SE8000447L - Forfarande for extraktion av tritium fran tungt vatten - Google Patents

Forfarande for extraktion av tritium fran tungt vatten

Info

Publication number
SE8000447L
SE8000447L SE8000447A SE8000447A SE8000447L SE 8000447 L SE8000447 L SE 8000447L SE 8000447 A SE8000447 A SE 8000447A SE 8000447 A SE8000447 A SE 8000447A SE 8000447 L SE8000447 L SE 8000447L
Authority
SE
Sweden
Prior art keywords
tritium
extraction
procedure
heavy water
heavy
Prior art date
Application number
SE8000447A
Other languages
English (en)
Other versions
SE439476B (sv
Inventor
A H Dombra
Original Assignee
Ca Atomic Energy Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Ca Atomic Energy Ltd filed Critical Ca Atomic Energy Ltd
Publication of SE8000447L publication Critical patent/SE8000447L/sv
Publication of SE439476B publication Critical patent/SE439476B/sv

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C01—INORGANIC CHEMISTRY
    • C01B—NON-METALLIC ELEMENTS; COMPOUNDS THEREOF; METALLOIDS OR COMPOUNDS THEREOF NOT COVERED BY SUBCLASS C01C
    • C01B4/00—Hydrogen isotopes; Inorganic compounds thereof prepared by isotope exchange, e.g. NH3 + D2 → NH2D + HD

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Inorganic Chemistry (AREA)
  • Separation By Low-Temperature Treatments (AREA)
  • Catalysts (AREA)
  • Physical Or Chemical Processes And Apparatus (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
SE8000447A 1979-01-22 1980-01-21 Forfarande for extraktion av tritium och eventuellt protium SE439476B (sv)

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CA000320154A CA1160428A (en) 1979-01-22 1979-01-22 Process for the extraction of tritium from heavy water

Publications (2)

Publication Number Publication Date
SE8000447L true SE8000447L (sv) 1980-07-23
SE439476B SE439476B (sv) 1985-06-17

Family

ID=4113387

Family Applications (1)

Application Number Title Priority Date Filing Date
SE8000447A SE439476B (sv) 1979-01-22 1980-01-21 Forfarande for extraktion av tritium och eventuellt protium

Country Status (9)

Country Link
JP (1) JPS55132622A (sv)
BE (1) BE881265A (sv)
CA (1) CA1160428A (sv)
DE (1) DE3001967A1 (sv)
FR (1) FR2446798A1 (sv)
GB (1) GB2039866B (sv)
IL (1) IL58977A (sv)
IT (1) IT8067086A0 (sv)
SE (1) SE439476B (sv)

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0198940B1 (de) * 1985-04-25 1989-07-12 GebràœDer Sulzer Aktiengesellschaft Verfahren zum Abtrennen und Anreichern von Tritium aus tritiierten Fluiden, insbesondere aus dem Kühlwasser des Primärkreislaufs und den Deuterium/Tritium-Strömen einer Kernfusionsanlage
US5468462A (en) * 1993-12-06 1995-11-21 Atomic Energy Of Canada Limited Geographically distributed tritium extraction plant and process for producing detritiated heavy water using combined electrolysis and catalytic exchange processes
US10381121B2 (en) 2013-11-13 2019-08-13 Savannah River Nuclear Solutions, Llc Decontamination of tritiated water
US11058994B2 (en) 2019-01-18 2021-07-13 Savannah River National Solutions, LLC Tritium cleanup system and method

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR1526867A (fr) * 1966-08-09 1968-05-31 Commissariat Energie Atomique Perfectionnements apportés aux moyens pour retirer le protonium et le tritium de l'eau lourde
JPS5544786B2 (sv) * 1972-05-04 1980-11-14
JPS4918680A (sv) * 1972-06-05 1974-02-19
JPS5132800A (ja) * 1974-09-11 1976-03-19 Shigeki Awata Kairyotabakotsukifuirutaa
DE2905585A1 (de) * 1978-04-13 1979-10-18 Sulzer Ag Verfahren zur trennung der wasserstoffisotopen h, d, t, um aus einem gemisch einzelne isotopen selektiv zu entfernen

Also Published As

Publication number Publication date
DE3001967A1 (de) 1980-07-31
IL58977A (en) 1982-12-31
FR2446798A1 (fr) 1980-08-14
IT8067086A0 (it) 1980-01-22
CA1160428A (en) 1984-01-17
SE439476B (sv) 1985-06-17
GB2039866B (en) 1982-12-22
GB2039866A (en) 1980-08-20
BE881265A (fr) 1980-05-16
JPS55132622A (en) 1980-10-15

Similar Documents

Publication Publication Date Title
FI792824A (fi) Foerfarande foer framstaellning av oxidering inhiberande aemnen
SE8104451L (sv) Framstellning av antracen fran kreosot
NO781082L (no) Fremgangsmaate ved fremstilling av jodofore forbindelser
NO792760L (no) Fremgangsmaate ved fremstilling av nye nafthydrinderivater
NO792823L (no) Fremgangsmaate ved fremstilling av nye arginiamidderivater
NO783968L (no) Fremgangsmaate til fremstilling av o-substituerte derivater av (+)-cyanidan-3-ol
DK60079A (da) Fremgangsmaade til fjernelse af koffein fra kaffe
DK140480A (da) Fremgangsmaade til fremstilling af mercaptoacyldipeptider
NO151716C (no) Fremgangsmaate for fjernelse av sedimenter under vann
DK344080A (da) Fremgangsmaade til fremstilling af betalactamantibiotika
NO773682L (no) Fremgangsmaate ved fremstilling av furocumariner
NO150326C (no) Fremgangsmaate for utvinning av hydrokarboner fra en underjordisk formasjon
DK522180A (da) Fremgangsmaade til fremstilling af indolderivater
SE8000447L (sv) Forfarande for extraktion av tritium fran tungt vatten
DK232080A (da) Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater
NO790993L (no) Fremgangsmaate for utvinning av tungtvann
DK300781A (da) Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater
NO151627C (no) Fremgangsmaate ved utvinning av kobolt fra koboltholdige nikkelopploesninger
DK127680A (da) Fremgangsmaade til fremstilling af penicillinsulfoxider
NO812467L (no) Fremgangsmaate ved fremstilling av as-triazinderivater
DK137080A (da) Fremgangsmaade til fremstilling af jordalkalimetalalkoxyalanater
NO781111L (no) Fremgangsmaate ved fremstilling av avkoffeinert kaffe
DK153469C (da) Fremgangsmaade til fremstilling af fluorerede alkenylaminer
DK430579A (da) Fremgangsmaade til fremstilling af isoquinolinderivater
DK88279A (da) Fremgangsmaade til fremstilling af isoquinolinderivater