 108 to I, insertion, Position 109 to N, insertion, Position 111 to insertion, Position 112 to E, insertion, Position 113 to W, insertion, Position 114 to insertion, Position 115 to I, insertion, Position 117 to N, insertion, Position 118 to N, insertion, Position 119 to M, insertion, Position 127 to G, A, V, I, W, M, F, Y, R, H, L, Position 133 to A, L, I, W, M, F, Y, R, Position 134 to L, I, W, F, N, Q, Y, R, H, insertion, deletion, Position 135 to G, L, P, C, N, Q, T, R, H, Position 136 to G, A, W, P, N, Y, S, T, D, E, H, insertion, deletion, Position 137 to G, A, V, I, W, P, M, N, Y, H, insertion, deletion, Position 138 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 139 to G, A, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 141 to G, V, L, I, W, P, M, F, Q, S, D, E, H, insertion, deletion, Position 142 to G, A, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 144 to L, W, P, M, F, N, Q, Y, S, D, E, R, H, insertion, deletion, Position 145 to G, V, L, I, W, M, F, Q, Y, D, E, R, H, insertion, deletion, Position 146 to G, A, W, L, I, W, M, F, N, Q, Y, T, D, E, R, H, insertion, deletion, Position 147 to G, A, V, L, W, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 148 to G, A, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 156 to V, I, W, F, R, Position 158 to V, L, I, W, M, F, Y, Position 160 to W, M, F, Y, R, H, Position 161 to I, W, M, F, Y, H, Position 162 to I, W, F, Y, R, Position 163 to V, W, M, F, H, Position 167 to R, K, Position 169 to C, E, F, G, H, I, K, L, M, N, Q, R, T, V, W, Y, Position 170 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion, Position 171 to D, deletion, Position 174 to G, A, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 176 to G, A, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 182 to A, V, L, I, W, C, M, F, N, Q, Y, S, T, D, E, H, deletion, Position 186 to G, A, V, L, W, M, F, N, Q, Y, S, T, D, E, R, H, deletion, Position 188 to G, A, V, L, W, F, S, R, K, deletion, Position 191 to A, V, L, I, W, M, F, Y, T, R, H, deletion, Position 192 to G, L, I, W, M, N, Q, Y, S, T, D, R, H, deletion, Position 193 to G, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H, deletion, Position 194 to W, N, Q, Y, D, H, Position 195 to W, P, Y, deletion, Position 196 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 197 to G, V, L, I, W, P, M, F, Q, Y, S, T, H, insertion, deletion, Position 198 to G, A, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 203 to V, F, Y, R, H, Position 205 to W, F, Y, R, K, Position 215 to A, L, I, W, M, F, Y, Position 216 to A, L, I, W, M, F, Y, R, Position 217 to W, R, Position 219 to G, A, V, L, I, W, F, Y, R, H, Position 233 to insertion, Position 234 to I, insertion, Position 236 to insertion, Position 237 to insertion, Position 238 to insertion, Position 239 to insertion, Position 240 to insertion, Position 243 to insertion, Position 246 to insertion, Position 247 to G, V, I, W, P, F, Y, S, T, R, insertion, deletion, Position 249 to L, W, P, F, S, D, E, H, insertion, deletion, Position 252 to G, A, W, P, N, Q, Y, T, E, R, H, insertion, deletion, Position 254 to G, V, L, I, W, M, F, N, Q, Y, S, D, E, R, H, insertion, deletion, Position 262 to G, A, V, L, I, W, P, F, N, Q, Y, T, D, E, R, H, insertion, deletion, Position 264a to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion, Position 270 to G, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 273 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 274 to W, P, M, F, N, Q, Y, T, D, E, R, H, Position 275 to G, A, V, L, I, W, M, F, N, Y, T, D, insertion, deletion, Position 276 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion,
with the proviso that the amino acids of the parent enzyme are substituted to another amino acid.
93. The protein variant of claim 76 having modified immunogenicity as compared to its parent protein having at least 81% homology to SEQ ID NO: 33 comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 33:
Position 5 to V, L, I, W, M, F, N, Q, Y, T, R, H, Position 22 to G, V, L, I, W, M, F, Y, S, T, insertion, deletion, Position 26 to G, A, V, L, I, W, M, F, N, Q, Y, S, T, D, E, R, H, insertion, deletion, Position 28 to G, A, V, L, I, W, P, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 37 to L, I, W, M, F, N, Q, Y, S, R, H, Position 40 to V, L, I, W, M, F, N, Q, Y, T, R, H, Position 44 to G, V, L, I, W, P, M, F, Y, S, T, Position 51 to V, L, I, W, M, F, N, Y, R, deletion, insertion, Position 52 to V, L, I, W, M, F, Y, S, T, R, deletion, insertion, Position 55 to G, A, V, L, I, W, C, M, F, N, Q, Y, T, D, E, R, K, H, deletion, insertion, Position 58 to L, W, M, F, N, Y, R, insertion, deletion, Position 61 to V, L, I, W, M, F, Y, insertion, deletion, Position 64 to G, V, L, I, W, P, C, M, F, N, Q, Y, S, T, D, E, R, K, H, insertion, deletion, Position 87 to A, V, L, I, W, M, F, Q, Y, S, T, D, E, H, Position 97 to V, L, W, C, M, F, Y, H, Position 98 to deletion, Position 101 to V, I, W, M, F, N, Q, Y, H, Position 102 to V, L, I, W, M, F, Y, R, H, G, deletion, Position 109 to N, insertion, Position 112 to E, insertion, Position 118 to N, insertion, Position 127 to G, A, V, I, W, M, F, Y, R, H, L, Position 137 to G, A, V, I, W, P, M, N, Y, H, insertion, deletion, Position 146 to G, A, W, L, I, W, M, F, N, Q, Y, T, D, E, R, H, insertion, deletion, Position 156 to V, I, W, F, R, Position 158 to V, L, I, W, M, F, Y, Position 161 to I, W, M, F, Y, H, Position 188 to G, A, V, L, W, F, S, R, K, deletion, Position 192 to G, L, I, W, M, N, Q, Y, S, T, D, R, H, deletion, Position 194 to W, N, Q, Y, D, H, Position 195 to W, P, Y, deletion, Position 203 to V, F, Y, R, H, Position 216 to A, L, I, W, M, F, Y, R, Position 236 to insertion, Position 237 to insertion, Position 262 to G, A, V, L, I, W, P, F, N, Q, Y, T, D, E, R, H, insertion, deletion, Position 264a to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion, deletion.
with the provisio that the amino acids of the parent enzyme are substituted to another mino acid.
94. The protein variant of claim 76, wherein the lipolytic enzyme comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 1:
Q15 to A, C, D, E, F, G, I, K, L, M, N, P, R, S, T, V, W, Y; Y16 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; A18 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; A19 to C, D, E, F, G, H, I, K, L, M, N, Q, R, S, V, W, Y; A20 to C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; N25 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; N26 to A, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; E43 to A, C, D, F, G, H, I, K, L, M, N, R, S, T, V, W, Y; V44 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, W, Y; K46 to A, C, D, E, F, G, H, I, L, M, N, Q, S, T, V, W, Y; A47 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; A49 to C, D, E, F, G, H, I, K, L, M, N, Q, R, S, V, W, Y; L52 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; Y53 to A, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; S54 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, T, V, W, Y; G65 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; L67 to A, C, D, E, F, G, H, I, K, M, N, Q, R, S, T, V, W, Y; A68 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; L69 to A, C, D, E, F, G, H, I, K, M, N, P, Q, S, T, V, W, Y; T72 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, V, W, Y; K74 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; L75 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; V77 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; S79 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; R81 to A, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; S83 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, V, W, Y; S85 to A, D, E, G, H, I, L, M, N, Q, V, W, Y; W89 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, Y; L97 to A, C, D, E, F, G, H, I, K, N, P, R, S, T, W, Y; K98 to A, C, G, H, L, M, N, P, Q, S, T, V, W, Y; E99 to C, F, G, I, M, P, W, Y; G106 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, T, V, W, Y; C107 to A, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; R108 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, Y; G109 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, W, Y; T123 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; L124 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, T, V, W, Y; K127 to A, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; E129 to A, C, D, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; A131 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; V132 to A, C, D, E, F, G, H, I, K, L, N, P, Q, R, S, T, W, Y; Y138 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; V140 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, W, Y; L147 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y; A150 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; T153 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Y164 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; D165 to A, C, E, F, G, H, I, K, L, M, N, Q, S, T, V, W, Y; D167 to A, C, E, F, H, I, L, M, N, P, Q, S, T, V, W, Y; S170 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, T, V, W, Y; Y171 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; G172 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; A173 to C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; P174 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; R175 to A, C, D, E, F, G, H, I, K, L, M, N, Q, S, T, V, W, Y; V176 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, W, Y; G177 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; R179 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; A182 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Y194 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; H198 to A, C, D, E, F, G, I, K, L, M, N, P, Q, R, S, T, V, W, Y; N200 to A, C, D, E, F, G, H, I, K, L, M, P, Q, S, T, V, W, Y; P207 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; P208 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; R209 to C, D, F, G, H, I, K, L, M, N, Q, T, V, W, Y; G212 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; S214 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; H215 to A, C, D, E, F, G, I, K, L, M, N, P, Q, R, S, T, V, W, Y; S216 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, T, V, W, Y; S217 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; P218 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; E219 to C, D, F, H, I, M, P, W, Y; Y220 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; K223 to A, C, D, E, F, G, H, I, L, M, N, Q, S, T, V, W, Y; S224 to A, C, D, E, F, G, H, I, K, L, M, N, Q, T, V, W, Y; D234 to C, E, F, H, I, M, W; I235 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; K237 to A, C, D, E, F, G, H, I, L, N, P, Q, S, T, V, W, Y; I238 to A, C, D, E, F, G, H, K, L, M, N, P, Q, R, S, T, V, W, Y; D242 to C, E, F, G, H, I, M, P, W, Y; A243 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; P250 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; P253 to A, C, D, E, F, G, H, I, K, L, M, N, Q, S, T, V, W, Y; D254 to C, E, F, H, I, M, P, Y; I255 to C, D, E, F, H, L, M, N, Q, W, Y; P256 to C, E, F, G, H, I, K, L, M, N, Q, R, V, W, Y; Y261 to A, C, E, F, G, H, L, M, N, P, Q, R, S, T, V.
95. The protein variant of claim 94, wherein the lipolytic enzyme comprises one or more of the substitutions corresponding to any of the following in SEQ ID NO: 1:
G65 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; L67 to A, C, D, E, F, G, H, I, K, M, N, Q, R, S, T, V, W, Y; R81 to A, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; S83 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, V, W, Y; S85 to A, D, E, G, H, I, L, M, N, Q, V, W, Y; L97 to A, C, D, E, F, G, H, I, K, N, P, R, S, T, W, Y; L124 to A, C, D, E, F, G, H, I, K, M, N, P, Q, R, T, V, W, Y; E129 to A, C, D, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Y164 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; R179 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; A182 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; P207 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; P208 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; R209 to C, D, F, G, H, I, K, L, M, N, Q, T, V, W, Y; G212 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; S214 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; H215 to A, C, D, E, F, G, I, K, L, M, N, P, Q, R, S, T, V, W, Y; S216 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, T, V, W, Y; S217 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; P218 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; E219 to C, D, F, H, I, M, P, W, Y; Y220 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; A243 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; P250 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; P253 to A, C, D, E, F, G, H, I, K, L, M, N, Q, S, T, V, W, Y.
96. The protein variant of claim 95, wherein the lipolytic comprises one or more of the following substitutions:
P207 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; P208 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; S214 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; S216 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, T, V, W, Y; S217 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; A243 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; P250 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; P253 to A, C, D, E, F, G, H, I, K, L, M, N, Q, S, T, V, W, Y.
97. The protein variant of claim 94, wherein the parent lipolytic enzyme has at least 80% homology with SEQ ID NO: 1.
98. The protein variant of claim 76, wherein the carbohydrase is a glucoamylase comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 36:
Position 68 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion, Position 94 to insertion, Position 102 to insertion, Position 122 to insertion, Position 125 to insertion, Position 272 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion, Position 345 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y, deletion, insertion, Position 348 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion, Position 353 to insertion, Position 357 to insertion, Position 359 to insertion, Position 450 to insertion, Position 451 to insertion, Position 468 to insertion,
with the proviso that the amino acids of the parent enzyme are substituted to another amino acid.
99. The protein variant of claim 98, wherein the enzyme is at least 81% homologous, preferably 90% homologous, more preferably 95% homologous, most preferably 99% homologous to Carezyme core (SEQ ID NO: 36).
100. The protein variant of claim 76, wherein the carbohydrase is a Thermamyl-like α-amylase comprising one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 2:
Position TYR 8 to A, C, D, G, K, M, P, R, W, Y, insertion; Position ASP 25 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, insertion; Position ASP 26 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position ALA 27 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position SER 28 to A, C, D, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position ASN 29 to A, C, D, G, K, M, P, R, W, Y; Position ARG 31 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position PRO 41 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position PRO 42 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position TYR 54 to A, C, D, E, G, K, M, P, R, Y, insertion; Position TYR 57 to A, C, D, G, K, M, P, R, W, Y, insertion; Position LEU 62 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position GLY 63 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position GLY 76 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position ARG 78 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position SER 79 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position LEU 88 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position GLY 92 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position ASN 102 to A, C, E, F, G, H, I, L, M, P, Q, S, T, V, W, Y, insertion; Position ALA 107 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position ASP 108 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position ALA 109 to A, C, D, E, F, G, H, K, M, N, P, Q, R, S, W, Y; Position LYS 138 to A, C, E, F, G, I, L, M, N, P, Q, S, T, V, W, insertion; Position ASP 140 to A, C, E, F, G, I, K, L, M, N, P, Q, S, T, V, W; Position PRO 142 to C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position ARG 144 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, Y; Position GLN 170 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position ILE 173 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position ASP 195 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y, deletion, insertion; Position TYR 196 to A, C, D, G, K, M, P, R, W, Y, insertion; Position ASP 232 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position ALA 233 to A, C, D, E, I, K, L, M, N, P, Q, R, W, Y, deletion, insertion; Position GLN 331 to A, C, D, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position TYR 349 to A, C, D, G, K, M, P, R, W, Y, insertion; Position ILE 352 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position GLN 357 to C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position ASP 366 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y, deletion, insertion; Position TYR 367 to C, E, F, H, K, M, N, P, Q, R, V, W, insertion; Position TYR 368 to A, C, D, G, K, M, P, R, W, Y, insertion; Position ILE 370 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position ALA 380 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position LYS 381 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y, deletion, insertion; Position ILE 382 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position PRO 384 to C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, deletion, insertion; Position LEU 386 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position ARG 389 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position GLN 390 to A, C, D, E, F, G, H, I, L, M, N, P, Q, S, T, V, W, Y;
with the proviso that the amino acids of the parent enzyme are substituted to another amino acid.
101. The protein variant of claim 100, wherein the amylase comprises one or more of the following substitutions:
Position PRO 41 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position PRO 42 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position ALA 109 to A, C, D, E, F, G, H, K, M, N, P, Q, R, S, W, Y; Position LYS 138 to A, C, E, F, G, I, L, M, N, P, Q, S, T, V, W; Position ASP 140 to A, C, E, F, G, I, K, L, M, N, P, Q, S, T, V, W; Position PRO 142 to C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position ARG 144 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, Y; Position ASP 366 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y, deletion, insertion; Position TYR 367 to C, E, F, H, K, M, N, P, Q, R, V, W, insertion; Position TYR 368 to A, C, D, G, K, M, P, R, W, Y, insertion; Position ALA 380 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position LYS 381 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y, deletion, insertion; Position ILE 382 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion; Position PRO 384 to C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, V, W, deletion, insertion; Position ARG 389 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y, deletion, insertion;
with the proviso that the amino acids of the parent enzyme are substituted to another amino acid.
102. The protein variant of claim 100, wherein the enzyme is at least 81% homologous, preferably 90% homologous, more preferably 95% homologous, most preferably 99% homologous to SEQ ID NO: 2.
103. The protein variant of claim 100, wherein the enzyme has an amino acid sequence of SEQ ID NO: 2, 4, 5, or 37.
104. A cellulase variant of a microbial parent cellulase having a catalytically active domain classified in family 45, said variant comprises a substitution of one or more amino acid residues at a position corresponding to a position in SEQ ID NO: 4 from the group consisting of:
Position 1 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 2 to A, C, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position 7 to A, C, D, E, F, G, H, K, L, M, N, P, Q, S, T, V, Y; Position 20 to C, D, F, H, I, L, M, N, P, Q, S, T, V, W, Y; Position 23 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position 27 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position 29 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 36 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position 37 to C, D, E, F, G, H, I, K, L, M, P, Q, T, V, W, Y; Position 38 to A, C, D, E, G, H, K, M, N, P, R, S, T, V, W, Y; Position 40 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 41 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 44 to A, C, D, E, F, H, I, L, M, N, S, T, W, Y; Position 54 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position 59 to A, C, D, E, F, G, H, I, K, L, M, N, P, R, S, T, V, W, Y; Position 61 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position 62 to A, C, D, G, H, I, K, L, M, N, P, Q, R, S, T, V, Y; Position 83 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 84 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 95 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position 96 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, V, W, Y; Position 97 to C, D, E, F, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position 98 to C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position 100 to C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position 101 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 131 to C, D, E, F, K, M, P, R, S, W, Y; Position 133 to A, C, E, F, G, H, I, L, M, P, R, S, T, V, W, Y; Position 134 to C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 136 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position 142 to A, C, E, F, G, H, I, K, M, N, P, Q, R, V, W, Y; Position 143 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position 145 to C, E, F, G, H, I, K, L, M, P, R, S, T, V, W, Y; Position 146 to A, C, D, F, G, H, I, K, L, M, N, P, T, V, W, Y; Position 151 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position 153 to C, D, E, F, G, H, I, M, N, P, Q, S, T, V, W, Y; Position 154 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position 155 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 157 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 158 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position 160 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position 162 to C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position 163 to A, C, D, E, F, G, H, I, K, M, P, Q, R, S, T, Y; Position 164 to A, C, D, E, F, G, H, I, L, M, N, P, Q, R, S, T, V, W, Y; Position 165 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position 168 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W; Position 169 to A, C, D, E, G, H, I, K, L, M, N, P, Q, R, S, T, V, Y; Position 170 to A, C, D, E, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position 174 to A, C, D, E, G, H, I, K, L, N, P, Q, R, S, T, V, Y; Position 176 to A, C, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position 177 to C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position 178 to A, C, E, F, G, H, I, K, L, M, Q, R, S, T, V, W, Y; Position 180 to A, C, D, E, F, G, H, I, K, M, N, Q, R, S, T, V, W, Y; Position 183 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position 191 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 195 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 197 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, V, W, Y; and Position 200 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y.
105. The protein variant of claim 104, wherein the carbohydrase comprises one or more of the following substitutions:
Position 20 to C, D, F, H, I, L, M, N, P, Q, S, T, V, W, Y; Position 23 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position 27 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position 83 to C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 84 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 95 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position 96 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, V, W, Y; Position 97 to C, D, E, F, H, I, K, L, M, N, P, Q, R, S, V, W, Y; Position 98 to C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position ALA 100 to C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y; Position 101 to A, C, D, E, F, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 131 to C, D, E, F, K, M, P, R, S, W, Y; Position 142 to A, C, E, F, G, H, I, K, M, N, P, Q, R, V, W, Y; Position 143 to A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; Position 145 to C, E, F, G, H, I, K, L, M, P, R, S, T, V, W, Y; Position 151 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, T, V, W, Y; Position 154 to A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, Y; Position 155 to A, C, D, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 157 to A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; and Position 158 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, Y.
106. The protein variant of claim 104, wherein the enzyme is at least 81% homologous, preferably 90% homologous, more preferably 95% homologous, most preferably 99% homologous to Carezyme core (SEQ ID NO: 4).
107. The protein variant of claim 76, wherein the laccase is a Coprinus-like laccase.
108. The protein variant of claim 107, wherein the laccase comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 3:
Position 5 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 8 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 10 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 12 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 22 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 23 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 30 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 39 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 40 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 41 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 42 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 43 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 51 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 53 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 55 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 58 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 59 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 60 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 71 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 72 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 78 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 79 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 80 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 100 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 101 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 102 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 112 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 113 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 114 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 118 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 139 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 142 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 155 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 157 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 165 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 166 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 168 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 175 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 180 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 183 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 186 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 190 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 191 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 192 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 193 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 211 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 213 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 231 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 234 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 236 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 241 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 251 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 257 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 259 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 265 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 275 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 286 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 294 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 295 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 296 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 299 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 300 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 301 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 302 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 306 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 313 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 314 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 315 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 320 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 321 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 322 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 324 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 329 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 332 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 335 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 336 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 339 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 344 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 345 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 348 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 349 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 350 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 366 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 367 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 369 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 370 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 371 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 372 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 375 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 378 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 379 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 389 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 390 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 409 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 410 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 414 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 416 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 418 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 419 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 420 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 430 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 432 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 433 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 434 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 442 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 443 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 445 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 446 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 469 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 473 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 485 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 488 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 490 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 491 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 492 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 493 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 494 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 495 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 496 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 499 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 500 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 501 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y;
with the proviso that the amino acids of the parent protein is substituted to another amino acid.
109. The protein variant of claim 108, wherein the laccase comprises one or more of the following substitutions corresponding to any of the following in SEQ ID NO: 3:
Position 59 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 96 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 100 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 181 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 348 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 369 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 414 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 432 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; Position 493 to A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y;
with the proviso that the amino acids of the parent protein is substituted to another amino acid.
110. A subtilisin variant comprising one or more of the insertions, substitutions and/or deletions in any of the positions of claim 77.
111. The variant of claim 110, wherein the subtilisin has at least 60%, preferably at least 70%, more preferably at least 80, even more preferably at least 90, still more preferably at least 95%, most preferably at least 99% homology to SEQ ID NO; 10.
112. A lipolytic enzyme comprising one or more of the insertions, substitutions and/or deletions in any of the positions of claim 94.
113. A glycoamylase variant comprising one or more of the insertions, substitutions and/or deletions in any of the positions of claim 98.
114. The variant of claim 113, wherein the variant has at least 60%, preferably at least 70%, more preferably at least 80, even more preferably at least 90, still more preferably at least 95%, most preferably at least 99% homology to SEQ ID NO: 36.
115. A Termamyl-like alpha-amylase comprising one or more of the insertions, substitutions and/or deletions in any of the positions of claim 100.
116. The variant of claim 115, wherein the variant has at least 60%, preferably at least 70%, more preferably at least 80, even more preferably at least 90, still more preferably at least 95%, most preferably at least 99% homology to SEQ ID NO; 2.
117. A cellulase variant comprising one or more of the insertions, substitutions and/or deletions in any of the positions of claim 104.
118. The variant of claim 117, wherein the variant has at least 60%, preferably at least 70%, more preferably at least 80, even more preferably at least 90, still more preferably at least 95%, most preferably at least 99% homology to SEQ ID NO: 10.
119. A Coprinus-like laccase variant comprising one or more of the insertions, substitutions and/or deletions in any of the positions of claim 107.
120. A composition comprising a protein variant of claim 22.
121. The composition of claim 120, wherein the composition is in form of a pharmaceutical composition such as a vaccine.
122. The composition of claim 120, wherein the compositions is in form of a industrial composition such as, a detergent composition, personal care composition.
123. The use of the composition as defined in claim 120 for the production of a pharmaceutical.
124. The use of the composition as defined in claim 120 for industrial application.
125. A DNA construct comprising a DNA sequence encoding a protein variant of claim 22.
126. An expression vector comprising a DNA construct of claim 125.
127. A host cell which is capable of expressing a polypeptide and comprising a DNA construct of claim 125.
128. A host cell which is capable of expressing a polypeptide and which is transformed by an expression vector of claim 126.
129. A host cell of claim 127, which is a fungal cell, an insect cell, a mammalian cell, or a plant cell.
130. A method of producing a protein variant having reduced immunogenicity as compared to the parent protein, comprising:
(a) culturing a host of claim 127 in a suitable culture medium to obtain expression and secretion of the protein into the medium, followed by
(b) isolation of the protein from the culture medium.
131. A kit for characterizing specificity of the allergic response of a patient, comprising a set of antibody binding peptide sequences corresponding to at least one epitope on at least one potential allergen.
132. The kit of claim 131, for which the antibody binding sequences each are specific for one out of a known range of allergens, such that the characterization of allergic specificity becomes less susceptibility to cross-reactivity interferences.
133. A kit of claim 131, which further comprises other diagnostic reagents, which facilitate determination of the serum response to each of the antibody binding sequences.
134. A kit of claim 131, further comprising allergen vaccines, which can be administered to the patient according to the test results obtained using the antibody binding sequences.
US09/957,806 2000-04-28 2001-09-21 Protein variants having modified immunogenicity Abandoned US20050181446A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
US09/957,806 US20050181446A1 (en) 2000-04-28 2001-09-21 Protein variants having modified immunogenicity
US12/699,979 US20110045572A1 (en) 2000-04-28 2010-02-04 Protein variants having modified immunogenicity
US13/936,300 US20140011259A1 (en) 2000-04-28 2013-07-08 Protein Variants Having Modified Immunogenicity
US14/514,652 US20150037872A1 (en) 2000-04-28 2014-10-15 Protein Variants Having Modified Immunogenicty

Applications Claiming Priority (9)

Application Number Priority Date Filing Date Title
DKPA200000707 2000-04-28
DKPA200000707 2000-04-28
US20334500P 2000-05-10 2000-05-10
DKPA200100327 2001-02-28
DKPA200100327 2001-02-28
US27781701P 2001-03-21 2001-03-21
WOPCT/DK01/00293 2001-04-30
PCT/DK2001/000293 WO2001083559A2 (en) 2000-04-28 2001-04-30 Production and use of protein variants having modified immunogenecity
US09/957,806 US20050181446A1 (en) 2000-04-28 2001-09-21 Protein variants having modified immunogenicity

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/DK2001/000293 Continuation WO2001083559A2 (en) 2000-04-28 2001-04-30 Production and use of protein variants having modified immunogenecity

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US12/699,979 Continuation US20110045572A1 (en) 2000-04-28 2010-02-04 Protein variants having modified immunogenicity

Publications (1)

Publication Number Publication Date
US20050181446A1 true US20050181446A1 (en) 2005-08-18

Family

ID=26068820

Family Applications (6)

Application Number Title Priority Date Filing Date
US09/869,877 Abandoned US20020192792A1 (en) 2000-04-28 2001-04-30 Laccase mutants
US10/258,783 Expired - Lifetime US7226770B2 (en) 2000-04-28 2001-04-30 Lipolytic enzyme variant
US09/957,806 Abandoned US20050181446A1 (en) 2000-04-28 2001-09-21 Protein variants having modified immunogenicity
US12/699,979 Abandoned US20110045572A1 (en) 2000-04-28 2010-02-04 Protein variants having modified immunogenicity
US13/936,300 Abandoned US20140011259A1 (en) 2000-04-28 2013-07-08 Protein Variants Having Modified Immunogenicity
US14/514,652 Abandoned US20150037872A1 (en) 2000-04-28 2014-10-15 Protein Variants Having Modified Immunogenicty

Family Applications Before (2)

Application Number Title Priority Date Filing Date
US09/869,877 Abandoned US20020192792A1 (en) 2000-04-28 2001-04-30 Laccase mutants
US10/258,783 Expired - Lifetime US7226770B2 (en) 2000-04-28 2001-04-30 Lipolytic enzyme variant

Family Applications After (3)

Application Number Title Priority Date Filing Date
US12/699,979 Abandoned US20110045572A1 (en) 2000-04-28 2010-02-04 Protein variants having modified immunogenicity
US13/936,300 Abandoned US20140011259A1 (en) 2000-04-28 2013-07-08 Protein Variants Having Modified Immunogenicity
US14/514,652 Abandoned US20150037872A1 (en) 2000-04-28 2014-10-15 Protein Variants Having Modified Immunogenicty

Country Status (8)

Country Link
US (6) US20020192792A1 (en)
EP (7) EP1280817A2 (en)
AT (1) ATE471377T1 (en)
AU (3) AU2001254620A1 (en)
CA (1) CA2406621A1 (en)
DE (1) DE60142415D1 (en)
ES (1) ES2588756T3 (en)
WO (3) WO2001083770A2 (en)

Cited By (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030119066A1 (en) * 2001-10-05 2003-06-26 Novozymes A/S Diagnostic kit for detecting immunogenic response and method of screening
US20040147008A1 (en) * 2002-11-06 2004-07-29 Novozymes A/S Subtilase variants
US20040175757A1 (en) * 1998-10-30 2004-09-09 Novozymes A/S Low allergenic protein variants
US20050003986A1 (en) * 1988-01-07 2005-01-06 Novozymes A/S Useful mutations of bacterial alkaline protease
US20050003985A1 (en) * 2001-10-31 2005-01-06 Beatrix Kottwitz Alkaline protease variants
US20050026269A1 (en) * 2001-05-02 2005-02-03 Beatrix Kottwitz Novel alkaline protease variants and detergents and cleaning agents containing said novel alkaline protease variants
US20050170488A1 (en) * 2002-01-16 2005-08-04 Poulose Ayrookaran J. Multiply-substituted protease variants
US20050281773A1 (en) * 2002-12-20 2005-12-22 Henkel Kommanditgesellschaft Auf Aktien Subtilisin variants with improved perhydrolase activity
US20060036083A1 (en) * 2002-02-19 2006-02-16 Joel Moss Modified defensins and their use
US20060228791A1 (en) * 2002-06-26 2006-10-12 Novozymes A/S Subtilases and subtilase variants having altered immunogenicity
US20080124783A1 (en) * 2002-01-16 2008-05-29 Poulose Ayrookaran J Multiply-substituted protease variants
US20080167213A1 (en) * 2001-07-12 2008-07-10 Novozymes A/S Subtilase Variants
WO2008092992A1 (en) 2007-01-29 2008-08-07 Valtion Teknillinen Tutkimuskeskus Allergen-binding ige monoclonal antibodies and method for preparing hypoallergens
US20090060933A1 (en) * 2004-06-14 2009-03-05 Estell David A Proteases producing an altered immunogenic response and methods of making and using the same
US20090143311A1 (en) * 2005-04-28 2009-06-04 Luppo Edens Compositions comprising tripeptides inhibiting ace
US20090304869A1 (en) * 2005-04-28 2009-12-10 Christianus Jacobus Van Platerink Peptides Having an Ace Inhibiting Effect
US20100120091A1 (en) * 2005-07-08 2010-05-13 Novozymes A/S Subtilase variants
US20100132131A1 (en) * 2006-01-23 2010-06-03 Philip Frank Souter Detergent compositions
US20100152088A1 (en) * 2008-11-11 2010-06-17 Estell David A Compositions and methods comprising a subtilisin variant
US20110251073A1 (en) * 2008-06-06 2011-10-13 Cascao-Pereira Luis G Compositions And Methods Comprising Variant Microbial Proteases
US20120178148A1 (en) * 2009-09-07 2012-07-12 Reckitt Benckiser N.V. Detergent Composition
US20120252106A1 (en) * 2009-09-25 2012-10-04 Novozymes A/S Use of Protease Variants
US20130344568A1 (en) * 2003-01-30 2013-12-26 Novozymes A/S Subtilases
US20140335596A1 (en) * 2011-12-20 2014-11-13 Novozymes A/S Subtilase Variants and Polynucleotides Encoding Same
EP3567547A1 (en) * 2013-10-11 2019-11-13 Mauna Kea Technologies Method for characterizing images acquired through a video medical device
US11485768B2 (en) 2016-04-19 2022-11-01 Imcyse Sa Immunogenic CD1d binding peptides
US11787849B2 (en) * 2015-09-25 2023-10-17 Imcyse Sa Methods and compounds for eliminating immune responses to therapeutic agents

Families Citing this family (77)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20120165241A1 (en) * 1995-05-05 2012-06-28 Unilever Plc Subtilase Variants
US6682924B1 (en) * 1995-05-05 2004-01-27 Novozymes A/S Protease variants and compositions
US6936289B2 (en) 1995-06-07 2005-08-30 Danisco A/S Method of improving the properties of a flour dough, a flour dough improving composition and improved food products
EP1433852B1 (en) 1997-04-09 2006-06-28 Danisco A/S Use of lipase for improving doughs and baked products
AU2003203147B2 (en) 1998-03-23 2008-05-29 Novozymes A/S Phytase variants
DK1098988T4 (en) 1998-07-21 2007-09-03 Danisco Food
AU5805700A (en) * 1999-07-09 2001-01-30 Novozymes A/S Glucoamylase variant
CA2406621A1 (en) 2000-04-28 2001-11-08 Novozymes A/S Protein variants having modified immunogenicity
EP1301080B1 (en) 2000-07-06 2011-09-14 Novozymes A/S Method of preparing a dough, or a baked product made from a dough, with addition of lipolytic enzymes
HUP0300840A2 (en) 2000-07-28 2003-07-28 Henkel Kommanditgesellschaft Auf Aktien Novel, amylolytic enzyme ectracted from bacillus sp. a 7-7 (dsm 12368) and washing and cleaning agents containing this novel amylolytic enzyme
CA2431972C (en) 2001-01-10 2012-10-23 Novozymes A/S Thermostable lipolytic enzyme variant
NZ528260A (en) 2001-05-18 2005-09-30 Danisco Method of improving dough and bread quality with the addition of an enzyme that hydrolyses a glycolipid and a phospholipid and incapable of hydrolysing a triglyceride or monoglyceride
DK2295556T3 (en) 2002-01-16 2015-01-26 Novozymes As Lipolytic Enzyme Variants and Method of Preparation thereof.
EP1504089A2 (en) * 2002-05-16 2005-02-09 Alk Abell A/S Allergen mutants
DE60319872T2 (en) * 2002-12-12 2009-03-05 Novozymes A/S METHOD FOR SELECTION OF A LIPOLYTIC ENZYME
MXPA05007654A (en) 2003-01-17 2005-09-30 Danisco Method.
US7955814B2 (en) 2003-01-17 2011-06-07 Danisco A/S Method
US20050196766A1 (en) 2003-12-24 2005-09-08 Soe Jorn B. Proteins
EP1597344A2 (en) * 2003-02-18 2005-11-23 Novozymes A/S Detergent compositions
EP2500423B1 (en) 2003-02-26 2015-06-17 Danisco US Inc. Amylases producing an altered immunogenic response and methods of making and using the same
CN1745169A (en) 2003-02-26 2006-03-08 金克克国际有限公司 Amylase producing an altered immunogenic response and methods of making and using the same
AU2004233940A1 (en) * 2003-04-25 2004-11-11 Novozymes A/S Group 1 mite polypeptide variants
EP2290057A3 (en) 2003-05-09 2011-08-03 Novozymes A/S Variant lipolytic enzymes
US20060236414A1 (en) 2003-06-19 2006-10-19 Novozymes A/S Proteases and methods for producing them
US20060251763A1 (en) * 2003-06-19 2006-11-09 Patkar Shamkant A Phospholipase variants
DE602004027376D1 (en) 2003-06-19 2010-07-08 Novozymes As PROTEASE
EP2284259A3 (en) 2003-10-10 2011-06-15 Novozymes A/S Protease variants
US7906307B2 (en) 2003-12-24 2011-03-15 Danisco A/S Variant lipid acyltransferases and methods of making
GB0716126D0 (en) 2007-08-17 2007-09-26 Danisco Process
US7718408B2 (en) 2003-12-24 2010-05-18 Danisco A/S Method
GB0405637D0 (en) 2004-03-12 2004-04-21 Danisco Protein
CA2591858C (en) 2004-06-21 2015-05-05 Novozymes A/S Proteases derived from norcardiopsis
GB0416035D0 (en) * 2004-07-16 2004-08-18 Danisco Protein
EA014985B1 (en) 2004-07-16 2011-04-29 Даниско А/С A process of enzymatic degumming edible oils by hydration and use lipid acyltransferase for carrying out the process
MX285771B (en) 2004-10-04 2011-04-07 Novozymes As Polypeptides having phytase activity and polynucleotides encoding same.
AR050895A1 (en) 2004-10-04 2006-11-29 Novozymes As POLYPEPTIDES THAT HAVE FITASA ACTIVITY AND POLYUCLEOTIDES THAT CODE THEM
EP1812463A2 (en) * 2004-10-22 2007-08-01 Novozymes A/S Group 2 mite polypeptide variants
BRPI0611892A2 (en) 2005-06-13 2011-01-04 Novozymes As method for producing reduced phosphorus alkyl fatty acid esters
US20070148311A1 (en) * 2005-12-22 2007-06-28 Bunge Oils, Inc. Phytosterol esterification product and method of make same
EP1976967A2 (en) * 2006-01-23 2008-10-08 The Procter and Gamble Company Detergent compositions
ES2629332T3 (en) 2006-01-23 2017-08-08 Novozymes A/S Lipase variants
EP1998793A1 (en) 2006-03-22 2008-12-10 Novozymes A/S Use of polypeptides having antimicrobial activity
AU2007234177B2 (en) 2006-04-04 2012-11-08 Novozymes A/S Phytase variants
US8273348B2 (en) 2006-12-21 2012-09-25 Novozymes A/S Lipase variants for pharmaceutical use
US8221743B2 (en) 2006-12-22 2012-07-17 Novozymes A/S Use of polypeptides against diseases caused by protozoans
AU2007344910B2 (en) 2007-01-25 2013-03-28 Dupont Nutrition Biosciences Aps Production of a lipid acyltransferase from transformed Bacillus licheniformis cells
US8460905B2 (en) * 2007-09-11 2013-06-11 Bunge Oils, Inc. Enzymatic degumming utilizing a mixture of PLA and PLC phospholipases with reduced reaction time
US8956853B2 (en) * 2007-01-30 2015-02-17 Bunge Oils, Inc. Enzymatic degumming utilizing a mixture of PLA and PLC phospholipases
WO2008116878A1 (en) 2007-03-26 2008-10-02 Novozymes A/S Hafnia phytase
US8241876B2 (en) 2008-01-07 2012-08-14 Bunge Oils, Inc. Generation of triacylglycerols from gums
MX2010009464A (en) 2008-02-29 2010-09-22 Dsm Ip Assets Bv Lipases with high specificity towards short chain fatty acids and uses thereof.
PL2342323T3 (en) 2008-09-26 2013-11-29 Novozymes As Hafnia phytase variants
WO2011078949A1 (en) 2009-12-21 2011-06-30 Danisco Us Inc. Surfactants that improve the cleaning of lipid-based stains treated with lipases
WO2012023021A1 (en) * 2010-08-17 2012-02-23 Council Of Scientific & Industrial Research (An Indian Registered Body Incorporated Under The Registration Of Societies Act (Act Xxxi Of 1860) Method for obtaining laccase enzyme from arthrographis sp.
WO2013138310A1 (en) * 2012-03-13 2013-09-19 Array Bridge Inc. An antibody array used for the analysis of the three-dimensional structure of protein therapeutics and its production
CN110093330B (en) * 2012-10-12 2023-11-28 丹尼斯科美国公司 Compositions and methods comprising lipolytic enzyme variants
WO2014067933A1 (en) 2012-10-31 2014-05-08 C-Lecta Gmbh Bioactive carrier preparation for enhanced safety in care products and food
BR112016022447A2 (en) * 2014-03-28 2017-10-10 Novozymes As resolubilization of low protein ph crystals
KR101655276B1 (en) * 2014-10-23 2016-09-08 대한민국(환경부 국립생물자원관장) Cosmetic composition for anti-oxidant and skin whitening effect comprising Ambrosia trifida extract as effective component
WO2016090059A1 (en) 2014-12-02 2016-06-09 Novozymes A/S Laccase variants and polynucleotides encoding same
EP3234123B1 (en) * 2014-12-19 2020-06-03 Novozymes A/S Protease variants and polynucleotides encoding same
US11198860B2 (en) 2014-12-19 2021-12-14 Novozymes A/S Protease variants and polynucleotides encoding same
AU2016244755B2 (en) * 2015-04-06 2020-11-26 International N&H Denmark Aps Proteases for high protein fermented milk products
CN108239626B (en) * 2016-12-27 2022-10-04 丰益(上海)生物技术研发中心有限公司 Lipase mutant with high esterification activity
CN109280091A (en) * 2018-11-27 2019-01-29 苏州卫生职业技术学院 A kind of biological enzyme extraction process of bitter gourd polysaccharide
CN109912707B (en) * 2019-03-07 2022-03-11 辽宁师范大学 Lampetra lamprey immune protein LIP mutant capable of being used as tumor diagnosis marker
CN111979208B (en) * 2019-05-23 2023-01-10 弈柯莱生物科技(上海)股份有限公司 A kind of L-glutamic acid dehydrogenase mutant and its application
CN110684751B (en) * 2019-10-23 2021-06-25 江南大学 A starch branching enzyme mutant with enhanced catalytic capacity
US12037613B2 (en) 2020-08-13 2024-07-16 Novozymes A/S Phytase variants and polynucleotides encoding same
WO2022043563A1 (en) * 2020-08-28 2022-03-03 Novozymes A/S Polyester degrading protease variants
US20240316187A1 (en) * 2021-08-03 2024-09-26 Helmholtz Zentrum München - Deutsches Forschungszentrum für Gesundheit und Umwelt (GmbH) Proteins identified from barn dust extract for the prevention and treatment of diseases
CN114703212B (en) * 2022-03-01 2024-03-29 东华大学 Method for modifying laccase by using specific segment random mutation method and laccase strain LAC123
US20250311734A1 (en) 2022-05-14 2025-10-09 Novozymes A/S Compositions and Methods for Preventing, Treating, Suppressing and/or Eliminatting Phytopathogenic Infestations and Infections
EP4461796A1 (en) * 2023-05-10 2024-11-13 Novozymes A/S Detergent composition comprising laccase
EP4461795A1 (en) * 2023-05-10 2024-11-13 Novozymes A/S Detergent composition comprising laccase
CN117603929B (en) * 2023-11-28 2025-08-12 安徽大学 A laccase mutant enzyme, its encoding gene, expression strain and application thereof
CN117925549B (en) * 2023-12-12 2026-03-27 天津科技大学 A heat-resistant laccase mutant, its gene, engineered bacteria, preparation method, and application

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6686164B1 (en) * 1998-10-30 2004-02-03 Novozymes A/S Low allergenic protein variants

Family Cites Families (88)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1585105A (en) 1976-04-29 1981-02-25 Unilever Ltd Emulsions
GB1590432A (en) 1976-07-07 1981-06-03 Novo Industri As Process for the production of an enzyme granulate and the enzyme granuate thus produced
JPS57189638A (en) 1981-05-20 1982-11-22 Yakult Honsha Co Ltd Production of liquid fermented milk
DK289083A (en) 1983-06-23 1984-12-24 Novo Industri As LIPASE, PROCEDURE FOR PREPARING THEREOF AND ITS APPLICATION
DK263584D0 (en) 1984-05-29 1984-05-29 Novo Industri As ENZYMOUS GRANULATES USED AS DETERGENT ADDITIVES
DE3423699C1 (en) 1984-06-27 1986-01-16 Maggi AG, Kempttal Sauce improver in tubes
GB8525012D0 (en) 1985-10-10 1985-11-13 Cpc International Inc Carbohydrate refining process
EP0258068B1 (en) 1986-08-29 1994-08-31 Novo Nordisk A/S Enzymatic detergent additive
DE3854249T2 (en) * 1987-08-28 1996-02-29 Novonordisk As Recombinant Humicola Lipase and Process for the Production of Recombinant Humicola Lipases.
ES2032000T3 (en) 1987-12-03 1993-01-01 Unilever Nv A PROCEDURE FOR THE PREPARATION OF A WATER AND OIL EMULSION.
DK6488D0 (en) * 1988-01-07 1988-01-07 Novo Industri As ENZYMES
JP2794574B2 (en) 1988-08-11 1998-09-10 昭和産業株式会社 Method for producing lysolecithin
JP2709736B2 (en) 1988-08-11 1998-02-04 昭和産業株式会社 Oil and fat refining method
JPH02160984A (en) 1988-12-09 1990-06-20 Novo Ind As Deinking method of waste paper
JPH02160997A (en) 1988-12-13 1990-06-20 Jujo Paper Co Ltd Method for preventing trouble by pitch
JP2877439B2 (en) 1989-05-17 1999-03-31 協和醗酵工業株式会社 How to modify eggs
US5665587A (en) * 1989-06-26 1997-09-09 Novo Nordisk A/S Modified subtilisins and detergent compositions containing same
DE3922748B4 (en) 1989-07-11 2006-01-05 Röhm GmbH & Co. KG Enzymatic soft process
EP0426211B1 (en) 1989-09-29 1993-11-24 Unilever N.V. Food product containing dried lyso-phospholipoprotein
DK0495064T3 (en) * 1990-08-13 2001-10-15 Biomay Prod & Handel Birch pollen allergen P14 for the diagnosis and therapy of allergic diseases
AT401180B (en) * 1990-08-13 1996-07-25 Biomay Biotech Prod FOR THE TREE POLLEN ALLERGEN P14 CODING RECOMBINANT DNA MOLECULES, MADE AND DERIVED POLYPEPTIDES THEREOF AND THEIR USE
DK0548228T3 (en) 1990-09-13 1999-05-10 Novo Nordisk As lipase variants
US5869438A (en) 1990-09-13 1999-02-09 Novo Nordisk A/S Lipase variants
US5892013A (en) * 1990-09-13 1999-04-06 Novo Nordisk A/S Lipase variants
JPH0687751B2 (en) 1990-09-26 1994-11-09 辻製油株式会社 Method for collecting lysolecithin containing high concentration of lysophosphatidylcholine
SK21093A3 (en) 1990-09-28 1993-10-06 Procter & Gamble Polyhydroxy fatty acid amide surfactants to enhace enzyme performance
DK249990D0 (en) 1990-10-17 1990-10-17 Novo Nordisk As PROCEDURE FOR ENZYMATIC PULP TREATMENT
CA2095852C (en) * 1990-12-05 2001-05-08 Uffe Lovborg Proteins with changed epitopes and methods for the production thereof
JPH04240286A (en) 1991-01-25 1992-08-27 Novo Nordisk As How to prevent pitch trouble using heat-resistant lipase
DE4109826A1 (en) 1991-03-26 1992-11-05 Roehm Gmbh ENZYMATICALLY SUPPORTED AESCHER AND BEATING PROCESS
JPH06507071A (en) 1991-05-01 1994-08-11 ノボザイムス アクティーゼルスカブ stabilizing enzyme
DE4115938A1 (en) 1991-05-16 1992-11-19 Metallgesellschaft Ag ENZYMATIC METHOD FOR REDUCING THE CONTENT OF PHOSPHORUS-CONTAINING COMPONENTS IN VEGETABLE AND ANIMAL OILS
ES2264915T3 (en) 1991-12-20 2007-02-01 Novozymes A/S ELIMINATION OF HYDROPHOBIC ESTERS OF FABRICS.
ES2098389T3 (en) 1992-04-25 1997-05-01 Nestle Sa AROMATIZATION PROCEDURE OF A CHOCOLATE WITH MILK.
DK104592D0 (en) 1992-08-21 1992-08-21 Novo Nordisk As COURSE OF ACTION
DE69313102T2 (en) 1993-06-11 1997-12-11 Nestle Sa Composition for heat stabilization of proteins and product therefrom
US6436690B1 (en) * 1993-09-15 2002-08-20 The Procter & Gamble Company BPN′ variants having decreased adsorption and increased hydrolysis wherein one or more loop regions are substituted
DE4339556C1 (en) 1993-11-19 1995-02-02 Metallgesellschaft Ag Process for degumming vegetable oil by means of enzymes
US5929017A (en) 1994-10-26 1999-07-27 Novonordisk A/S Enzymatic detergent composition
GB2296011B (en) 1994-12-13 1999-06-16 Solvay Novel fusarium isolate and lipases, cutinases and enzyme compositions derived therefrom
US6475765B1 (en) * 1995-03-09 2002-11-05 Procter & Gamble Company Subtilisin DY variants having decreased adsorption and increased hydrolysis
IL117350A0 (en) * 1995-03-09 1996-07-23 Procter & Gamble Proteinase k variants having decreased adsorption and increased hydrolysis
US5837517A (en) * 1995-05-05 1998-11-17 Novo Nordisk A/S Protease variants and compositions
US6682924B1 (en) * 1995-05-05 2004-01-27 Novozymes A/S Protease variants and compositions
EP0839186B1 (en) * 1995-07-14 2004-11-10 Novozymes A/S A modified enzyme with lipolytic activity
JP4068142B2 (en) 1995-08-11 2008-03-26 ノボザイムス アクティーゼルスカブ Novel lipolytic enzyme
ZA967411B (en) * 1995-09-01 1997-04-16 Novo Nordisk Biotech Inc Blue copper oxidase mutants with enhanced activity
EP0876489A2 (en) 1996-01-24 1998-11-11 Novo Nordisk Biotech, Inc. Nucleic acids encoding polypeptides having absidia lipase activity
US5804201A (en) * 1996-03-11 1998-09-08 The Rockefeller University Immunomodulatory peptides of vespid antigen 5
AU2382397A (en) 1996-04-25 1997-11-19 Novo Nordisk A/S Alkaline lipolytic enzyme
WO1997043375A1 (en) 1996-05-15 1997-11-20 The Procter & Gamble Company Detergent compositions comprising specific lipolytic enzyme and a specific surfactant system
JP3791058B2 (en) 1996-07-30 2006-06-28 日本油脂株式会社 Method for producing lysolecithin
WO1998008939A1 (en) 1996-08-27 1998-03-05 Novo Nordisk A/S Novel lipolytic enzymes
JPH10155493A (en) 1996-10-04 1998-06-16 Sankyo Co Ltd Gene encoding phospholipase A1 from Aspergillus
CN1530443A (en) * 1996-11-04 2004-09-22 ŵ����÷�����޹�˾ subtilase variants and compositions
DE69716711T3 (en) 1996-12-09 2010-06-10 Novozymes A/S Reduction of phosphorus-containing substances in high non-hydratable phosphorus edible oils using a phospholipase, a filamentous fungal phospholipase having a phospholipase A and / or B activity
US5998353A (en) * 1996-12-19 1999-12-07 Novo Nordisk A/S Laccase mutants
EP0956345A1 (en) * 1996-12-19 1999-11-17 Novo Nordisk A/S Laccase mutants
DE19701348A1 (en) 1997-01-16 1998-07-23 Roehm Gmbh Protein with phospholipase activity
JP2001511162A (en) * 1997-02-06 2001-08-07 ノボ ノルディスク アクティーゼルスカブ Polypeptide-polymer conjugates with attached and / or removed attachment groups
AU5983398A (en) * 1997-02-28 1998-09-18 Novo Nordisk A/S Laccase mutants
JP3853464B2 (en) 1997-04-08 2006-12-06 辻製油株式会社 Production method of plant lysolecithin
EP1433852B1 (en) 1997-04-09 2006-06-28 Danisco A/S Use of lipase for improving doughs and baked products
WO1999011768A1 (en) * 1997-08-29 1999-03-11 Novo Nordisk A/S Protease variants and compositions
BR9811412A (en) * 1997-08-29 2000-08-22 Novo Nordisk As Subtilase enzyme variant having improved detergent washing performance, isolated DNA sequence, expression vector, microbial host cell, processes for producing a variant and for identifying a protease variant, composition, and, use of a subtilase variant
AR016969A1 (en) * 1997-10-23 2001-08-01 Procter & Gamble PROTEASE VARIANTE, ADN, EXPRESSION VECTOR, GUEST MICROORGANISM, CLEANING COMPOSITION, ANIMAL FOOD AND COMPOSITION TO TREAT A TEXTILE
US6780629B2 (en) * 1997-11-21 2004-08-24 Novozymes A/S Subtilase enzymes
ATE298791T1 (en) * 1997-11-21 2005-07-15 Novozymes As PROTEASE VARIANTS AND COMPOSITIONS
US6773907B2 (en) * 1997-11-21 2004-08-10 Peter Kamp Hansen Subtilase enzymes
CA2317724A1 (en) * 1998-01-09 1999-07-15 Circassia Limited Methods and compositions for desensitisation
ATE430199T1 (en) * 1998-01-31 2009-05-15 Univ Arkansas METHODS AND REAGENTS FOR REDUCING THE CLINICAL RESPONSE TO ALLERGY
AU3247699A (en) * 1998-02-17 1999-09-06 Novo Nordisk A/S Lipase variant
ATE408690T1 (en) * 1998-03-16 2008-10-15 Alk Abello As MUTATED RECOMBINANT ALLERGEN
US6835550B1 (en) * 1998-04-15 2004-12-28 Genencor International, Inc. Mutant proteins having lower allergenic response in humans and methods for constructing, identifying and producing such proteins
US6461849B1 (en) * 1998-10-13 2002-10-08 Novozymes, A/S Modified polypeptide
US6376450B1 (en) * 1998-10-23 2002-04-23 Chanchal Kumar Ghosh Cleaning compositions containing multiply-substituted protease variants
JP2003500003A (en) * 1998-10-30 2003-01-07 ノボザイムス アクティーゼルスカブ Low allergenic protein variants
EP1131416B1 (en) 1998-11-27 2009-09-02 Novozymes A/S Lipolytic enzyme variants
EP1033405A3 (en) * 1999-02-25 2001-08-01 Ceres Incorporated Sequence-determined DNA fragments and corresponding polypeptides encoded thereby
US8229721B1 (en) * 1999-11-03 2012-07-24 Lonza Biologics Plc Apparatus and method for structure-based prediction of amino acid sequences
US6777218B1 (en) * 2000-03-14 2004-08-17 Novozymes A/S Subtilase enzymes having an improved wash performance on egg stains
US6902922B2 (en) * 2000-04-03 2005-06-07 Novozymes A/S Subtilisin variants
CA2406621A1 (en) 2000-04-28 2001-11-08 Novozymes A/S Protein variants having modified immunogenicity
US7109016B2 (en) * 2000-08-21 2006-09-19 Novozymes A/S Subtilase enzymes
US6893855B2 (en) * 2000-10-13 2005-05-17 Novozymes A/S Subtilase variants
US7888093B2 (en) * 2002-11-06 2011-02-15 Novozymes A/S Subtilase variants
CN102766545B (en) * 2003-05-07 2014-08-06 诺维信公司 Variant subtilisin enzymes (subtilases)
US20070161531A1 (en) * 2005-07-08 2007-07-12 Novozymes A/S Subtilase variants

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6686164B1 (en) * 1998-10-30 2004-02-03 Novozymes A/S Low allergenic protein variants
US20040175757A1 (en) * 1998-10-30 2004-09-09 Novozymes A/S Low allergenic protein variants

Cited By (64)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050003986A1 (en) * 1988-01-07 2005-01-06 Novozymes A/S Useful mutations of bacterial alkaline protease
US20040175757A1 (en) * 1998-10-30 2004-09-09 Novozymes A/S Low allergenic protein variants
US20050026269A1 (en) * 2001-05-02 2005-02-03 Beatrix Kottwitz Novel alkaline protease variants and detergents and cleaning agents containing said novel alkaline protease variants
US20080167213A1 (en) * 2001-07-12 2008-07-10 Novozymes A/S Subtilase Variants
US8569035B2 (en) 2001-07-12 2013-10-29 Novozymes A/S Subtilase variants
US20110152155A1 (en) * 2001-07-12 2011-06-23 Novozymes A/S Subtilase variants
US10351837B2 (en) 2001-07-12 2019-07-16 Novozymes A/S Subtilase variants
US20150024990A1 (en) * 2001-07-12 2015-01-22 Novozymes A/S Subtilase Variants
US9528100B2 (en) * 2001-07-12 2016-12-27 Novozymes A/S Subtilase variants
US20030119066A1 (en) * 2001-10-05 2003-06-26 Novozymes A/S Diagnostic kit for detecting immunogenic response and method of screening
US20050003985A1 (en) * 2001-10-31 2005-01-06 Beatrix Kottwitz Alkaline protease variants
US7320887B2 (en) * 2001-10-31 2008-01-22 Henkel Kommanditgesellschaft Auf Aktien Alkaline protease variants
US20050170488A1 (en) * 2002-01-16 2005-08-04 Poulose Ayrookaran J. Multiply-substituted protease variants
US20110091959A1 (en) * 2002-01-16 2011-04-21 Danisco Us Inc. Multiply-Substituted Protease Variants
US20110091958A1 (en) * 2002-01-16 2011-04-21 Danisco Us Inc. Multiply-Substituted Protease Variants
US20090011489A1 (en) * 2002-01-16 2009-01-08 Poulose Ayrookaran J Multiply-substituted protease variants
US20080124783A1 (en) * 2002-01-16 2008-05-29 Poulose Ayrookaran J Multiply-substituted protease variants
US20130157341A1 (en) * 2002-01-16 2013-06-20 Danisco Us Inc. Multiply-Substituted Protease Variants
US20110086412A1 (en) * 2002-01-16 2011-04-14 Danisco Us Inc. Multiply-Substituted Protease Variants
US20080176313A1 (en) * 2002-01-16 2008-07-24 Poulose Ayrookaran J Multiply-substituted protease variants
US20060036083A1 (en) * 2002-02-19 2006-02-16 Joel Moss Modified defensins and their use
US20090155293A1 (en) * 2002-02-19 2009-06-18 The United States Of America As Represented By The Secretary Of The Dept. Of Health & Human Services Modified defensins and their use
US8609607B2 (en) 2002-02-19 2013-12-17 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Modified defensins and their use
US7511015B2 (en) * 2002-02-19 2009-03-31 The United States Of America As Represented By The Department Of Health And Human Services Modified defensins and their use
US8106006B2 (en) 2002-02-19 2012-01-31 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Modified defensins and their use
US20060228791A1 (en) * 2002-06-26 2006-10-12 Novozymes A/S Subtilases and subtilase variants having altered immunogenicity
US9732310B2 (en) 2002-11-06 2017-08-15 Novozymes A/S Subtilase variants
US7888093B2 (en) * 2002-11-06 2011-02-15 Novozymes A/S Subtilase variants
US20090181875A1 (en) * 2002-11-06 2009-07-16 Novozymes A/S Subtilase variants
US20040147008A1 (en) * 2002-11-06 2004-07-29 Novozymes A/S Subtilase variants
US7510859B2 (en) * 2002-12-20 2009-03-31 Henkel Kommanditgesellschaft Auf Aktien Subtilisin variants with improved perhydrolase activity
US20050281773A1 (en) * 2002-12-20 2005-12-22 Henkel Kommanditgesellschaft Auf Aktien Subtilisin variants with improved perhydrolase activity
US9169475B2 (en) * 2003-01-30 2015-10-27 Novozymes A/S Subtilases
US10144922B2 (en) 2003-01-30 2018-12-04 Novozymes A/S Subtilase variants and compositions comprising the same
US9493758B2 (en) 2003-01-30 2016-11-15 Novozymes A/S Subtilases
US20130344568A1 (en) * 2003-01-30 2013-12-26 Novozymes A/S Subtilases
US20090060933A1 (en) * 2004-06-14 2009-03-05 Estell David A Proteases producing an altered immunogenic response and methods of making and using the same
US20110076260A1 (en) * 2004-06-14 2011-03-31 David A Estell Proteases Producing an Altered Immunogenic Response and Methods of Making and Using the Same
US20090143311A1 (en) * 2005-04-28 2009-06-04 Luppo Edens Compositions comprising tripeptides inhibiting ace
US20090304869A1 (en) * 2005-04-28 2009-12-10 Christianus Jacobus Van Platerink Peptides Having an Ace Inhibiting Effect
US20100120091A1 (en) * 2005-07-08 2010-05-13 Novozymes A/S Subtilase variants
US9133423B2 (en) * 2005-07-08 2015-09-15 Novozymes A/S Subtilase variants
US20100132131A1 (en) * 2006-01-23 2010-06-03 Philip Frank Souter Detergent compositions
US9261511B2 (en) 2007-01-29 2016-02-16 Desentum Oy Allergen-binding IgE monoclonal antibodies and method for preparing hypoallergens
US20100086552A1 (en) * 2007-01-29 2010-04-08 Valtion Teknillinen Tutkimuskeskus Allergen-binding ige monoclonal antibodies and method for preparing hypoallergens
WO2008092992A1 (en) 2007-01-29 2008-08-07 Valtion Teknillinen Tutkimuskeskus Allergen-binding ige monoclonal antibodies and method for preparing hypoallergens
US20110251073A1 (en) * 2008-06-06 2011-10-13 Cascao-Pereira Luis G Compositions And Methods Comprising Variant Microbial Proteases
US12448616B2 (en) 2008-06-06 2025-10-21 Danisco Us Inc. Compositions and methods comprising variant microbial proteases
US12410420B2 (en) 2008-06-06 2025-09-09 Danisco Us Inc. Compositions and methods comprising variant microbial proteases
US10563189B2 (en) 2008-06-06 2020-02-18 The Procter & Gamble Company Compositions and methods comprising variant microbial proteases
US20100152088A1 (en) * 2008-11-11 2010-06-17 Estell David A Compositions and methods comprising a subtilisin variant
US20150240192A1 (en) * 2008-11-11 2015-08-27 Danisco Us Inc. Compositions and methods comprising a subtilisin variant
US9434915B2 (en) * 2008-11-11 2016-09-06 Danisco Us Inc. Compositions and methods comprising a subtilisin variant
US20140295527A1 (en) * 2008-11-11 2014-10-02 Danisco Us Inc. Compositions and methods comprising a subtilisin variant
US8530219B2 (en) 2008-11-11 2013-09-10 Danisco Us Inc. Compositions and methods comprising a subtilisin variant
US20120178148A1 (en) * 2009-09-07 2012-07-12 Reckitt Benckiser N.V. Detergent Composition
US10655089B2 (en) 2009-09-07 2020-05-19 Reckitt Benckiser Finish B.V. Detergent composition
US11015148B2 (en) 2009-09-07 2021-05-25 Reckitt Benckiser Finish B.V. Detergent composition
US9453187B2 (en) * 2009-09-07 2016-09-27 Reckitt Benckiser Finish B.V. Detergent composition
US20120252106A1 (en) * 2009-09-25 2012-10-04 Novozymes A/S Use of Protease Variants
US20140335596A1 (en) * 2011-12-20 2014-11-13 Novozymes A/S Subtilase Variants and Polynucleotides Encoding Same
EP3567547A1 (en) * 2013-10-11 2019-11-13 Mauna Kea Technologies Method for characterizing images acquired through a video medical device
US11787849B2 (en) * 2015-09-25 2023-10-17 Imcyse Sa Methods and compounds for eliminating immune responses to therapeutic agents
US11485768B2 (en) 2016-04-19 2022-11-01 Imcyse Sa Immunogenic CD1d binding peptides

Also Published As

Publication number Publication date
EP2258852A1 (en) 2010-12-08
WO2001083770A3 (en) 2002-05-02
EP2258853B1 (en) 2016-06-08
AU2001254622A1 (en) 2001-11-12
WO2001083559A2 (en) 2001-11-08
WO2001083770A2 (en) 2001-11-08
US20110045572A1 (en) 2011-02-24
EP2236611A1 (en) 2010-10-06
AU2001254620A1 (en) 2001-11-12
EP2258853A1 (en) 2010-12-08
ATE471377T1 (en) 2010-07-15
WO2001083559A3 (en) 2002-06-20
DE60142415D1 (en) 2010-07-29
EP1555322B1 (en) 2010-06-16
US7226770B2 (en) 2007-06-05
EP1280817A2 (en) 2003-02-05
US20150037872A1 (en) 2015-02-05
US20020192792A1 (en) 2002-12-19
US20140011259A1 (en) 2014-01-09
CA2406621A1 (en) 2001-11-08
EP1555322A1 (en) 2005-07-20
EP1280919A2 (en) 2003-02-05
US20030144165A1 (en) 2003-07-31
WO2001083761A1 (en) 2001-11-08
AU2001254623A1 (en) 2001-11-12
EP2258835A1 (en) 2010-12-08
ES2588756T3 (en) 2016-11-04

Similar Documents

Publication Publication Date Title
US20150037872A1 (en) Protein Variants Having Modified Immunogenicty
ES2241189T3 (en) OXIDASE CARBOHYDRATE AND ITS USE FOR COOKING.
ES2289824T3 (en) GLYCOSILATED PROTEINS WITH REDUCED ALLERGENICITY.
ES2220114T3 (en) VARIANTS OF LITTLE ALLERGEN PROTEINS.
US6428993B1 (en) Transglutaminase from oomycetes
US6730346B2 (en) Methods for using lipases in baking
JP4050329B2 (en) Polypeptide having prolyl pipetidyl aminopeptidase activity and nucleic acid encoding the same
JPH11509082A (en) Enzymes having aminopeptidase activity
ES2285771T3 (en) POLYPEPTIDES WITH AMINOPAPTIDASE ACTIVITY AND NUCLEIC ACIDS THAT CODE IT.
US6686164B1 (en) Low allergenic protein variants
US7273738B2 (en) Family GH-61 polypeptides
US7060474B1 (en) Carbohydrate oxidase and use thereof in baking
RU2060666C1 (en) Multienzyme composition for cracker, press cake and pastry preparing
AU695995C (en) Transglutaminases from oomycetes

Legal Events

Date Code Title Description
AS Assignment

Owner name: NOVOZYMES A/S, DENMARK

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:ROGGEN, ERWIN LUDO;ERNST, STEFFEN;SVENDSEN, ALLAN;AND OTHERS;REEL/FRAME:012674/0372;SIGNING DATES FROM 20010516 TO 20010518

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION