RU2784425C1 - Potassium salt of haee peptide for the treatment of neurodegenerative diseases - Google Patents
Potassium salt of haee peptide for the treatment of neurodegenerative diseases Download PDFInfo
- Publication number
- RU2784425C1 RU2784425C1 RU2022119487A RU2022119487A RU2784425C1 RU 2784425 C1 RU2784425 C1 RU 2784425C1 RU 2022119487 A RU2022119487 A RU 2022119487A RU 2022119487 A RU2022119487 A RU 2022119487A RU 2784425 C1 RU2784425 C1 RU 2784425C1
- Authority
- RU
- Russia
- Prior art keywords
- haee
- peptide
- potassium salt
- potassium
- pharmaceutical composition
- Prior art date
Links
- 159000000001 potassium salts Chemical class 0.000 title claims abstract description 148
- 206010053643 Neurodegenerative disease Diseases 0.000 title claims abstract description 31
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 30
- 239000000126 substance Substances 0.000 claims abstract description 24
- 238000004519 manufacturing process Methods 0.000 claims abstract description 4
- 239000000243 solution Substances 0.000 claims description 56
- 239000011780 sodium chloride Substances 0.000 claims description 47
- 239000007864 aqueous solution Substances 0.000 claims description 32
- 206010001897 Alzheimer's disease Diseases 0.000 claims description 20
- 150000003839 salts Chemical class 0.000 claims description 20
- 239000007788 liquid Substances 0.000 claims description 19
- 238000001035 drying Methods 0.000 claims description 18
- -1 monosubstituted potassium Chemical class 0.000 claims description 17
- FAPWRFPIFSIZLT-UHFFFAOYSA-M sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 claims description 17
- 238000002329 infrared spectrum Methods 0.000 claims description 12
- 230000003920 cognitive function Effects 0.000 claims description 10
- KWYUFKZDYYNOTN-UHFFFAOYSA-M potassium hydroxide Chemical compound [OH-].[K+] KWYUFKZDYYNOTN-UHFFFAOYSA-M 0.000 claims description 10
- 239000007787 solid Substances 0.000 claims description 9
- FBPFZTCFMRRESA-KAZBKCHUSA-N D-Mannitol Natural products OC[C@@H](O)[C@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KAZBKCHUSA-N 0.000 claims description 8
- FBPFZTCFMRRESA-KVTDHHQDSA-N Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 claims description 8
- 239000000594 mannitol Substances 0.000 claims description 8
- 235000010355 mannitol Nutrition 0.000 claims description 8
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 claims description 8
- 239000002244 precipitate Substances 0.000 claims description 8
- 229920003079 Povidone K 17 Polymers 0.000 claims description 7
- 238000001938 differential scanning calorimetry curve Methods 0.000 claims description 7
- 230000002757 inflammatory Effects 0.000 claims description 7
- 229960002668 sodium chloride Drugs 0.000 claims description 7
- 229960002885 Histidine Drugs 0.000 claims description 6
- OTYBMLCTZGSZBG-UHFFFAOYSA-L Potassium sulfate Chemical compound [K+].[K+].[O-]S([O-])(=O)=O OTYBMLCTZGSZBG-UHFFFAOYSA-L 0.000 claims description 6
- 239000000654 additive Substances 0.000 claims description 6
- 150000001413 amino acids Chemical group 0.000 claims description 6
- 229910052939 potassium sulfate Inorganic materials 0.000 claims description 6
- 235000011151 potassium sulphates Nutrition 0.000 claims description 6
- 238000003756 stirring Methods 0.000 claims description 6
- 238000001990 intravenous administration Methods 0.000 claims description 5
- 238000002360 preparation method Methods 0.000 claims description 5
- LENZDBCJOHFCAS-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 claims description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N D-sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 claims description 4
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 claims description 4
- 229940044476 Poloxamer 407 Drugs 0.000 claims description 4
- CZMRCDWAGMRECN-GDQSFJPYSA-N Sucrose Natural products O([C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](CO)O1)[C@@]1(CO)[C@H](O)[C@@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-GDQSFJPYSA-N 0.000 claims description 4
- 229960004793 Sucrose Drugs 0.000 claims description 4
- RQPZNWPYLFFXCP-UHFFFAOYSA-L barium dihydroxide Chemical compound [OH-].[OH-].[Ba+2] RQPZNWPYLFFXCP-UHFFFAOYSA-L 0.000 claims description 4
- 229910001863 barium hydroxide Inorganic materials 0.000 claims description 4
- ZGTMUACCHSMWAC-UHFFFAOYSA-L disodium;2-[2-[carboxylatomethyl(carboxymethyl)amino]ethyl-(carboxymethyl)amino]acetate Chemical compound [Na+].[Na+].OC(=O)CN(CC([O-])=O)CCN(CC(O)=O)CC([O-])=O ZGTMUACCHSMWAC-UHFFFAOYSA-L 0.000 claims description 4
- 229920001992 poloxamer 407 Polymers 0.000 claims description 4
- 239000001184 potassium carbonate Substances 0.000 claims description 4
- 229910000027 potassium carbonate Inorganic materials 0.000 claims description 4
- 150000003112 potassium compounds Chemical class 0.000 claims description 4
- 239000005720 sucrose Substances 0.000 claims description 4
- 229960000281 trometamol Drugs 0.000 claims description 4
- TYJJADVDDVDEDZ-UHFFFAOYSA-M Potassium bicarbonate Chemical compound [K+].OC([O-])=O TYJJADVDDVDEDZ-UHFFFAOYSA-M 0.000 claims description 3
- 239000007853 buffer solution Substances 0.000 claims description 3
- 201000010099 disease Diseases 0.000 claims description 3
- 230000001771 impaired Effects 0.000 claims description 3
- 230000000626 neurodegenerative Effects 0.000 claims description 3
- 239000011736 potassium bicarbonate Substances 0.000 claims description 3
- 235000015497 potassium bicarbonate Nutrition 0.000 claims description 3
- 229910000028 potassium bicarbonate Inorganic materials 0.000 claims description 3
- CHKVPAROMQMJNQ-UHFFFAOYSA-M Potassium bisulfate Chemical compound [K+].OS([O-])(=O)=O CHKVPAROMQMJNQ-UHFFFAOYSA-M 0.000 claims description 2
- 238000001361 intraarterial administration Methods 0.000 claims description 2
- 238000007918 intramuscular administration Methods 0.000 claims description 2
- 238000007912 intraperitoneal administration Methods 0.000 claims description 2
- 238000007913 intrathecal administration Methods 0.000 claims description 2
- 229910000343 potassium bisulfate Inorganic materials 0.000 claims description 2
- 238000007920 subcutaneous administration Methods 0.000 claims description 2
- 230000002500 effect on skin Effects 0.000 claims 1
- 229940086066 potassium hydrogencarbonate Drugs 0.000 claims 1
- 230000000694 effects Effects 0.000 abstract description 14
- 125000003275 alpha amino acid group Chemical group 0.000 abstract description 4
- 238000010175 APPswe/PSEN1dE9 Methods 0.000 description 31
- 241000699660 Mus musculus Species 0.000 description 28
- 230000003993 interaction Effects 0.000 description 27
- 238000010178 5xFAD (B6SJL) Methods 0.000 description 25
- 238000010179 5xFAD (C57BL6) Methods 0.000 description 25
- 239000000047 product Substances 0.000 description 24
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 21
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 18
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 18
- 239000000843 powder Substances 0.000 description 18
- 210000004556 Brain Anatomy 0.000 description 15
- 210000002381 Plasma Anatomy 0.000 description 15
- 230000001225 therapeutic Effects 0.000 description 13
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 13
- 241001465754 Metazoa Species 0.000 description 12
- 238000004458 analytical method Methods 0.000 description 12
- 230000015572 biosynthetic process Effects 0.000 description 11
- 238000005755 formation reaction Methods 0.000 description 11
- 230000027455 binding Effects 0.000 description 10
- 238000000034 method Methods 0.000 description 10
- 239000000523 sample Substances 0.000 description 10
- 229940049954 Penicillin Drugs 0.000 description 9
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 9
- 230000006399 behavior Effects 0.000 description 9
- 229960000626 benzylpenicillin Drugs 0.000 description 9
- 239000011701 zinc Substances 0.000 description 9
- 210000001320 Hippocampus Anatomy 0.000 description 8
- 238000005057 refrigeration Methods 0.000 description 8
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 7
- 230000003542 behavioural Effects 0.000 description 7
- 238000004128 high performance liquid chromatography Methods 0.000 description 7
- 238000002844 melting Methods 0.000 description 7
- 239000000203 mixture Substances 0.000 description 7
- 238000000425 proton nuclear magnetic resonance spectrum Methods 0.000 description 7
- 210000004369 Blood Anatomy 0.000 description 6
- 239000008280 blood Substances 0.000 description 6
- 150000001793 charged compounds Chemical class 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 6
- 238000003860 storage Methods 0.000 description 6
- 210000001218 Blood-Brain Barrier Anatomy 0.000 description 5
- ZPWVASYFFYYZEW-UHFFFAOYSA-L Dipotassium phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 5
- 229940037179 Potassium Ion Drugs 0.000 description 5
- BDAGIHXWWSANSR-UHFFFAOYSA-N formic acid Chemical compound OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 5
- 230000001744 histochemical Effects 0.000 description 5
- 229910052700 potassium Inorganic materials 0.000 description 5
- NPYPAHLBTDXSSS-UHFFFAOYSA-N potassium ion Chemical compound [K+] NPYPAHLBTDXSSS-UHFFFAOYSA-N 0.000 description 5
- 229910001414 potassium ion Inorganic materials 0.000 description 5
- HCHKCACWOHOZIP-UHFFFAOYSA-N zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 5
- 229910052725 zinc Inorganic materials 0.000 description 5
- TZCXTZWJZNENPQ-UHFFFAOYSA-L Barium sulfate Chemical compound [Ba+2].[O-]S([O-])(=O)=O TZCXTZWJZNENPQ-UHFFFAOYSA-L 0.000 description 4
- 125000004429 atoms Chemical group 0.000 description 4
- CURLTUGMZLYLDI-UHFFFAOYSA-N carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 4
- 239000001569 carbon dioxide Substances 0.000 description 4
- 229910002092 carbon dioxide Inorganic materials 0.000 description 4
- 229940079593 drugs Drugs 0.000 description 4
- 238000000132 electrospray ionisation Methods 0.000 description 4
- 238000002149 energy-dispersive X-ray emission spectroscopy Methods 0.000 description 4
- 238000004108 freeze drying Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 150000002500 ions Chemical class 0.000 description 4
- 239000003446 ligand Substances 0.000 description 4
- 230000011514 reflex Effects 0.000 description 4
- WSVLPVUVIUVCRA-RJMJUYIDSA-N (2R,3R,4S,5R,6S)-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxane-3,4,5-triol;hydrate Chemical compound O.O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O WSVLPVUVIUVCRA-RJMJUYIDSA-N 0.000 description 3
- 230000036912 Bioavailability Effects 0.000 description 3
- 210000001736 Capillaries Anatomy 0.000 description 3
- 210000001947 Dentate Gyrus Anatomy 0.000 description 3
- 229960001021 Lactose Monohydrate Drugs 0.000 description 3
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 3
- 230000035514 bioavailability Effects 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 230000002490 cerebral Effects 0.000 description 3
- 230000001149 cognitive Effects 0.000 description 3
- 239000010949 copper Substances 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 238000000113 differential scanning calorimetry Methods 0.000 description 3
- 238000000921 elemental analysis Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 238000000605 extraction Methods 0.000 description 3
- 238000001914 filtration Methods 0.000 description 3
- 238000010438 heat treatment Methods 0.000 description 3
- 235000019359 magnesium stearate Nutrition 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 229940016286 microcrystalline cellulose Drugs 0.000 description 3
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 3
- 239000008108 microcrystalline cellulose Substances 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 238000000302 molecular modelling Methods 0.000 description 3
- 239000012188 paraffin wax Substances 0.000 description 3
- 230000001575 pathological Effects 0.000 description 3
- 230000000144 pharmacologic effect Effects 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- PTFCDOFLOPIGGS-UHFFFAOYSA-N zinc dication Chemical compound [Zn+2] PTFCDOFLOPIGGS-UHFFFAOYSA-N 0.000 description 3
- 102100001249 ALB Human genes 0.000 description 2
- 101710027066 ALB Proteins 0.000 description 2
- IQFVPQOLBLOTPF-HKXUKFGYSA-L Congo red Chemical compound [Na+].[Na+].C1=CC=CC2=C(N)C(/N=N/C3=CC=C(C=C3)C3=CC=C(C=C3)/N=N/C3=C(C4=CC=CC=C4C(=C3)S([O-])(=O)=O)N)=CC(S([O-])(=O)=O)=C21 IQFVPQOLBLOTPF-HKXUKFGYSA-L 0.000 description 2
- 206010012289 Dementia Diseases 0.000 description 2
- 238000004252 FT/ICR mass spectrometry Methods 0.000 description 2
- 229960002989 Glutamic Acid Drugs 0.000 description 2
- 101710007376 H1-1 Proteins 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N HCl Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- 101710017533 His1:CG33831 Proteins 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 102100008812 PSEN1 Human genes 0.000 description 2
- 206010061536 Parkinson's disease Diseases 0.000 description 2
- 238000002441 X-ray diffraction Methods 0.000 description 2
- WEVYAHXRMPXWCK-UHFFFAOYSA-N acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 2
- 230000002378 acidificating Effects 0.000 description 2
- 229940050528 albumin Drugs 0.000 description 2
- 239000012062 aqueous buffer Substances 0.000 description 2
- 238000005452 bending Methods 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 230000003930 cognitive ability Effects 0.000 description 2
- 238000006073 displacement reaction Methods 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 235000019253 formic acid Nutrition 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- 238000004896 high resolution mass spectrometry Methods 0.000 description 2
- 238000000589 high-performance liquid chromatography-mass spectrometry Methods 0.000 description 2
- 125000002883 imidazolyl group Chemical group 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 238000011068 load Methods 0.000 description 2
- 239000004579 marble Substances 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- OKKJLVBELUTLKV-UHFFFAOYSA-N methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 230000001264 neutralization Effects 0.000 description 2
- 230000003287 optical Effects 0.000 description 2
- 230000008506 pathogenesis Effects 0.000 description 2
- 230000036231 pharmacokinetics Effects 0.000 description 2
- 239000002831 pharmacologic agent Substances 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 2
- 239000011591 potassium Substances 0.000 description 2
- 229940094025 potassium bicarbonate Drugs 0.000 description 2
- 238000004321 preservation Methods 0.000 description 2
- 230000035489 relative bioavailability Effects 0.000 description 2
- 238000001228 spectrum Methods 0.000 description 2
- 239000007921 spray Substances 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-L sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 2
- 238000005160 1H NMR spectroscopy Methods 0.000 description 1
- 108060000460 APP Proteins 0.000 description 1
- 102100017796 APP Human genes 0.000 description 1
- 206010002022 Amyloidosis Diseases 0.000 description 1
- 206010002023 Amyloidosis Diseases 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 206010057668 Cognitive disease Diseases 0.000 description 1
- 229910002476 CuII Inorganic materials 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 230000036947 Dissociation constant Effects 0.000 description 1
- 238000001157 Fourier transform infrared spectrum Methods 0.000 description 1
- 229940049906 Glutamate Drugs 0.000 description 1
- 230000036499 Half live Effects 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006822 Human Serum Albumin Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 241000896769 Multiple sclerosis associated retrovirus Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 210000004897 N-terminal region Anatomy 0.000 description 1
- 210000004940 Nucleus Anatomy 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 102000012412 Presenilin-1 Human genes 0.000 description 1
- 108010036933 Presenilin-1 Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 208000007400 Relapsing-Remitting Multiple Sclerosis Diseases 0.000 description 1
- 210000002966 Serum Anatomy 0.000 description 1
- 210000004001 Thalamic Nuclei Anatomy 0.000 description 1
- 102000015296 acetylcholine-gated cation-selective channel activity proteins Human genes 0.000 description 1
- 108040006409 acetylcholine-gated cation-selective channel activity proteins Proteins 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 238000007792 addition Methods 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 235000001014 amino acid Nutrition 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 239000012491 analyte Substances 0.000 description 1
- 239000010405 anode material Substances 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N aspartic acid group Chemical group N[C@@H](CC(=O)O)C(=O)O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- 238000011087 biopharmaceutical technology Methods 0.000 description 1
- 230000000903 blocking Effects 0.000 description 1
- 238000010241 blood sampling Methods 0.000 description 1
- 238000009933 burial Methods 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- UXTMROKLAAOEQO-UHFFFAOYSA-N chloroform;ethanol Chemical compound CCO.ClC(Cl)Cl UXTMROKLAAOEQO-UHFFFAOYSA-N 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 238000010835 comparative analysis Methods 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 238000010192 crystallographic characterization Methods 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 238000010908 decantation Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002708 enhancing Effects 0.000 description 1
- 230000036545 exercise Effects 0.000 description 1
- WSFSSNUMVMOOMR-UHFFFAOYSA-N formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 1
- 239000012520 frozen sample Substances 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 230000000971 hippocampal Effects 0.000 description 1
- 125000003372 histidine group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 230000036571 hydration Effects 0.000 description 1
- 238000006703 hydration reaction Methods 0.000 description 1
- 230000002209 hydrophobic Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxyl anion Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000005040 ion trap Methods 0.000 description 1
- 230000003902 lesions Effects 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000001404 mediated Effects 0.000 description 1
- 201000009457 movement disease Diseases 0.000 description 1
- 230000004770 neurodegeneration Effects 0.000 description 1
- 230000003959 neuroinflammation Effects 0.000 description 1
- 230000002314 neuroinflammatory Effects 0.000 description 1
- 210000002569 neurons Anatomy 0.000 description 1
- CTQNGGLPUBDAKN-UHFFFAOYSA-N o-xylene Chemical compound CC1=CC=CC=C1C CTQNGGLPUBDAKN-UHFFFAOYSA-N 0.000 description 1
- 230000003204 osmotic Effects 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 230000002093 peripheral Effects 0.000 description 1
- 230000000275 pharmacokinetic Effects 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000001681 protective Effects 0.000 description 1
- 235000018102 proteins Nutrition 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 108090000623 proteins and genes Proteins 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000003252 repetitive Effects 0.000 description 1
- 230000000717 retained Effects 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 125000003616 serine group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000002594 sorbent Substances 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 238000002411 thermogravimetry Methods 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 210000001519 tissues Anatomy 0.000 description 1
- 230000001052 transient Effects 0.000 description 1
- 201000004810 vascular dementia Diseases 0.000 description 1
- 235000020799 vitamin D status Nutrition 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 239000008096 xylene Substances 0.000 description 1
Images
Abstract
Description
Изобретение относится к однозамещенной или двузамещенной калиевой соли пептида HAEE, где HAEE представляет собой синтетический пептид, ацетилированный по N-концу и амидированный по C-концу, с аминокислотной последовательностью His-Ala-Glu-Glu. Настоящее изобретение также относится к способу его получения калиевых солей пептида HAEE (варианты), к фармацевтическим композициям на основе калиевых солей пептида HAEE и применению калиевых солей пептида HAEE для лечения нейродегенеративных заболеваний.The invention relates to a monosubstituted or disubstituted potassium salt of the HAEE peptide, where HAEE is a synthetic peptide, acetylated at the N-terminus and amidated at the C-terminus, with the amino acid sequence His-Ala-Glu-Glu. The present invention also relates to a method for its production of potassium salts of the HAEE peptide (variants), to pharmaceutical compositions based on potassium salts of the HAEE peptide and the use of potassium salts of the HAEE peptide for the treatment of neurodegenerative diseases.
ПРЕДШЕСТВУЮЩИЙ УРОВЕНЬ ТЕХНИКИPRIOR ART
Нейродегенеративные заболевания имеют ряд общих факторов развития и целый ряд других обобщающих механизмов (Litvinenko I.V., Krasakov I.V., Bisaga G.N. et al. Modern conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy. Zhurnal Nevrologii i Psikhiatrii imeni S.S. Korsakova. 2017;117(6-2):3-10. (In Russ.). doi: 10.17116/jnevro2017117623-10), что может связывать болезнь Альцгеймера (БА), сосудистую деменцию, нейродегенерацию при рассеянном склерозе (РС), болезнь Паркинсона, а также болезнь Альцгеймера в условиях активации системного воспаления (Williams-Gray C.H., Wijeyekoon R., Yarnall A.J. et al. ICICLE-PD study group. Serum immune markers and disease progression in an incident Parkinson’s disease cohort (ICICLE-PD). Movement Disorders. 2016;31(7):995-1003. https://doi.org/10.1002/mds.26563). Воспаление относится к типовым патологическим процессам организма человека. Типовой патологический процесс проявляется определенным набором характерных признаков. В настоящее время считается, что нейродегенеративный процесс является вторичным по отношению к воспалительному (Mostafa A., Jalilvand S., Shoja Z. Et al. Multiple sclerosis-associated retrovirus, Epstein-barr virus, and vitamin D status in patients with relapsing remitting multiple sclerosis. Journal of Medical Virology. 2017. doi: 10.1002/jmv.24774; Litvinenko I.V., Krasakov I.V., Bisaga G.N. et al. Modern conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy. Zhurnal Nevrologii i Psikhiatrii imeni S.S. Korsakova. 2017;117(6-2):3-10. (In Russ.). doi: 10.17116/jnevro2017117623-10).Neurodegenerative diseases have a number of common development factors and a number of other generalizing mechanisms (Litvinenko I.V., Krasakov I.V., Bisaga G.N. et al. Modern conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy. Zhurnal Nevrologii i Psikhiatrii imeni S.S. Korsakova. 2017;117(6 -2):3-10. (In Russ.) doi: 10.17116/jnevro2017117623-10), which may link Alzheimer's disease (AD), vascular dementia, neurodegeneration in multiple sclerosis (MS), Parkinson's disease, and Alzheimer's disease in conditions of activation of systemic inflammation (Williams-Gray C.H., Wijeyekoon R., Yarnall A.J. et al. ICICLE-PD study group. Serum immune markers and disease progression in an incident Parkinson's disease cohort (ICICLE-PD). Movement Disorders. 2016;31 (7):995-1003 https://doi.org/10.1002/mds.26563). Inflammation is one of the typical pathological processes of the human body. A typical pathological process is manifested by a certain set of characteristic features. It is currently believed that the neurodegenerative process is secondary to the inflammatory one (Mostafa A., Jalilvand S., Shoja Z. Et al. Multiple sclerosis-associated retrovirus, Epstein-barr virus, and vitamin D status in patients with relapsing remitting multiple sclerosis Journal of Medical Virology 2017 doi: 10.1002/jmv.24774 Litvinenko I.V., Krasakov I.V., Bisaga G.N. et al Modern conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy Zhurnal Nevrologii i Psikhiatrii imeni S.S. Korsakova 2017; 117(6-2):3-10 (In Russ.) doi: 10.17116/jnevro2017117623-10).
Болезнь Альцгеймера является одним из наиболее распространенных нейродегенеративных заболеваний среди людей пожилого возраста и характеризуется нейритными бляшками, основным компонентом которых является пептид бета-амилоид (Аβ). N-концевая область 1-16 бета-амилоида является металл-связывающим доменом, где цинк (Zn) и медь (Cu) присоединяются к пептиду Аβ (Guilloreau L., Damian L., Coppel Y., et al. (2006). Structural and thermodynamical properties of CuII amyloid-β16/28 complexes associated with Alzheimer’s disease. JBIC Journal of Biological Inorganic Chemistry, 11(8), 1024-1038, doi: 10.1007/s00775-006-0154-1). Снижение уровня ионов цинка в крови за счет связывания ионов цинка специфическими хелатирующими агентами и/или блокирование взаимодействий пептида Аβ с ионами цинка может предотвратить патологии, связанные с этими взаимодействиями (Ayton S., Lei P., Bush A. Biometals and Their Therapeutic Implications in Alzheimer’s Disease. Neurotherapeutics. 2015. 12(1): p. 109-120). Высокие концентрации цинка вызывают преципитацию пептида Аβ и влияют на образование в специфических отделах мозга (гиппокамп, кортекс, таламические ядра) внеклеточных агрегатов Аβ (амилоидных бляшек), которые ассоциированы с развитием болезни Альцгеймера ((Frederickson C.J., Bush A.I. (2001). Synaptically released zinc: physiological functions and pathological effects. Biometals, 14(3), 353-366, doi: 10.1023/A:1012934207456). Поэтому применение цинка и других катионов в фармацевтических препаратах, которые могут взаимодействовать с таргетными мишенями в организме и лечить нейродегенеративные заболевания, в частности болезнь Альцгеймера, является нетривиальной решением.Alzheimer's disease is one of the most common neurodegenerative diseases among the elderly and is characterized by neuritic plaques, the main component of which is the peptide beta-amyloid (Aβ). The amyloid beta 1-16 N-terminal region is a metal-binding domain where zinc (Zn) and copper (Cu) are attached to the Aβ peptide (Guilloreau L., Damian L., Coppel Y., et al. (2006). Structural and thermodynamical properties of CuII amyloid-β16/28 complexes associated with Alzheimer's disease JBIC Journal of Biological Inorganic Chemistry, 11(8), 1024-1038, doi: 10.1007/s00775-006-0154-1). Reducing the level of zinc ions in the blood due to the binding of zinc ions to specific chelating agents and / or blocking the interactions of the Aβ peptide with zinc ions can prevent the pathologies associated with these interactions (Ayton S., Lei P., Bush A. Biometals and Their Therapeutic Implications in Alzheimer's Disease Neurotherapeutics 2015 12(1): pp. 109-120). High concentrations of zinc cause precipitation of the Aβ peptide and affect the formation in specific parts of the brain (hippocampus, cortex, thalamic nuclei) of extracellular aggregates of Aβ (amyloid plaques), which are associated with the development of Alzheimer's disease ((Frederickson C.J., Bush A.I. (2001). Synaptically released zinc: physiological functions and pathological effects Biometals, 14(3), 353-366, doi: 10.1023/A:1012934207456 Therefore, the use of zinc and other cations in pharmaceuticals that can interact with targeted targets in the body and treat neurodegenerative diseases , in particular Alzheimer's disease, is a non-trivial solution.
На сегодняшний день нет действующих эффективных препаратов, которые бы излечивали нейродегенеративные заболевания. Из научной и патентной литературы известны ряд пептидов, которые могли бы применяться при лечении таких заболеваний.To date, there are no active effective drugs that would cure neurodegenerative diseases. A number of peptides are known from the scientific and patent literature that could be used in the treatment of such diseases.
Из WO 2012/056157 и патента РФ № 2679080 известно соединение, представляющее собой Ac-HAEE-NH2 (далее - HAEE). В аббревиатуре НАЕЕ буквы означают: Н -гистидин, А - аланин, Е - глутаминовая кислота. НАЕЕ способно ингибировать взаимодействие пептидов Аβ с ионами Zn (II), вызывая уменьшение или предотвращение агрегации пептида Аβ в присутствии ионов Zn (II) при физиологических концентрациях ионов Zn (II) 100-400 мкМ. Более высокие концентрации ионов Zn (II), порядка 1 ммоль (мМ), подавляют взаимодействия между НАЕЕ и 1-16 областью Aβ. Было показано, что инкубация агрегатов Аβ с HAEE в течение минимум 1 часа при 20, 40, 80, 100 и 150 мкМ HAEE приводит к дезагрегации таких агрегатов.From WO 2012/056157 and RF patent No. 2679080, a compound is known that is Ac-HAEE-NH 2 (hereinafter referred to as HAEE). In the abbreviation HAEE, the letters mean: H - histidine, A - alanine, E - glutamic acid. HAEE is able to inhibit the interaction of Aβ peptides with Zn (II) ions, causing a decrease or prevention of Aβ peptide aggregation in the presence of Zn (II) ions at physiological concentrations of Zn (II) ions of 100-400 μM. Higher concentrations of Zn(II) ions, on the order of 1 mmol (mM), suppress interactions between the HAEE and the 1-16 region of Aβ. Incubation of Aβ aggregates with HAEE for at least 1 hour at 20, 40, 80, 100 and 150 μM HAEE has been shown to disaggregate such aggregates.
Из патента РФ № 2679059 известно, что несмотря на ингибирование образования амилоидных бляшек, влияние известных препаратов, в частности НАЕЕ, на улучшение когнитивных функций при болезни Альцгеймера в среднем является очень ограниченным и существует необходимость получения альтернативных эффективных средств для лечения болезни Альцгеймера, в том числе за счет снижения или предотвращения связывания ионов Zn(II) с пептидом Аβ. В качестве альтернативного средства для лечения болезни Альцгеймера было предложено использовать пептид с аминокислотной последовательностью (в стандартных однобуквенных кодах) H[isoD][pS]GYEVHH (где isoD обозначает изомеризованный остаток аспарагиновой кислоты, а pS относится к фосфорилированному остатку серина) с открытыми или защищенными концами основной полипептидной цепи.From RF patent No. 2679059 it is known that despite the inhibition of the formation of amyloid plaques, the effect of known drugs, in particular HAEE, on improving cognitive functions in Alzheimer's disease is on average very limited and there is a need to obtain alternative effective drugs for the treatment of Alzheimer's disease, including by reducing or preventing the binding of Zn(II) ions to the Aβ peptide. As an alternative treatment for Alzheimer's disease, it has been proposed to use a peptide with the amino acid sequence (in standard single-letter codes) H[isoD][pS]GYEVHH (where isoD denotes an isomerized aspartic acid residue and pS refers to a phosphorylated serine residue) with open or protected ends of the main polypeptide chain.
Из патента РФ № 2709539 известно, что короткие заряженные пептиды типа HAEE имеют очень короткое время жизни в плазме крови (от нескольких секунд до нескольких минут) и с трудом проходят через гематоэнцефалический барьер (ГЭБ), что существенно ослабляет эффективность их терапевтического воздействия. С целью преодоления этих недостатков авторы патента РФ № 2709539 разработали фармацевтическую композицию для доставки HAEE через ГЭБ для лечения нейродегенеративных заболеваний, включая деменцию Альцгеймеровского типа (болезнь Альцгеймера), которая позволяет улучшить фармакокинетические характеристики и увеличить биодоступность HAEE.It is known from RF patent No. 2709539 that short charged peptides of the HAEE type have a very short lifetime in blood plasma (from several seconds to several minutes) and hardly pass through the blood-brain barrier (BBB), which significantly reduces the effectiveness of their therapeutic effect. In order to overcome these shortcomings, the authors of RF patent No. 2709539 have developed a pharmaceutical composition for the delivery of HAEE through the BBB for the treatment of neurodegenerative diseases, including dementia of the Alzheimer's type (Alzheimer's disease), which improves the pharmacokinetic characteristics and increases the bioavailability of HAEE.
Данная композиция содержит эффективное количество субстанции в виде комплекса HAЕЕ с цинком и человеческим сывороточным альбумином (HAEE-Zn-HSA) в форме раствора для введения с фармацевтически приемлемым носителем, выбранным из круга нейтральных носителей и разбавителей, например, в физиологическом растворе. Полученная фармацевтическая композиция позволяет увеличить в пять раз биодоступность субстанции в мозге, увеличить время полувыведения из организма в два раза; улучшить когнитивные функции экспериментальных животных на 20%. Из патента РФ № 2709539 известно, что фармацевтическая композиция HAEE-Zn-HSA является стабильной в подходящей водной буферной системе, в диапазоне значений pH от 4 до 8, в присутствии или в отсутствии различных солей.This composition contains an effective amount of the substance in the form of a complex of HAEE with zinc and human serum albumin (HAEE-Zn-HSA) in the form of a solution for administration with a pharmaceutically acceptable carrier selected from the range of neutral carriers and diluents, for example, in saline. The resulting pharmaceutical composition makes it possible to increase the bioavailability of the substance in the brain by five times, to increase the half-life from the body by two times; improve the cognitive functions of experimental animals by 20%. From RF patent No. 2709539 it is known that the pharmaceutical composition HAEE-Zn-HSA is stable in a suitable aqueous buffer system, in the pH range from 4 to 8, in the presence or absence of various salts.
Однако известно, что заряд альбумина в нейтральной среде равен -1, в щелочной среде равен -2, а в слабокислой среде равен 0 (изоэлектрическое состояние) и альбумин выпадает в осадок (Биохимия с упражнениями и задачами. Под ред. А.И. Глухова, Е.С. Северина. ГЭОТАР-Медиа, Москва. 2019. С.19), поэтому данный комплекс не должен существовать в слабокислой среде при pH 4-5,5.However, it is known that the charge of albumin in a neutral medium is -1, in an alkaline medium it is -2, and in a slightly acidic medium it is 0 (isoelectric state) and albumin precipitates (Biochemistry with exercises and tasks. Edited by A.I. Glukhov , E.S. Severina, GEOTAR-Media, Moscow, 2019, p.19), so this complex should not exist in a slightly acidic environment at pH 4-5.5.
Прототипом изобретения был выбран источник WO 2012/056157, в котором описывается пептид с аминокислотной последовательностью His-Ala-Glu-Glu, ацетилированный по N-концу и амидированный по C-концу (НАЕЕ). Фармацевтически приемлемые соли для НАЕЕ не были ранее получены и охарактеризованы, а их свойства в твердой фазе неизвестны.The prototype of the invention was the source WO 2012/056157, which describes a peptide with the amino acid sequence His-Ala-Glu-Glu, acetylated at the N-terminus and amidated at the C-terminus (HAEE). Pharmaceutically acceptable salts for HAEE have not been previously prepared and characterized, and their properties in the solid phase are unknown.
Получение фармацевтически приемлемых солей лекарственных веществ способствует улучшению их растворимости, биодоступности, повышению стабильности и других полезных биофармацевтических характеристик.The preparation of pharmaceutically acceptable salts of medicinal substances improves their solubility, bioavailability, stability and other useful biopharmaceutical characteristics.
Таким образом, задачи, на решение которых направлено изобретение, заключаются в получении эффективного средства для лечения нейродегенеративных заболеваний в виде неизвестных ранее калиевых солей НАЕЕ, включая однозамещенную (НАЕЕ-K) и двузамещенную (НАЕЕ-K2) калиевые соли НАЕЕ, в том числе в твердой форме, разработке фармацевтических композиций на основе такого средства и его применении для лечения нейродегенеративных заболеваний.Thus, the tasks to be solved by the invention are to obtain an effective agent for the treatment of neurodegenerative diseases in the form of previously unknown potassium salts of HAEE, including monosubstituted (HAEE-K) and disubstituted (HAEE-K 2 ) potassium salts of HAEE, including in solid form, the development of pharmaceutical compositions based on such an agent and its use in the treatment of neurodegenerative diseases.
В соответствии с настоящим изобретением описываются калиевые соли пептида HAEE.The present invention describes the potassium salts of the HAEE peptide.
В настоящем изобретении было обнаружено, что для усиления терапевтического действия пептида НАЕЕ для лечения нейроденегеративных заболеваний полезно использовать калиевые соли НАЕЕ. Использование калиевых солей пептида НАЕЕ для лечения нейродегенеративных заболеваний изменяет механизм действия пептида НАЕЕ, связанный с конформационной структурой пептида HAEE, что приводит к неожиданно высокому терапевтическому эффекту.In the present invention, it has been found useful to use HAEE potassium salts to enhance the therapeutic effect of the HAEE peptide for the treatment of neurodegenerative diseases. The use of potassium salts of the HAEE peptide for the treatment of neurodegenerative diseases changes the mechanism of action of the HAEE peptide associated with the conformational structure of the HAEE peptide, which leads to an unexpectedly high therapeutic effect.
Это подтверждается экспериментальным введением нативного пептида НАЕЕ и калиевых солей пептида HAEE в организм экспериментальных животных. Было обнаружено, что 3D-структура нативного пептида НАЕЕ, который в виде водного раствора был введен в плазму крови мышей дикого типа, отличается от 3D-структуры нативного HAEE в исходном водном растворе, что подтверждается методом ВЭЖХ по изменению времени выходa с хроматографической колонки пробы HAEE, экстрагированной из плазмы крови, относительно времени выхода пробы HAEE, экстрагированной из исходного водного раствора. В то же время 3D-структура HAEE в форме калиевых солей оставалась неизменной в аналогичных экспериментальных условиях (то есть после экстрагирования из исходного водного раствора калиевой соли пептида HAEE и после экстрагирования из плазмы крови мышей дикого типа после 2-х минутной экспозиции) и соответствовала 3D-структуре нативного пептида HAEE, экстрагированного из исходного водного раствора. По данным масс-спектрометрии химическая структура пептида HAEE во всех экспериментальных пробах сохранялась неизменной как для нативного пептида, так и для пептида в составе калиевой соли. Изменение времени выхода нативного пептида HAEE или калиевой соли пептида HAEE с хроматографической колонки связано в основном с различиями в гидрофобных взаимодействиях пептида HAEE с материалом колонки, а эти взаимодействия в свою очередь определяются превалирующей 3D-структурой пептида HAEE в конкретной пробе. Таким образом, из полученных экспериментальных данных следует, что 3D-структура пептида HAEE, которая соответствует «развернутой» конформации пептида и является превалирующей для нативного пептида HAEE в исходном водном растворе, соответствует 3D-структуре калиевой соли пептида HAEE в водном растворе и остается неизменной в случае экспозиции калиевой соли пептида HAEE в плазме крови, в то время как нативный пептид HAEE в плазме крови утрачивает «развернутую» конформацию.This is confirmed by the experimental introduction of the native HAEE peptide and potassium salts of the HAEE peptide into the body of experimental animals. It was found that the 3D structure of the native HAEE peptide, which was introduced into the blood plasma of wild-type mice as an aqueous solution, differs from the 3D structure of the native HAEE in the initial aqueous solution, which was confirmed by HPLC by changing the time of release from the chromatographic column of the HAEE sample extracted from blood plasma relative to the release time of the HAEE sample extracted from the initial aqueous solution. At the same time, the 3D structure of HAEE in the form of potassium salts remained unchanged under similar experimental conditions (i.e., after extraction from the initial aqueous solution of the potassium salt of the HAEE peptide and after extraction from the blood plasma of wild-type mice after a 2-minute exposure) and corresponded to 3D -structure of the native HAEE peptide extracted from the initial aqueous solution. According to mass spectrometry, the chemical structure of the HAEE peptide in all experimental samples remained unchanged for both the native peptide and the peptide in the potassium salt composition. The change in the release time of the native HAEE peptide or the potassium salt of the HAEE peptide from the chromatographic column is mainly due to differences in the hydrophobic interactions of the HAEE peptide with the column material, and these interactions, in turn, are determined by the prevailing 3D structure of the HAEE peptide in a particular sample. Thus, it follows from the obtained experimental data that the 3D structure of the HAEE peptide, which corresponds to the "unfolded" conformation of the peptide and is predominant for the native HAEE peptide in the initial aqueous solution, corresponds to the 3D structure of the potassium salt of the HAEE peptide in the aqueous solution and remains unchanged in in the case of exposure of the potassium salt of the HAEE peptide in blood plasma, while the native HAEE peptide in blood plasma loses its “unfolded” conformation.
В данном случае термин 3D-структура используется как синоним пространственной структуры или взаимного расположения атомов в молекуле HAEE в трехмерном пространстве. Метод ВЭЖХ основан на преимущественно межмолекулярных взаимодействиях на границе раздела фаз. Изменение времени выхода НАЕЕ с хроматографической колонки отражает изменение межмолекулярных взаимодействий HAEE с сорбентом, что является следствием различий пространственной структуры молекул НАЕЕ в нативном состоянии и в виде калиевой соли.In this case, the term 3D structure is used as a synonym for the spatial structure or arrangement of atoms in the HAEE molecule in three dimensions. The HPLC method is based primarily on intermolecular interactions at the interface. The change in the HAEE exit time from the chromatographic column reflects the change in the intermolecular interactions of HAEE with the sorbent, which is a consequence of differences in the spatial structure of the HAEE molecules in the native state and in the form of a potassium salt.
Известно, что нарушение 3D-структуры олигопептидов может приводить к снижению их функций и уменьшению терапевтического действия (Sikora, K., Jaśkiewicz, M., Neubauer, D., Migoń, D., & Kamysz, W. (2020). The role of counter-ions in peptides-an overview. Pharmaceuticals, 13(12), 442.). Ранее было показано, что для оптимального взаимодействия с партнерами белковой природы пептид HAEE должен находиться в «развернутой» конформации (Barykin E. P., Garifulina A. I., Tolstova A. P., Anashkina A. A., Adzhubei A. A., Mezentsev Y. V., Shelukhina I. V., Kozin S. A., Tsetlin V. I., Makarov A. A. Tetrapeptide Ac-HAEE-NH(2) Protects α4β2 nAChR from Inhibition by Aβ // International journal of molecular sciences. - 2020. - T. 21, № 17. - C. 6272; Zolotarev YA, Mitkevich VA, Shram SI, Adzhubei AA, Tolstova AP, Talibov OB, Dadayan AK, Myasoyedov NF, Makarov AA, Kozin SA. Pharmacokinetics and Molecular Modeling Indicate nAChRα4-Derived Peptide HAEE Goes through the Blood-Brain Barrier. Biomolecules. 2021 Jun 18;11(6):909). В нативном пептиде HAEE имидазольная группа аминокислотного остатка гистидина может образовывать стабильные полярные связи с карбоксильными группами боковых цепей аминокислотных остатков глутаминовой кислоты, что не способствует поддержанию биологически значимой «развернутой» конформации данного пептида и, как следствие, снижает полезные терапевтические эффекты HAEE.It is known that a violation of the 3D structure of oligopeptides can lead to a decrease in their functions and a decrease in the therapeutic effect (Sikora, K., Jaśkiewicz, M., Neubauer, D., Migoń, D., & Kamysz, W. (2020). The role of counter-ions in peptides-an overview Pharmaceuticals, 13(12), 442). Previously, it was shown that for optimal interaction with protein partners, the HAEE peptide should be in an “unfolded” conformation (Barykin E. P., Garifulina A. I., Tolstova A. P., Anashkina A. A., Adzhubei A. A., Mezentsev Y. V., Shelukhina I. V., Kozin S. A., Tsetlin V. I., Makarov Zolotarev YA, Mitkevich VA, Shram SI, Adzhubei AA, Tolstova AP, Talibov OB, Dadayan AK, Myasoyedov NF, Makarov AA, Kozin SA Pharmacokinetics and Molecular Modeling Indicate nAChRα4-Derived Peptide HAEE Goes through the Blood-Brain Barrier Biomolecules 2021 Jun 18;11(6): 909). In the native HAEE peptide, the imidazole group of the histidine amino acid residue can form stable polar bonds with the carboxyl groups of the side chains of glutamic acid amino acid residues, which does not contribute to maintaining the biologically significant “unfolded” conformation of this peptide and, as a result, reduces the beneficial therapeutic effects of HAEE.
Таким образом, одним из преимуществ данного изобретения является повышение терапевтической эффективности пептида НАЕЕ в форме калиевой соли НАЕЕ вследствие сохранения 3D-структуры данной соли в «развернутой» конформации.Thus, one of the advantages of this invention is to increase the therapeutic efficacy of the HAEE peptide in the form of the potassium salt of HAEE by maintaining the 3D structure of this salt in an "unfolded" conformation.
Изобретение также имеет отношение к применению калиевой соли пептида HAEE для лечения нейродегенеративных заболеваний, а также патологий, сопровождающихся нейровоспалительными процессами. Калиевая соль пептида HAEE может эффективно влиять на нейродегенеративные заболевания, в частности, вызванные воспалительными причинами, восстанавливая нарушенные когнитивные функции.The invention also relates to the use of the potassium salt of the HAEE peptide for the treatment of neurodegenerative diseases, as well as pathologies accompanied by neuroinflammatory processes. The potassium salt of the HAEE peptide can effectively affect neurodegenerative diseases, in particular those caused by inflammatory causes, restoring impaired cognitive functions.
Калиевая соль пептида HAEE может быть использован как в твердой, так и в жидкой форме, сохраняя свою стабильность в течение по меньшей мере 2 лет.The potassium salt of the HAEE peptide can be used in both solid and liquid form, maintaining its stability for at least 2 years.
Техническим результатом изобретения является:The technical result of the invention is:
- возможность использования калиевой соли пептида HAEE при лечении нейродегенеративных заболеваний, в частности вызванных опосредованно воспалительными причинами, которое приводит к эффективному восстановлению когнитивных функций;- the possibility of using the potassium salt of the HAEE peptide in the treatment of neurodegenerative diseases, in particular those caused indirectly by inflammatory causes, which leads to an effective restoration of cognitive functions;
- повышенная стабильность калиевой соли пептида HAEE по сравнению с НАЕЕ;- increased stability of the potassium salt of the HAEE peptide compared to HAEE;
- устойчивость «развернутой» конформации 3D молекулы НАЕЕ после растворения калиевой соли HAEE в плазме крови по сравнению с НАЕЕ.- stability of the "unfolded" conformation of the 3D HAEE molecule after dissolution of the potassium salt of HAEE in blood plasma compared to HAEE.
Заявляемые в настоящем изобретении калиевые соли пептида НАЕЕ в соответствии с используемым способом получения могут быть получены в аморфной форме, что подтверждается рентгенофазовым анализом (Фиг. 1,2).Claimed in the present invention, the potassium salts of the HAEE peptide in accordance with the method used for obtaining can be obtained in amorphous form, which is confirmed by x-ray phase analysis (Fig. 1,2).
Калиевые соли пептида НАЕЕ характеризуется кривой дифференциальной сканирующей калориметрии (ДСК) с термогравиометрией (ТГ) (ДСК-ТГА). Молекула НАЕЕ на ДСК-кривой характеризуется широким пиком с началом при 62°С и максимумом при 89°С; двойным пиком плавления при температуре 203 и 227,5°С с началом при 188°С (Фиг. 3). Погрешность при многократном измерении оценивается в ± 3°С.The potassium salts of the HAEE peptide are characterized by a differential scanning calorimetry (DSC) with thermograviometry (TG) (DSC-TGA) curve. The HAEE molecule on the DSC curve is characterized by a broad peak with an onset at 62°C and a maximum at 89°C; a double melting peak at 203 and 227.5°C starting at 188°C (Fig. 3). The error in multiple measurements is estimated at ± 3°C.
HAEE-K на ДСК-кривой характеризуется тремя эндотермическими максимумами: первый широкий эндотермический пик начинается от 60°С и имеет максимум при 102°С; второй начинается при 162°С с максимумом при 188°С, третий пик начинается при 198°С с максимумом при 228°С. (Фиг. 4).HAEE-K on the DSC curve is characterized by three endothermic maxima: the first broad endothermic peak starts at 60°C and has a maximum at 102°C; the second begins at 162°C with a maximum at 188°C, the third peak begins at 198°C with a maximum at 228°C. (Fig. 4).
HAEE-K2 на ДСК-кривой характеризуется четырьмя эндотермическими пиками. Первый широкий пик имеет начало при 60°С с максимумом в области 105°С, второй слабовыраженный пик начинается от 155°С с максимумом при 163°С, третий пик начинается от 215°С с максимумом при 236°С и четвертый максимум плавления наблюдается при 242°С (Фиг 5).HAEE-K 2 on the DSC curve is characterized by four endothermic peaks. The first broad peak starts at 60°C with a maximum at 105°C, the second weak peak starts at 155°C with a maximum at 163°C, the third peak starts at 215°C with a maximum at 236°C, and the fourth melting maximum is observed. at 242°C (Fig. 5).
ДСК-кривые показывают, что термическое поведение калиевых солей пептида НАЕЕ (Фиг. 4,5) отличается от поведения НАЕЕ (Фиг. 3), температура плавления двузамещенной калиевой соли и начало плавления однозамещенной калиевой соли выше по сравнению с температурой плавления НАЕЕ, что обеспечивает более высокую стабильность, что подтверждается результатами теста ускоренного хранения.DSC curves show that the thermal behavior of the potassium salts of the HAEE peptide (Fig. 4,5) differs from the behavior of HAEE (Fig. 3), the melting point of the dipotassium salt and the onset of melting of the monosubstituted potassium salt are higher compared to the melting point of HAEE, which ensures higher stability, which is confirmed by the results of the accelerated storage test.
ИК-спектр с Фурье преобразованием калиевых солей пептида НАЕЕ представлен на Фиг. 6. ИК-спектры калиевых солей повторяет все основные линии ИК-спектра НАЕЕ.The FTIR spectrum of the potassium salts of the HAEE peptide is shown in FIG. 6. The IR spectra of potassium salts repeat all the main lines of the HAEEE IR spectrum.
В ИК-спектре HAEE-K наблюдается новый максимум при 2980 см-1 (соли аминов RNH3 +), произошло смещение и уширение пика 1530 в область 1550 см-1 (плоские деформационные колебания -NН2). Произошло изменение интенсивностей пиков при 1250 и 1310 см-1 (С-N). Появился новый максимум при 985 см-1 (Фиг. 6,7).In the IR spectrum of HAEE-K, a new maximum is observed at 2980 cm -1 (salts of amines RNH 3 + ), there was a shift and broadening of the peak at 1530 in the region of 1550 cm -1 (flat deformation vibrations -NH 2 ). There was a change in the intensities of the peaks at 1250 and 1310 cm -1 (C-N). A new maximum appeared at 985 cm -1 (Fig. 6.7).
В ИК-спектре HAEE-K наблюдается новый максимум при 1675 см-1 (плоские деформационные колебания -NН2). Максимумы при 1645 см-1 и 1530 см-1 смещены (плоские деформационные колебания -NН2 / С=О / [δ(N-H)]). В области 1300-700 см-1 наблюдаются новые слабые максимумы при 1315 и 1305 см-1 (колебания -СОO- карбоновых кислот), при 1275 см-1 (С-N) и при 700 см-1 (неплоские деформационные колебания -NH2). В ИК-спектре исчез максимум при 1205 см-1 (алифатические амины). Максимум при 1130 см-1 сместился в область 1145 см-1 (C-N вал.). Произошло сужение и увеличение интенсивности пика при 3275 см-1. (N-H группа). (Фиг. 6,7).The IR spectrum of HAEE-K shows a new maximum at 1675 cm-one (plane deformation vibrations -NH2). Maximums at 1645 cm-one and 1530 cm-one offset (flat deformation vibrations -NH2 / C=O / [δ(N-H)]). In the area of 1300-700 cm-one new weak maxima are observed at 1315 and 1305 cm-one (vibrations -COO- carboxylic acids), at 1275 cm-one (С-N) and at 700 cm-one (out-of-plane bending vibrations -NH2). The maximum at 1205 cm disappeared in the IR spectrum-one (aliphatic amines). Maximum at 1130 cm-one moved to the area of 1145 cm-one (C-N shaft.). There was a narrowing and an increase in the intensity of the peak at 3275 cm-one. (N-H group). (Fig. 6.7).
Отличие ИК-спектра HAEE-K2 от HAAE заключается в смещении максимумов при 1530 см-1 в область 1645 см-1 (плоские деформационные колебания -NН2), наблюдаются изменения в интенсивности пиков в области 1180-1310 см-1 (С-N). (Фиг. 6,7).The difference between the IR spectrum of HAEE-K 2 and HAAE lies in the shift of the maxima at 1530 cm -1 to the region of 1645 cm -1 (plane deformation vibrations -NH 2 ), changes in the intensity of the peaks in the region of 1180-1310 cm -1 (C- N). (Fig. 6.7).
Таким образом в ИК-спектре калиевых солей пептида НАЕЕ произошли изменения колебаний связи в молекуле НАЕЕ, преимущественно аминогрупп, что связано с образованием солей калия.Thus, in the IR spectrum of the potassium salts of the HAEE peptide, there were changes in the bond vibrations in the HAEE molecule, mainly in amino groups, which is associated with the formation of potassium salts.
Способ получения калиевых солей пептида НАЕЕ заключается в смешивании при комнатной температуре водных растворов HAEE и водного раствора соединения калия в стехиометрических соотношениях, перемешивании в течение 5-30 мин и высушивании раствора.The method for obtaining potassium salts of the HAEE peptide consists in mixing aqueous solutions of HAEE and an aqueous solution of a potassium compound in stoichiometric ratios at room temperature, stirring for 5-30 min and drying the solution.
Для получения HAEE-K стехиометрическое соотношение компонентов НАЕЕ:K должно быть 1:1 по молям. Для получения HAEE-K2 стехиометрическое соотношение компонентов НАЕЕ:K должно быть 1:2 по молям.To obtain HAEE-K, the stoichiometric ratio of the components of HAEE:K must be 1:1 in moles. To obtain HAEE-K 2 stoichiometric ratio of components HAEE:K should be 1:2 moles.
Во время перемешивания допускается нагревание до 50°С.During mixing, heating up to 50°C is allowed.
Высушивание выполняется стандартными методами органический химии, преимущественно под вакуумом. Температура сушки не должна превышать 50°С. Калиевые соли пептида НАЕЕ могут быть получены в виде лиофилизата методом стандартной сублимационной лиофильной сушки. Для лиофильного высушивания раствор предварительно замораживается.Drying is carried out by standard methods of organic chemistry, preferably under vacuum. The drying temperature should not exceed 50°C. Potassium salts of the HAEE peptide can be obtained as a lyophilisate by standard freeze-drying. For freeze-drying, the solution is pre-frozen.
В заявляемом способе получения соединениями калия являются гидроксид, гидрокарбонат или карбонат калия.In the claimed method of obtaining potassium compounds are hydroxide, bicarbonate or potassium carbonate.
Вариант способа получения калиевых солей пептида НАЕЕ заключается в смешивании при комнатной температуре водных растворов HAEE и водного раствора сульфата калия или гидросульфата калия в стехиометрических соотношениях, перемешивании в течение 5-10 мин, добавлении стехиометрических количеств водного раствора гидроксида бария для осаждения сульфат-аниона, перемешивании в течение 10-30 мин, удаление осадка сульфата бария и высушивании раствора.A variant of the method for obtaining potassium salts of the HAEE peptide consists in mixing aqueous solutions of HAEE and an aqueous solution of potassium sulfate or potassium hydrogen sulfate in stoichiometric ratios at room temperature, stirring for 5-10 min, adding stoichiometric amounts of an aqueous solution of barium hydroxide to precipitate the sulfate anion, stirring within 10-30 min, removing the precipitate of barium sulfate and drying the solution.
Для получения HAEE-K стехиометрическое соотношение компонентов НАЕЕ:K должно быть 1:1 по молям. Для получения HAEE-K2 стехиометрическое соотношение компонентов НАЕЕ:K должно быть 1:2 по молям.To obtain HAEE-K, the stoichiometric ratio of the components of HAEE:K must be 1:1 in moles. To obtain HAEE-K 2 stoichiometric ratio of components HAEE:K should be 1:2 moles.
После добавления раствора гидроксида бария во время перемешивания допускается нагревание до 50°С. Для осаждения сульфат-аниона стехиометрическое соотношение компонентов SO4 2-:Ba2+ должно быть 1:1 по молям.After adding a solution of barium hydroxide during stirring, heating up to 50°C is allowed. To precipitate the sulfate anion, the stoichiometric ratio of the components SO 4 2- :Ba 2+ should be 1:1 by moles.
Удаление осадка сульфата бария выполняется фильтрованием или центрифугированием и декантацией супернатанта, содержащего раствор калиевой соли пептида НАЕЕ.Removal of the barium sulfate precipitate is performed by filtration or centrifugation and decantation of the supernatant containing a solution of the potassium salt of the HAEE peptide.
Высушивание выполняется стандартными методами органический химии, преимущественно под вакуумом. Температура сушки не должна превышать 50°С. Калиевые соли пептида НАЕЕ могут быть получены в виде лиофилизата методом стандартной сублимационной лиофильной сушки. Для лиофильного высушивания раствор предварительно замораживается.Drying is carried out by standard methods of organic chemistry, preferably under vacuum. The drying temperature should not exceed 50°C. Potassium salts of the HAEE peptide can be obtained as a lyophilisate by standard freeze-drying. For freeze-drying, the solution is pre-frozen.
При получении калиевых солей пептида НАЕЕ в зависимости от способа высушивания может оставаться остаточная влажность до 5% масс. При этом калиевые соли пептида НАЕЕ не набирают дополнительную воду при хранении и стабильны в течение длительного времени.Upon receipt of the potassium salts of the HAEE peptide, depending on the method of drying, a residual moisture content of up to 5% of the mass may remain. At the same time, potassium salts of the HAEE peptide do not accumulate additional water during storage and are stable for a long time.
Еще одним объектом изобретения является фармацевтические композиции с эффективным количеством калиевой соли пептида НАЕЕ и наличием вспомогательных веществ. В качестве лекарственного средства однозамещенная или двузамещенная калиевая соль пептида НАЕЕ может быть использована без вспомогательных веществ в виде лиофилизированной субстанции.Another object of the invention is pharmaceutical compositions with an effective amount of the potassium salt of the HAEE peptide and the presence of excipients. As a drug, the monosubstituted or disubstituted potassium salt of the HAEE peptide can be used without auxiliary substances in the form of a lyophilized substance.
Эффективное количество калиевой соли пептида НАЕЕ зависит от типа нейродегенеративного заболевания, веса тела, способа введения, поэтому может варьироваться в широких пределах от 0,1 до 100 мг, более желательно от 5 до 50 мг.The effective amount of the potassium salt of the HAEE peptide depends on the type of neurodegenerative disease, body weight, route of administration, and therefore can vary widely from 0.1 to 100 mg, more preferably from 5 to 50 mg.
Фармацевтическая композиция калиевой соли пептида НАЕЕ может быть в твердом виде или в виде водного раствора. Твердые композиции калиевой соли пептида НАЕЕ содержат его эффективное количество и необязательно вспомогательные вещества. Твердая фармацевтическая композиция может быть получена высушиванием раствора активного вещества и набором вспомогательных компонентов или добавлением вспомогательных веществ к порошку калиевой соли пептида НАЕЕ.The pharmaceutical composition of the potassium salt of the HAEE peptide may be in solid form or in the form of an aqueous solution. Solid compositions of the potassium salt of the HAEE peptide contain its effective amount and optional excipients. A solid pharmaceutical composition can be obtained by drying a solution of the active substance and a set of excipients or by adding excipients to the powder of the potassium salt of the HAEE peptide.
Высушенная или лиофилизированная калиевая соль пептида НАЕЕ может находиться в аморфной форме, которая соответствует дифрактограмме на Фиг. 1,2.The dried or lyophilized potassium salt of the HAEE peptide may be in an amorphous form, which corresponds to the diffraction pattern in FIG. 1.2.
Вспомогательные вещества выбираются из фармацевтически приемлемых добавок. Такими веществами могут быть маннитол, повидон К 17, трометамол, динатрия эдетат, натрия хлорид, сахароза, гистидин, полоксамер 407, и другие фармацевтически приемлемые добавки.Excipients are selected from pharmaceutically acceptable additives. Such substances may include mannitol,
Фармацевтическая композиция калиевой соли пептида НАЕЕ в виде водного раствора содержит эффективное количество калиевой соли пептида НАЕЕ, воду, а также набор фармацевтически приемлемых добавок и солей. Такими веществами могут быть маннитол, повидон К 17, трометамол, динатрия эдетат, натрия хлорид, сахароза, гистидин, полоксамер 407, и другие фармацевтически приемлемые добавки.The pharmaceutical composition of the potassium salt of the HAEE peptide in the form of an aqueous solution contains an effective amount of the potassium salt of the HAEE peptide, water, and a set of pharmaceutically acceptable additives and salts. Such substances may include mannitol,
Еще одним объектом изобретения является применение калиевой соли пептида НАЕЕ для лечения нейродегенеративных заболеваний, которое заключается во введении калиевой соли пептида НАЕЕ в составе описанных фармацевтических композиций пациенту в эффективном количестве. Эффективное количество калиевой соли пептида НАЕЕ зависит от типа нейродегенеративного заболевания, веса тела, способа введения, поэтому может варьироваться в широких пределах от 0,1 до 100 мг, предпочтительно от 5 до 50 мг.Another object of the invention is the use of the potassium salt of the HAEE peptide for the treatment of neurodegenerative diseases, which consists in administering the potassium salt of the HAEE peptide in the described pharmaceutical compositions to the patient in an effective amount. The effective amount of the potassium salt of the HAEE peptide depends on the type of neurodegenerative disease, body weight, route of administration, and therefore can vary widely from 0.1 to 100 mg, preferably from 5 to 50 mg.
Введение калиевой соли пептида НАЕЕ пациенту может осуществляться с помощью всех возможных видов наружного, энтерального, ингаляционного и парентерального способов применения (включая внутривенное, внутриартериальное, внутрибрюшинное, подкожное, накожное, трансдермальное, внутримышечное, интратекальное, субарахноидальное, пероральное, интраназальное, сублингвальное, буккальное, ректальное введение). При введении калиевой соли пептида НАЕЕ в твердой форме предпочтительным способом введения является сублингвальный. При введении калиевой соли пептида HAEE в форме раствора предпочтительными способами введения являются внутривенный и интраназальный.The introduction of the potassium salt of the HAEE peptide to the patient can be carried out using all possible types of external, enteral, inhalation and parenteral routes of administration (including intravenous, intra-arterial, intraperitoneal, subcutaneous, cutaneous, transdermal, intramuscular, intrathecal, subarachnoid, oral, intranasal, sublingual, buccal, rectal administration). When administering the potassium salt of the HAEE peptide in solid form, the preferred route of administration is sublingual. When administering the potassium salt of the HAEE peptide in the form of a solution, the preferred routes of administration are intravenous and intranasal.
Возможность терапевтического лечения нейродегенеративных заболеваний была показана на примере болезни Альцгеймера, как одного из самых распространенных нейродегенеративных расстройств, смоделированной на трансгенных мышах линии APPswe/PSEN1dE9 (APP/PS1) (Jankowsky, J. L., Slunt, H. H., Ratovitski, T., Jenkins, N. A., Copeland, N. G., & Borchelt, D. R. (2001). Co-expression of multiple transgenes in mouse CNS: a comparison of strategies. Biomolecular engineering, 17(6), 157-165, doi: 10.1016/S1389-0344(01)00067-3), которые проявляют характерные когнитивные признаки патологии. Данная модель может считаться моделью опосредованного воспалительного действия при нарушении когнитивных функций.The possibility of therapeutic treatment of neurodegenerative diseases was shown on the example of Alzheimer's disease, as one of the most common neurodegenerative disorders, modeled on transgenic mice of the APPswe/PSEN1dE9 (APP/PS1) line (Jankowsky, J. L., Slunt, H. H., Ratovitski, T., Jenkins, N. A. , Copeland, N. G., & Borchelt, D. R. (2001) Co-expression of multiple transgenes in mouse CNS: a comparison of strategies Biomolecular engineering, 17(6), 157-165, doi: 10.1016/S1389-0344(01) 00067-3) that exhibit characteristic cognitive signs of pathology. This model can be considered as a model of mediated inflammatory action in cognitive impairment.
В настоящем изобретении калиевые соли пептида НАЕЕ вводили шестикратно внутривенно в дозе 0,05 мг/кг, после чего проводили валидный тест на когнитивные способности «Закапывание шариков» (англ. Marble Burying Test) [Santana-Santana M., Bayascas J.R., Giménez-Llort L. (2021). Sex-Dependent Signatures, Time Frames and Longitudinal Fine-Tuning of the Marble Burying Test in Normal and AD-Pathological Aging Mice. Biomedicines, 9(8), 994, doi: 10.3390/biomedicines9080994), определяя количество более чем на 2/3 закопанных шариков в процентах от общего количества шариков. Чем больше количество закопанных шариков (КЗШ), тем выше когнитивные способности у мышей.In the present invention, the potassium salts of the HAEE peptide were administered six times intravenously at a dose of 0.05 mg/kg, after which a valid Marble Burying Test for cognitive abilities was performed [Santana-Santana M., Bayascas J.R., Giménez- Llort L. (2021). Sex-Dependent Signatures, Time Frames and Longitudinal Fine-Tuning of the Marble Burying Test in Normal and AD-Pathological Aging Mice. Biomedicines, 9(8), 994, doi: 10.3390/biomedicines9080994), determining the number of more than 2/3 of the buried balls as a percentage of the total number of balls. The greater the number of buried balls (KZS), the higher the cognitive abilities in mice.
По результатам тестирования у контрольной группы мышей дикого типа, которым вводили физиологический раствор, значение КЗШ равнялось 50,6 ±13,3 (%). Это значение принималось в качестве референсного. У контрольной группы трансгенных мышей линии APP/PS1, которым вводили физиологический раствор, значение КЗШ = 12,6 ±4,2 (%), что указывает на сильное ухудшение поведенческих рефлексов трансгенных мышей линии APP/PS1 по сравнению с животными дикого типа и отражает инвалидизирующее влияние оверэкспрессии человеческого бета-амилоида, ассоциированное с нейроваоспалением и образования амилоидных бляшек, на процессы нервной деятельности. У группы трансгенных мышей линии APP/PS1, получавшей НАЕЕ, значение КЗШ составило 20,6±7,3 (%). Группа трансгенных мыши линии APP/PS1, получавшая однозамещенную и двузамещенную калиевую соль пептида HAEE, показали значения КЗШ = 44,3±11,1 (%) и КЗШ = 49,2±10,2 (%), соответственно (Таблица 4). Эти данные свидетельствуют о том, что использование калиевой соли пептида HAEE существенно улучшает поведенческие рефлексы трансгенных мышей APP/PS1, а эффект от этого использования значительно превышает таковой, наблюдаемый для HAEE. НАЕЕ-K2 на уровне тенденции имеет большую эффективность по сравнению с НАЕЕ-K.According to the results of testing in the control group of wild-type mice, which were injected with saline, the value of KZS was 50.6 ± 13.3 (%). This value was taken as a reference. In the control group of transgenic mice of the APP/PS1 line, which were injected with saline, the value of KZS = 12.6 ± 4.2 (%), which indicates a strong deterioration in the behavioral reflexes of transgenic mice of the APP/PS1 line compared to wild-type animals and reflects the disabling effect of overexpression of human beta-amyloid, associated with neuroinflammation and the formation of amyloid plaques, on the processes of nervous activity. In the group of transgenic mice of the APP/PS1 line treated with HAE, the KZS value was 20.6 ± 7.3 (%). A group of transgenic mice of the APP/PS1 line, which received the monosubstituted and disubstituted potassium salt of the HAEE peptide, showed the values of KZS = 44.3±11.1 (%) and KZS = 49.2±10.2 (%), respectively (Table 4) . These data indicate that the use of the potassium salt of the HAEE peptide significantly improves the behavioral reflexes of APP/PS1 transgenic mice, and the effect of this use is significantly higher than that observed for HAEE. HAEE-K 2 at the trend level is more effective than HAEE-K.
Таким образом, калиевые соли пептида НАЕE могут эффективно применяться при лечении нейродегенеративных заболеваний, в частности вызванными воспалительными осложнениями, восстанавливая когнитивные функции до нормального состояния.Thus, potassium salts of the HAEE peptide can be effectively used in the treatment of neurodegenerative diseases, in particular those caused by inflammatory complications, by restoring cognitive functions to a normal state.
Гистохимический анализ области гиппокампа головного мозга экспериментальных мышей показал, что число бляшек (ЧБ) на один срез мозга у контрольной группы диких мышей равно нулю, у контрольной группы трансгенных мышей APP/PS1 значение ЧБ оказалось равным 31,7 ± 4,9, в группе мышей, получавших НАЕЕ, значение ЧБ составило 24,7±3,4. В группе мышей, получавших НАЕЕ-K и НАЕЕ-K2, значение ЧБ составило 9,2±3,1 и 8,7±2,8, соответственно.Histochemical analysis of the hippocampal region of the brain of experimental mice showed that the number of plaques (PN) per one brain slice in the control group of wild mice was equal to zero, in the control group of APP/PS1 transgenic mice, the value of PN was 31.7 ± 4.9, in the group in mice treated with HAEE, the BH value was 24.7 ± 3.4. In the group of mice treated with HAEE-K and HAEE-K 2 , the BH value was 9.2±3.1 and 8.7±2.8, respectively.
Таким образом, результаты гистохимического анализа показали, что введение калиевых солей пептида НАЕЕ приводили к почти 4-кратному уменьшению амилоидной нагрузки в гиппокампе трансгенных мышей APP/PS1, и по этому показателю эффективность калиевых солей пептида НАЕЕ примерно в три раза выше таковой, выявленной для HAEE.Thus, the results of histochemical analysis showed that the administration of potassium salts of the HAEE peptide led to an almost 4-fold decrease in the amyloid load in the hippocampus of APP/PS1 transgenic mice, and in terms of this indicator, the effectiveness of potassium salts of the HAEE peptide was approximately three times higher than that found for HAEE. .
В качестве одного из механизмов действия калиевых солей пептида НАЕЕ на возможность лечения нейродегенеративных заболеваний может являться его связывание с бета-амилоидом. Были рассчитаны кинетические характеристики взаимодействия калиевых солей пептида НАЕЕ и иммобилизованного человеческого бета-амилоида, которые оказались равны kon = (1,43±0,06) × 103 M-1s-1; koff = (5,92±0,06) × 10-3 s-1; KD = (4,14±0,30) × 10-6 М для НАЕЕ-K и значения kon = (1,36±0,06) × 103 M-1s-1; koff = (5,84±0,06) × 10-3 s-1; KD = (4,29±0,3) × 10-6 для НАЕЕ-K2. Поскольку значение KD ≤ 10-4 М, то такое взаимодействие является биологически значимым. В отличие от калиевых солей, нативный пептид НАЕЕ не связывался с бета-амилоидом в аналогичных экспериментальных условиях.As one of the mechanisms of action of potassium salts of the HAEE peptide on the possibility of treating neurodegenerative diseases, its binding to beta-amyloid may be. The kinetic characteristics of the interaction of potassium salts of the HAEE peptide and immobilized human beta-amyloid were calculated, which turned out to be equal to k on = (1.43±0.06) × 10 3 M -1 s -1 ; k off \u003d (5.92 ± 0.06) × 10 -3 s -1 ; K D = (4.14±0.30) × 10 -6 M for HAEEE-K and k on values = (1.36 ± 0.06) × 10 3 M -1 s -1 ; k off \u003d (5.84 ± 0.06) × 10 -3 s -1 ; K D = (4.29±0.3) × 10 -6 for HAE-K 2 . Since the value of K D ≤ 10 -4 M, then this interaction is biologically significant. Unlike potassium salts, the native HAEE peptide did not bind beta-amyloid under similar experimental conditions.
Это различие между нативным пептидом НАЕЕ и калиевыми солями пептида НАЕЕ может влиять на фармакологические свойства, что подтвердили различающиеся тесты восстановления когнитивных функций - эффективность НАЕЕ была значительно ниже эффективности калиевых солей пептида НАЕЕ. Этот эффект можно связать с вышеупомянутыми данными ВЭЖХ-МС, которые показали изменения в 3D структуре нативного НАЕЕ после его введения в плазму крови, тогда как калиевая соль пептида HAEE до и после его введения в плазму крови имеет одно и то же время удерживания на хроматограмме ВЭЖХ и, соответственно, устойчивую 3D структуру. Это означает, что ион калия играет защитную роль для сохранения «развернутой» конформации пептида HAEE в данных солях, что, возможно, также предотвращает взаимодействие с элементами плазмы крови, поскольку известно, что введение нативного HAEE в периферическую кровеносную систему мышей, крыс и кроликов приводит к образованию стабильных комплексов HAEE с транспортными и рецепторными белками (Zolotarev Y.A., Mitkevich V.A., Shram S.I. et al. Pharmacokinetics and Molecular Modeling Indicate nAChRα4-Derived Peptide HAEE Goes through the Blood-Brain Barrier. Biomolecules. 2021. 11(6): p. 909, doi: 10.3390/biom11060909).This difference between the native HAEE peptide and the potassium salts of the HAEE peptide may influence the pharmacological properties, which was confirmed by different cognitive recovery tests - the effectiveness of HAEE was significantly lower than that of the potassium salts of the HAEE peptide. This effect can be associated with the above HPLC-MS data, which showed changes in the 3D structure of native HAEE after its introduction into blood plasma, while the potassium salt of the HAEE peptide before and after its introduction into blood plasma has the same retention time on the HPLC chromatogram. and, accordingly, a stable 3D structure. This means that the potassium ion plays a protective role in maintaining the “unfolded” conformation of the HAEE peptide in these salts, which may also prevent interaction with blood plasma elements, since it is known that the introduction of native HAEE into the peripheral circulatory system of mice, rats, and rabbits leads to to the formation of stable HAEE complexes with transport and receptor proteins (Zolotarev Y.A., Mitkevich V.A., Shram S.I. et al. Pharmacokinetics and Molecular Modeling Indicate nAChRα4-Derived Peptide HAEE Goes through the Blood-Brain Barrier. Biomolecules. 2021. 11(6): p 909, doi: 10.3390/biom11060909).
В совокупности можно сделать вывод о том, что калиевые соли пептида НАЕЕ имеет намного большую терапевтическую эффективность по сравнению с НАЕЕ и эти вещества между собой бионеэквивалентны, поскольку после введения калиевой соли в организм, НАЕЕ существует в растворе плазмы крови в «развернутой» конформации и имеет отличный от НАЕЕ механизм действия.Taken together, it can be concluded that the potassium salts of the HAEE peptide have a much greater therapeutic efficacy compared to HAEE, and these substances are not bioequivalent to each other, since after the introduction of the potassium salt into the body, HAEE exists in the blood plasma solution in an "unfolded" conformation and has mechanism of action different from HAEEE.
ОПИСАНИЕ ФИГУР.DESCRIPTION OF FIGURES.
Фиг. 1. Дифрактограмма HAEE-K.Fig. 1. X-ray diffraction pattern of HAEE-K.
Фиг. 2. Дифрактограмма HAEE-K2.Fig. 2. X-ray pattern of HAEE-K 2 .
Фиг. 3. ДСК-ТГА кривая НАЕЕ. 1 - ДСК-кривая; 2 - ТГ-кривая.Fig. 3. DSC-TGA curve HAEE. 1 - DSC curve; 2 - TG curve.
Фиг. 4. ДСК-ТГА кривая HAEE-K.Fig. 4. DSC-TGA curve HAEE-K.
Фиг. 5. ДСК-ТГА кривая HAEE-K2.Fig. 5. DSC-TGA curve HAEE-K 2 .
Фиг. 6. ИК-спектр c Фурье преобразованием НАЕЕ (1), НАЕЕ-K2 (2) и НАЕЕ-K (3).Fig. Fig. 6. IR spectrum with Fourier transform of HAEE (1), HAEE-K 2 (2) and HAEE-K (3).
Фиг. 7. ИК-спектр c Фурье преобразованием в характеристичной области 1800-700 см-1. НАЕЕ (1), НАЕЕ-K2 (2) и НАЕЕ-K (3).Fig. 7. IR spectrum with Fourier transform in the characteristic region 1800-700 cm -1 . HAEEE (1), HAEEE-K 2 (2) and HAEEE-K (3).
Фиг. 8. Расположение атомов в молекуле НАЕЕ для 1Н-ЯМР-анализа.Fig. 8. Arrangement of atoms in the HAEE molecule for 1 H-NMR analysis.
Фиг. 9. 1Н-ЯМР спектр НАЕЕ.Fig. 9. 1 H-NMR spectrum of HAEEE.
Фиг. 10. 1Н-ЯМР спектр НАЕЕ-K.Fig. 10. 1 H-NMR spectrum of HAEE-K.
Фиг. 11. 1Н-ЯМР спектр НАЕЕ-K2.Fig. 11. 1 H-NMR spectrum of HAEE-K 2 .
Описание приборов.Description of devices.
Порошковый рентгенофазовый анализ (РФА) выполнялся на дифрактометре Rigaku Ultima IV (Япония), напряжение на трубке - 40 кВ, ток трубки - 30 мА, материал анода трубки - Cu. Гониометр: Θ/Θ вертикального типа, образец неподвижен. Радиус гониометра - 185 мм /285 мм. Максимумы на дифрактограмме накапливались в течение 1 ч. Угол 2Θ составил от 3 до 70 градусов.Powder X-ray phase analysis (XRD) was performed on a Rigaku Ultima IV diffractometer (Japan), the tube voltage was 40 kV, the tube current was 30 mA, and the tube anode material was Cu. Goniometer: Θ/Θ vertical type, the sample is stationary. Goniometer radius - 185 mm / 285 mm. The maxima in the diffraction pattern accumulated over 1 h. The angle 2Θ ranged from 3 to 70 degrees.
Исследование температуры плавления, термического поведения и потери массы выполняли методом дифференциальной сканирующей калориметрии и термогравиметрии (ДСК-ТГА) на приборе NETZSCH STA 449 С (Германия) в инертной атмосфере при скорости нагрева 10 град/мин.The melting point, thermal behavior, and weight loss were studied by differential scanning calorimetry and thermogravimetry (DSC-TGA) on a NETZSCH STA 449 C instrument (Germany) in an inert atmosphere at a heating rate of 10 deg/min.
Элементный анализ выполнен методом энергодисперсионной рентгеновской спектроскопии с приставкой EDXA на микроскопе TESCAN MIRA3 (Чехия). Площадь измеряемого участка 0,04 мм2, количество измерений - 3.Elemental analysis was performed by energy dispersive X-ray spectroscopy with an EDXA attachment on a TESCAN MIRA3 microscope (Czech Republic). The area of the measured area is 0.04 mm 2 , the number of measurements is 3.
Спектры инфракрасного излучения (ИК-спектры) получали на ИК-Фурье спектрометре Spectrum Two (Perkin Elmer, США) c приставкой диффузного отражения в диапазоне 4000-600 см-1 с разрешением 2 см-1, количество сканов - 10.Infrared radiation spectra (IR spectra) were obtained on a Spectrum Two IR-Fourier spectrometer (Perkin Elmer, USA) with a diffuse reflectance attachment in the range of 4000-600 cm -1 with a resolution of 2 cm -1 , the number of scans was 10.
1Н-спектры ЯМР получали на ЯМР-спектрометре Bruker Avance IIIHD 500, рабочая частота 500,13 Mhz для ядер 1H. 1 H NMR spectra were obtained on a
Масс-спектрометрия высокого разрешения проводилась с использованием масс-спектрометра LTQ FT Ultra (Thermo Scientific, Германия), который сочетает в себе технологии ионного циклотронного резонанса с преобразованием Фурье и ионной ловушки. Ионизацию электрораспылением (ESI) выполняли с использованием источника Ion Max (Thermo Scientific, Германия) с металлическим капилляром для распыления. Использовались следующие параметры источника IonMax: скорость потока составляла 3 мкл/мин; температура нагретого капилляра составляла 200°C; распыляемый газ был отключен; напряжение на капилляре электрораспыления составляло +3,8 кВ в положительной моде и -2,5кВ в отрицательно моде. Идентификация молекулярных ионов проводилась с помощью специализированного программного обеспечения Qual Browser (Thermo Corp., Germany).High resolution mass spectrometry was carried out using an LTQ FT Ultra mass spectrometer (Thermo Scientific, Germany), which combines Fourier transform ion cyclotron resonance and ion trap technologies. Electrospray ionization (ESI) was performed using an Ion Max source (Thermo Scientific, Germany) with a metal spray capillary. The following parameters of the IonMax source were used: the flow rate was 3 μl/min; the temperature of the heated capillary was 200°C; spray gas has been turned off; the electrospray capillary voltage was +3.8 kV in the positive mode and -2.5 kV in the negative mode. Molecular ions were identified using specialized software Qual Browser (Thermo Corp., Germany).
Взаимодействие с бета-амилоидом фиксировали биосенсором на эффекте поверхностного плазмонного резонанса (БППР) в водных буферных системах при физиологических значениях pH. БППР эксперименты были проведены на инструменте «BIAcore 3000» (GE Healthcare, США) с использованием оптического чипа CM4 в соответствии с протоколами компании-производителя. Синтетический аналог 42-членного человеческого бета-амилоида (Aβ42), на C-конце которого добавлен тетраглицилцистеиновый пептидный фрагмент (-Gly-Gly-Gly-Gly-Cys), был использован в качестве лиганда.The interaction with beta-amyloid was recorded by a biosensor based on the effect of surface plasmon resonance (SPPR) in aqueous buffer systems at physiological pH values. The BPPR experiments were carried out on a
Лиганд (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAGGGGC) иммобилизовали на поверхности оптического чипа через дисульфидную связь тиоловой группы С-концевого остатка цистеина. В качестве аналитов использовали калиевые соли НАЕЕ или HAEE.The ligand (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAGGGGC) was immobilized on the optical chip surface through the disulfide bond of the thiol group of the C-terminal cysteine residue. Potassium salts of HAEE or HAEE were used as analytes.
Высушивание замороженных образцов выполнялось в пенициллиновых пузырьках на сублиматоре Heto FD 2.5 при давлении 0,1-0,2 мбар.Drying of frozen samples was carried out in penicillin vials on a Heto FD 2.5 sublimator at a pressure of 0.1-0.2 mbar.
Тест ускоренного хранения проводили в камере Memmert HCP50 при 40°С и 75% влажности. Образцы отбирали раз в месяц в течение 6 месяцев и определяли содержание действующего вещества методом ВЭЖХ.The accelerated storage test was performed in a Memmert HCP50 chamber at 40° C. and 75% humidity. Samples were taken once a month for 6 months and the content of the active substance was determined by HPLC.
ВАРИАНТЫ ОСУЩЕСТВЛЕНИЯ ИЗОБРЕТЕНИЯEMBODIMENTS FOR CARRYING OUT THE INVENTION
Изобретение иллюстрируется нижеприведенными примерами, но не ограничивается ими.The invention is illustrated by the following examples, but is not limited to them.
Пример 1. Получение однозамещенной калиевой соли пептида НАЕЕ (HAEE-K). Example 1Receipt monosubstituted potassium salt of the HAEE peptide (HAEE-K).
К 100 мл водного раствора НАЕЕ с концентрацией 10-3 М добавляли 10 мл KOH c концентрацией 0,01 М и перемешивали в течение 15 мин при комнатной температуре. Полученный раствор разделили на две части по 55 мл.To 100 ml of an aqueous solution of HAEE with a concentration of 10 -3 M was added 10 ml of KOH with a concentration of 0.01 M and stirred for 15 min at room temperature. The resulting solution was divided into two parts of 55 ml.
Первую часть высушивали на ротационном испарителе под вакуумом 7 мм. рт. ст. при температуре 40°С. Получили белый порошок однозамещенной калиевой соли пептида НАЕЕ, выход продукта с учетом потерь составил 87%.The first part was dried on a rotary evaporator under a vacuum of 7 mm. rt. Art. at a temperature of 40°C. A white powder of the monosubstituted potassium salt of the HAEE peptide was obtained; the yield of the product, taking into account the losses, was 87%.
Вторую часть раствора объемом 55 мл разливали в пенициллиновые пузырьки объемом по 5 мл и замораживали в холодильной установке при -20°С и затем лиофильно высушивали в стандартном режиме при давлении 0,015 мбар в течение 24 ч. Выход продукта с учетом потерь составил 98%. Продукт представлял собой белый порошок однозамещенной калиевой соли пептида НАЕЕ.The second part of the solution with a volume of 55 ml was poured into penicillin vials with a volume of 5 ml and frozen in a refrigeration unit at -20°C and then lyophilized in the standard mode at a pressure of 0.015 mbar for 24 h. The product yield, taking into account losses, was 98%. The product was a white powder of the monobasic potassium salt of the HAEE peptide.
Исследование образцов однозамещенной калиевой соли пептида НАЕЕ показало, что независимо от способа высушивания они имеют идентичные характеристики (Фиг. 1, 4, 6, 7, 10).The study of samples of the monosubstituted potassium salt of the HAEE peptide showed that, regardless of the method of drying, they have identical characteristics (Fig. 1, 4, 6, 7, 10).
Еще одним вариантом способа получения HAEE-K является использование гидрокарбоната калия.Another variant of the method for obtaining HAEE-K is the use of potassium bicarbonate.
К 100 мл водного раствора НАЕЕ с концентрацией 10-3 М добавляли 10 мл KНСО3 c концентрацией 0,01 М и перемешивали в течение 30 мин при температуре 40°С вплоть до прекращения выделения пузырьков диоксида углерода. Полученный раствор разделили на две части по 55 мл.To 100 ml of an aqueous solution of HAEE with a concentration of 10 -3 M was added 10 ml of KHCO 3 with a concentration of 0.01 M and stirred for 30 min at a temperature of 40°C until the evolution of carbon dioxide bubbles ceased. The resulting solution was divided into two parts of 55 ml.
Первую часть высушивали на ротационном испарителе под вакуумом 8 мм. рт. ст. при температуре 35°С. Получили белый порошок однозамещенной калиевой соли пептида НАЕЕ, выход продукта с учетом потерь составил 84%.The first part was dried on a rotary evaporator under a vacuum of 8 mm. rt. Art. at a temperature of 35°C. A white powder of the monosubstituted potassium salt of the HAEE peptide was obtained; the yield of the product, taking into account losses, was 84%.
Вторую часть раствора объемом 55 мл разливали в пенициллиновые пузырьки объемом по 5 мл и замораживали в холодильной установке при -20°С и затем лиофильно высушивали в стандартном режиме при давлении 0,02 мбар в течение 36 ч. Выход продукта с учетом потерь составил 97%. Продукт представлял собой белый порошок однозамещенной калиевой соли пептида НАЕЕ.The second part of the solution with a volume of 55 ml was poured into 5 ml penicillin vials and frozen in a refrigeration unit at -20°C and then lyophilized in the standard mode at a pressure of 0.02 mbar for 36 h. The product yield, taking into account losses, was 97% . The product was a white powder of the monobasic potassium salt of the HAEE peptide.
Исследование образцов однозамещенной калиевой соли пептида НАЕЕ показало, что независимо от способа высушивания они имеют идентичные характеристики (Фиг. 1, 4, 6, 7, 10).The study of samples of the monosubstituted potassium salt of the HAEE peptide showed that, regardless of the method of drying, they have identical characteristics (Fig. 1, 4, 6, 7, 10).
Еще одним вариантом способа получения HAEE-K является использование карбоната калия.Another variant of the method for obtaining HAEE-K is the use of potassium carbonate.
К 100 мл водного раствора НАЕЕ с концентрацией 10-3 М добавляли 5 мл K2СО3 c концентрацией 0,01 М и перемешивали в течение 25 мин при температуре 50°С вплоть до прекращения выделения пузырьков диоксида углерода. Полученный раствор разделили на две части по 50 и 55 мл.To 100 ml of an aqueous solution of HAE with a concentration of 10 -3 M was added 5 ml of K 2 CO 3 with a concentration of 0.01 M and stirred for 25 min at a temperature of 50°C until the evolution of carbon dioxide bubbles ceased. The resulting solution was divided into two parts of 50 and 55 ml.
Первую часть высушивали на ротационном испарителе под вакуумом 6 мм. рт. ст. при комнатной температуре. Получили белый порошок однозамещенной калиевой соли пептида НАЕЕ, выход продукта с учетом потерь составил 83%.The first part was dried on a rotary evaporator under a vacuum of 6 mm. rt. Art. at room temperature. A white powder of the monosubstituted potassium salt of the HAEE peptide was obtained; the yield of the product, taking into account losses, was 83%.
Вторую часть раствора объемом 55 мл разливали в пенициллиновые пузырьки объемом по 5 мл и замораживали в холодильной установке при -20°С и затем лиофильно высушивали в стандартном режиме при давлении 0,02 мбар в течение 30 ч. Выход продукта с учетом потерь составил 97%. Продукт представлял собой белый порошок однозамещенной калиевой соли пептида НАЕЕ.The second part of the solution with a volume of 55 ml was poured into penicillin vials with a volume of 5 ml and frozen in a refrigeration unit at -20°C and then lyophilized in the standard mode at a pressure of 0.02 mbar for 30 h. The yield of the product, taking into account losses, was 97% . The product was a white powder of the monobasic potassium salt of the HAEE peptide.
Исследование образцов однозамещенной калиевой соли пептида НАЕЕ показало, что независимо от способа высушивания они имеют идентичные характеристики (Фиг. 1, 4, 6, 7, 10).The study of samples of the monosubstituted potassium salt of the HAEE peptide showed that, regardless of the method of drying, they have identical characteristics (Fig. 1, 4, 6, 7, 10).
Еще одним вариантом способа получения HAEE-K является использование сульфата калия.Another option for the method of obtaining HAEE-K is the use of potassium sulfate.
К 100 мл водного раствора НАЕЕ с концентрацией 10-3 М добавляли 5 мл K2SO4 c концентрацией 0,01 М и перемешивали в течение 5 мин при комнатной температуре. После чего добавляли к получившемуся раствору добавляли 5 мл раствора Ba(ОН)2 с концентрацией 0,01 М и перемешивали в течение 20 мин при температуре 35°С. Полученный раствор с осадком центрифугировали при 6000 об/мин в течение 15 мин и декантировали надосадочную жидкость, которую высушивали на ротационном испарителе под вакуумом 9 мм. рт. ст. при 30°С. Получили белый порошок однозамещенной калиевой соли пептида НАЕЕ, выход продукта с учетом потерь составил 82%.To 100 ml of an aqueous solution of HAE with a concentration of 10 -3 M was added 5 ml of K 2 SO 4 with a concentration of 0.01 M and stirred for 5 min at room temperature. Then added to the resulting solution was added 5 ml of a solution of Ba(OH) 2 with a concentration of 0.01 M and stirred for 20 min at a temperature of 35°C. The resulting solution with the precipitate was centrifuged at 6000 rpm for 15 min, and the supernatant liquid was decanted, which was dried on a rotary evaporator under a vacuum of 9 mm. rt. Art. at 30°C. A white powder of the monosubstituted potassium salt of the HAEE peptide was obtained; the yield of the product, taking into account losses, was 82%.
В еще одном варианте осуществления изобретения к 100 мл водного раствора НАЕЕ с концентрацией 10-3 М добавляли 5 мл K2SO4 c концентрацией 0,01 М (или 5 мл КHSO4 с концентрацией 0,02 М) и перемешивали в течение 5 мин при комнатной температуре. После чего добавляли к получившемуся раствору добавляли 5 мл раствора Ba(ОН)2 с концентрацией 0,01 М и перемешивали в течение 30 мин при комнатной температуре. Полученный раствор с осадком фильтровали через бумажный фильтр под вакуумом. Профильтрованный раствора разливали в пенициллиновые пузырьки объемом по 2 мл и замораживали в холодильной установке при -20°С и затем лиофильно высушивали в стандартном режиме при давлении 0,02 мбар в течение 32 ч. Выход продукта с учетом потерь составил 91%. Продукт представлял собой белый порошок однозамещенной калиевой соли пептида НАЕЕ.In another embodiment of the invention, 5 ml of K 2 SO 4 with a concentration of 0.01 M (or 5 ml of KHSO 4 with a concentration of 0.02 M) were added to 100 ml of an aqueous solution of HAE with a concentration of 10 -3 M and stirred for 5 min at room temperature. After that, 5 ml of a Ba(OH) 2 solution with a concentration of 0.01 M was added to the resulting solution and stirred for 30 min at room temperature. The resulting solution with the precipitate was filtered through a paper filter under vacuum. The filtered solution was poured into 2 ml penicillin vials and frozen in a refrigeration unit at -20°C and then lyophilized in the standard mode at a pressure of 0.02 mbar for 32 h. The product yield, taking into account losses, was 91%. The product was a white powder of the monobasic potassium salt of the HAEE peptide.
Исследование образцов однозамещенной калиевой соли пептида НАЕЕ, полученные из сульфата калия показало, что независимо от способа фильтрования и высушивания они имеют идентичные характеристики (Фиг. 1, 4, 6, 7, 10).The study of samples of monosubstituted potassium salt of the HAEE peptide obtained from potassium sulfate showed that, regardless of the method of filtering and drying, they have identical characteristics (Fig. 1, 4, 6, 7, 10).
Все полученные образцы НАЕЕ-K характеризуются аморфной формой на дифрактограмме (Фиг. 1). На ДСК кривой в отличие от НАЕЕ (Фиг. 3) HAEE-K характеризуется тремя эндотермическими максимумами: первый широкий эндотермический пик начинается от 60°С и имеет максимум при 102°С; второй начинается при 162°С с максимумом при 188°С, третий пик начинается при 198°С с максимумом при 228°С. (Фиг. 4).All obtained samples of HAEE-K are characterized by an amorphous form on the diffraction pattern (Fig. 1). On the DSC curve, in contrast to HAEE (Fig. 3), HAEE-K is characterized by three endothermic maxima: the first broad endothermic peak starts at 60°C and has a maximum at 102°C; the second begins at 162°C with a maximum at 188°C, the third peak begins at 198°C with a maximum at 228°C. (Fig. 4).
Методом ДСК-ТГА было показано, что калиевая соль пептида НАЕЕ может содержать остаточную влажность до 5% масс.It was shown by DSC-TGA that the potassium salt of the HAEE peptide can contain residual moisture up to 5 wt%.
Элементный анализ (EDXA) НАЕЕ-K показал содержание калия в образцах 7±0,5% масс.Elemental analysis (EDXA) HAE-K showed the content of potassium in the
В ИК-спектре с Фурье преобразованием НАЕЕ-K по сравнению с НАЕЕ наблюдается новый максимум при 1675 см-1 (плоские деформационные колебания -NН2). Максимумы при 1645 см-1 и 1530 см-1 смещены (плоские деформационные колебания -NН2 / С=О / [δ(N-H)]). В области 1300-700 см-1 наблюдаются новые слабые максимумы при 1315 и 1305 см-1 (колебания -СОO- карбоновых кислот), при 1275 см-1 (С-N) и при 700 см-1 (неплоские деформационные колебания -NH2). В ИК-спектре исчез максимум при 1205 см-1 (алифатические амины). Максимум при 1130 см-1 сместился в область 1145 см-1 (C-N вал.). Произошло сужение и увеличение интенсивности пика при 3275 см-1. (N-H группа). (Фиг. 6,7).In the IR spectrum with the Fourier transform of the HAEEE-K, compared with the HAEEE, a new maximum is observed at 1675 cm-one (plane deformation vibrations -NH2). Maximums at 1645 cm-one and 1530 cm-one offset (flat deformation vibrations -NH2 / C=O / [δ(N-H)]). In the area of 1300-700 cm-one new weak maxima are observed at 1315 and 1305 cm-one (vibrations -COO- carboxylic acids), at 1275 cm-one (С-N) and at 700 cm-one (out-of-plane bending vibrations -NH2). The maximum at 1205 cm disappeared in the IR spectrum-one (aliphatic amines). Maximum at 1130 cm-one moved to the area of 1145 cm-one (C-N shaft.). There was a narrowing and an increase in the intensity of the peak at 3275 cm-one. (N-H group). (Fig. 6.7).
Исходный образец НАЕЕ характеризовался ЯМР 1H[500.13Mhz; D2O; 298K; d, м.д.]: 1.27 (3H, d, j=7.13Hz, CH3(16)), 1.87 (5H, m, CH3(3), 1/2CH2(21),1/2CH2(33)), 1.99 (2H, sx, j=7.45Hz 1/2CH2(21),1/2CH2(33)), 2.28 (4H, m, 2CH2(22,34 )), 3.13, 3,03 (2H, m, CH2(8)), 4.19 (3H, m, 3CH (15,20,29)), 4.56 (1H, t, j=6.86Hz, CH(5)), 7.19 (1H, s, CH(10)), 8.50 (1H, s, CH(12)) (Фиг. 8,9).The original HAEE sample was characterized by NMRoneH[500.13Mhz; D2O; 298K; d, ppm]: 1.27 (3H, d, j=7.13Hz, CH3(16)), 1.87 (5H, m, CH3(3), 1/2CH2(21),1/2CH2(33)), 1.99 (2H, sx, j=7.45Hz 1/2CH2(21),1/2CH2(33)), 2.28 (4H, m, 2CH2(22.34 )), 3.13, 3.03 (2H, m, CH2(8)), 4.19 (3H, m, 3CH (15,20,29)), 4.56 (1H, t, j=6.86Hz, CH(5)), 7.19 (1H, s, CH(10)), 8.50 (1H, s, CH(12)) (Fig. 8.9).
В НАЕЕ-K положение химических сдвигов протонов в молекуле НАЕЕ изменялась и представлено на Фиг. 10, что свидетельствует о влиянии иона калия на молекулы НАЕЕ в растворе и, следовательно, о сохранении стерической структуры молекулы НАЕЕ как в твердом виде в виде калиевой соли, так и в растворе, что важно для фармакологических свойств. Смещение сигналов представлены в Таблица 1, значимыми были приняты сигналы отличающиеся на 0,02-0,03 м.д.In HAEE-K, the position of the chemical shifts of protons in the HAEE molecule was changed and is shown in FIG. 10, which indicates the effect of the potassium ion on the HAEE molecules in solution and, consequently, the preservation of the steric structure of the HAEE molecule both in solid form in the form of a potassium salt and in solution, which is important for pharmacological properties. Signal shifts are presented in Table 1; signals differing by 0.02-0.03 ppm were accepted as significant.
Смещение протонных сигналов от определенных групп в молекуле показывает их вклад в электростатическое взаимодействие с ионом калия при образовании соли; чем больше взаимодействие, тем большее смещение наблюдается в 1Н-ЯМР-спектре у определенных СН-групп молекулы. Поэтому наибольшее взаимодействие наблюдается у атомов 21, 22, 33, 34 (Glu), что свидетельствует об образовании соли по карбоксильной группе глутамата.The displacement of proton signals from certain groups in the molecule shows their contribution to the electrostatic interaction with the potassium ion in the formation of the salt; the greater the interaction, the greater the shift observed in the 1 H-NMR spectrum for certain CH groups of the molecule. Therefore, the greatest interaction is observed at
Пример 2. Получение двузамещенной калиевой соли пептида НАЕЕ (HAEE-K2). Example 2 Preparation of the disubstituted potassium salt of the HAEE peptide ( HAEE-K 2 ) .
К 100 мл водного раствора НАЕЕ с концентрацией 10-3 М добавляли 10 мл KOH c концентрацией 0,02 М и перемешивали в течение 20 мин при комнатной температуре. Полученный раствор разделили на две равные части по 55 мл.To 100 ml of an aqueous solution of HAEE with a concentration of 10 -3 M was added 10 ml of KOH with a concentration of 0.02 M and stirred for 20 min at room temperature. The resulting solution was divided into two equal parts of 55 ml.
Первую часть высушивали на ротационном испарителе под вакуумом 6 мм. рт. ст. при температуре 40°С. Получили белый порошок двузамещенной калиевой соли пептида НАЕЕ, выход продукта с учетом потерь составил 87%.The first part was dried on a rotary evaporator under a vacuum of 6 mm. rt. Art. at a temperature of 40°C. A white powder of the disubstituted potassium salt of the HAEE peptide was obtained; the yield of the product, taking into account losses, was 87%.
Вторую часть раствора объемом 55 мл разливали в пенициллиновые пузырьки объемом по 5 мл и замораживали в холодильной установке при -20°С и затем лиофильно высушивали в стандартном режиме при давлении 0,02 мбар в течение 28 ч. Выход продукта с учетом потерь составил 97%. Продукт представлял собой белый порошок двузамещенной калиевой соли пептида НАЕЕ.The second part of the solution with a volume of 55 ml was poured into penicillin vials with a volume of 5 ml and frozen in a refrigeration unit at -20°C and then lyophilized in the standard mode at a pressure of 0.02 mbar for 28 h. The product yield, taking into account losses, was 97% . The product was a white powder of the dipotassium salt of the HAEE peptide.
Исследование образцов двузамещенной калиевой соли пептида НАЕЕ показало, что независимо от способа высушивания они имеют идентичные характеристики (Фиг. 2, 5, 6, 7, 11).The study of samples of the disubstituted potassium salt of the HAEE peptide showed that, regardless of the method of drying, they have identical characteristics (Fig. 2, 5, 6, 7, 11).
Еще одним вариантом способа получения HAEE-K2 является использование гидрокарбоната калия.Another variant of the method for obtaining HAEE-K 2 is the use of potassium bicarbonate.
К 100 мл водного раствора НАЕЕ с концентрацией 10-3 М добавляли 10 мл KНСО3 c концентрацией 0,02 М и перемешивали в течение 30 мин при температуре 40°С вплоть до прекращения выделения пузырьков диоксида углерода. Полученный раствор разделили на две равные части по 55 мл.To 100 ml of an aqueous solution of HAE with a concentration of 10 -3 M was added 10 ml of KHCO 3 with a concentration of 0.02 M and stirred for 30 min at a temperature of 40°C until the evolution of carbon dioxide bubbles ceased. The resulting solution was divided into two equal parts of 55 ml.
Первую часть высушивали на ротационном испарителе под вакуумом 8 мм. рт. ст. при температуре 35°С. Получили белый порошок двузамещенной калиевой соли пептида НАЕЕ, выход продукта с учетом потерь составил 84%.The first part was dried on a rotary evaporator under a vacuum of 8 mm. rt. Art. at a temperature of 35°C. A white powder of the disubstituted potassium salt of the HAEE peptide was obtained; the yield of the product, taking into account losses, was 84%.
Вторую часть раствора объемом 55 мл разливали в пенициллиновые пузырьки объемом по 5 мл и замораживали в холодильной установке при -20°С и затем лиофильно высушивали в стандартном режиме при давлении 0,02 мбар в течение 34 ч. Выход продукта с учетом потерь составил 98%. Продукт представлял собой белый порошок двузамещенной калиевой соли пептида НАЕЕ.The second part of the solution with a volume of 55 ml was poured into penicillin vials with a volume of 5 ml and frozen in a refrigeration unit at -20°C and then lyophilized in the standard mode at a pressure of 0.02 mbar for 34 h. The product yield, taking into account losses, was 98% . The product was a white powder of the dipotassium salt of the HAEE peptide.
Исследование образцов двузамещенной калиевой соли пептида НАЕЕ показало, что независимо от способа высушивания они имеют идентичные характеристики (Фиг. 2, 5, 6, 7, 11).The study of samples of the disubstituted potassium salt of the HAEE peptide showed that, regardless of the method of drying, they have identical characteristics (Fig. 2, 5, 6, 7, 11).
Еще одним вариантом способа получения HAEE-K2 является использование карбоната калия.Another variant of the method for obtaining HAEE-K 2 is the use of potassium carbonate.
К 100 мл буферного раствора НАЕЕ с pH = 7 и с концентрацией 10-3 М добавляли 10 мл K2СО3 c концентрацией 0,01 М и перемешивали в течение 20 мин при температуре 50°С вплоть до прекращения выделения пузырьков диоксида углерода. Полученный раствор разделили на две равные части.10 ml of K 2 CO 3 with a concentration of 0.01 M was added to 100 ml of a HAEE buffer solution with pH = 7 and a concentration of 10 -3 M and stirred for 20 min at a temperature of 50°C until the evolution of carbon dioxide bubbles ceased. The resulting solution was divided into two equal parts.
Первую часть высушивали на ротационном испарителе под вакуумом 6 мм. рт. ст. при комнатной температуре. Получили белый порошок двузамещенной калиевой соли пептида НАЕЕ, выход продукта с учетом потерь составил 83%.The first part was dried on a rotary evaporator under a vacuum of 6 mm. rt. Art. at room temperature. A white powder of the disubstituted potassium salt of the HAEE peptide was obtained; the yield of the product, taking into account losses, was 83%.
Вторую часть раствора объемом 55 мл разливали в пенициллиновые пузырьки объемом по 5 мл и замораживали в холодильной установке при -20°С и затем лиофильно высушивали в стандартном режиме при давлении 0,02 мбар в течение 30 ч. Выход продукта с учетом потерь составил 97%. Продукт представлял собой белый порошок двузамещенной калиевой соли пептида НАЕЕ.The second part of the solution with a volume of 55 ml was poured into penicillin vials with a volume of 5 ml and frozen in a refrigeration unit at -20°C and then lyophilized in the standard mode at a pressure of 0.02 mbar for 30 h. The yield of the product, taking into account losses, was 97% . The product was a white powder of the dipotassium salt of the HAEE peptide.
Исследование образцов двузамещенной калиевой соли пептида НАЕЕ показало, что независимо от способа высушивания они имеют идентичные характеристики (Фиг. 2, 5, 6, 7, 11).The study of samples of the disubstituted potassium salt of the HAEE peptide showed that, regardless of the method of drying, they have identical characteristics (Fig. 2, 5, 6, 7, 11).
Еще одним вариантом способа получения HAEE-K2 является использование сульфата калия.Another option for the method of obtaining HAEE-K 2 is the use of potassium sulfate.
К 100 мл водного раствора НАЕЕ с концентрацией 10-3 М добавляли 10 мл K2SO4 c концентрацией 0,01 М и перемешивали в течение 5 мин при комнатной температуре. После чего добавляли к получившемуся раствору добавляли 5 мл раствора Ba(ОН)2 с концентрацией 0,01 М и перемешивали в течение 20 мин при температуре 35°С. Полученный раствор с осадком центрифугировали при 6000 об/мин в течение 15 мин и декантировали надосадочную жидкость, которую высушивали на ротационном испарителе под вакуумом 7 мм. рт. ст. при 30°С. Получили белый порошок двузамещенной калиевой соли пептида НАЕЕ, выход продукта с учетом потерь составил 86%.To 100 ml of an aqueous solution of HAE with a concentration of 10 -3 M was added 10 ml of K 2 SO 4 with a concentration of 0.01 M and stirred for 5 min at room temperature. Then added to the resulting solution was added 5 ml of a solution of Ba(OH) 2 with a concentration of 0.01 M and stirred for 20 min at a temperature of 35°C. The resulting solution with a precipitate was centrifuged at 6000 rpm for 15 min, and the supernatant liquid was decanted, which was dried on a rotary evaporator under a vacuum of 7 mm. rt. Art. at 30°C. A white powder of the disubstituted potassium salt of the HAEE peptide was obtained; the yield of the product, taking into account losses, was 86%.
В еще одном варианте осуществления изобретения к 100 мл водного раствора НАЕЕ с концентрацией 10-3 М добавляли 10 мл K2SO4 c концентрацией 0,01 М (или 5 мл КHSO4 с концентрацией 0,02 М) и перемешивали в течение 5 мин при комнатной температуре. После чего добавляли к получившемуся раствору добавляли 5 мл раствора Ba(ОН)2 с концентрацией 0,01 М и перемешивали в течение 30 мин при комнатной температуре. Полученный раствор с осадком фильтровали через бумажный фильтр под вакуумом. Профильтрованный раствора разливали в пенициллиновые пузырьки объемом по 2 мл и замораживали в холодильной установке при -20°С и затем лиофильно высушивали в стандартном режиме при давлении 0,02 мбар в течение 32 ч. Выход продукта с учетом потерь составил 91%. Продукт представлял собой белый порошок двузамещенной калиевой соли пептида НАЕЕ.In another embodiment of the invention, 10 ml of K 2 SO 4 with a concentration of 0.01 M (or 5 ml of KHSO 4 with a concentration of 0.02 M) were added to 100 ml of an aqueous solution of HAEE with a concentration of 10 -3 M and stirred for 5 min at room temperature. After that, 5 ml of a Ba(OH) 2 solution with a concentration of 0.01 M was added to the resulting solution and stirred for 30 min at room temperature. The resulting solution with the precipitate was filtered through a paper filter under vacuum. The filtered solution was poured into 2 ml penicillin vials and frozen in a refrigeration unit at -20°C and then lyophilized in the standard mode at a pressure of 0.02 mbar for 32 h. The product yield, taking into account losses, was 91%. The product was a white powder of the dipotassium salt of the HAEE peptide.
Исследование образцов двузамещенной калиевой соли пептида НАЕЕ, полученные из сульфата калия показало, что независимо от способа фильтрования и высушивания они имеют идентичные характеристики (Фиг. 2, 5, 6, 7, 11).The study of samples of the disubstituted potassium salt of the HAEE peptide obtained from potassium sulfate showed that, regardless of the method of filtration and drying, they have identical characteristics (Fig. 2, 5, 6, 7, 11).
Все полученные образцы НАЕЕ-K2 характеризуются аморфной формой на дифрактограмме (Фиг. 2). На ДСК кривой в отличие от НАЕЕ (Фиг. 3) HAEE-K2 характеризуется четырьмя эндотермическими пиками. Первый широкий пик имеет начало при 60°С с максимумом в области 105°С, второй слабовыраженный пик начинается от 155°С с максимумом при 163°С, третий пик начинается от 215°С с максимумом при 236°С и четвертый максимум плавления наблюдается при 242°С (Фиг. 5).All obtained samples of HAEE-K 2 are characterized by an amorphous form on the diffraction pattern (Fig. 2). On the DSC curve, in contrast to the HAEE (Fig. 3), HAEE-K 2 is characterized by four endothermic peaks. The first broad peak starts at 60°C with a maximum at 105°C, the second weak peak starts at 155°C with a maximum at 163°C, the third peak starts at 215°C with a maximum at 236°C, and the fourth melting maximum is observed. at 242°C (Fig. 5).
Методом ДСК-ТГА было показано, что двузамещенная калиевая соль пептида НАЕЕ может содержать остаточную влажность до 5% масс.It was shown by DSC-TGA that the disubstituted potassium salt of the HAEE peptide can contain residual moisture up to 5% wt.
Элементный анализ (EDXA) НАЕЕ-K2 показал содержание калия в образцах 13±1 % масс.Elemental analysis (EDXA) HAE-K 2 showed the content of potassium in the samples 13±1% wt.
ИК-спектр с Фурье преобразованием НАЕЕ-K2 по сравнению с НАЕЕ характеризуется смещением максимумов при 1530 см-1 в область 1645 см-1 (плоские деформационные колебания -NН2), наблюдаются изменения в интенсивности пиков в области 1180-1310 см-1 (С-N). (Фиг. 6,7).The IR spectrum with the Fourier transform of HAEE-K 2 in comparison with HAEE is characterized by a shift of the maxima at 1530 cm -1 to the region of 1645 cm -1 (plane deformation vibrations -NH 2 ), changes in the intensity of the peaks in the region of 1180-1310 cm -1 are observed (C-N). (Fig. 6.7).
В НАЕЕ-K2 положение химических сдвигов протонов в молекуле НАЕЕ изменялась и представлено на Фиг. 10, что свидетельствует о влиянии иона калия на молекулы НАЕЕ в растворе и, следовательно, о сохранении стерической структуры молекулы НАЕЕ как в твердом виде в виде калиевой соли, так и в растворе, что важно для фармакологических свойств. Смещение сигналов представлены в Таблице 1, значимыми были приняты сигналы отличающиеся на 0,02-0,03 м.д.In HAEE-K 2 the position of the chemical shifts of the protons in the HAEE molecule was changed and is shown in FIG. 10, which indicates the effect of the potassium ion on the HAEE molecules in solution and, consequently, the preservation of the steric structure of the HAEE molecule both in solid form in the form of a potassium salt and in solution, which is important for pharmacological properties. The signal shifts are presented in Table 1; signals differing by 0.02-0.03 ppm were accepted as significant.
Смещение протонных сигналов от определенных групп в молекуле показывает их вклад в электростатическое взаимодействие с ионом калия при образовании соли; чем больше взаимодействие, тем большее смещение наблюдается в 1Н-ЯМР-спектре у определенных СН-групп молекулы. Поэтому взаимодействие наблюдается у атомов 21, 22, 33, 34 (Glu), что свидетельствует об образовании соли по карбоксильной группе глутамина. В отличие от НАЕЕ-K в НАЕЕ-K2 во взаимодействие включается имидазольная группа гистидинового фрагмента, что видно по смещению сигналов у протонов 8, 10, 12 (His1).The displacement of proton signals from certain groups in the molecule shows their contribution to the electrostatic interaction with the potassium ion in the formation of the salt; the greater the interaction, the greater the shift observed in the 1 H-NMR spectrum for certain CH groups of the molecule. Therefore, the interaction is observed at
Пример 3. ВЭЖХ и масс-спектрометрия калиевых солей пептида НАЕЕ. Example 3 HPLC and mass spectrometry of potassium salts of the HAEE peptide.
Характеризация калиевых солей в водном растворе проводилась методом масс-спектрометрии высокого разрешения с использованием технологии ионного циклотронного резонанса с преобразованием Фурье путем измерения точной массы характерных молекулярных ионов как при положительной, так и при отрицательной модах ионизации. Для проведения измерений образцы калиевых солей пептида НАЕЕ в водном растворе c концентрацией 20 мкМ вносили в смесь воды и ацетонитрила в соотношении 1:1 с добавлением муравьиной кислоты (для достижения финальной концентрации 0,1%). Characterization of potassium salts in aqueous solution was carried out by high-resolution mass spectrometry using Fourier transform ion cyclotron resonance technology by measuring the exact mass of characteristic molecular ions in both positive and negative ionization modes. For measurements, samples of potassium salts of the HAEE peptide in an aqueous solution with a concentration of 20 μM were added to a mixture of water and acetonitrile in a ratio of 1:1 with the addition of formic acid (to achieve a final concentration of 0.1%).
Масс-спектрометрический анализ водного раствора калиевых солей, проведенный при положительной моде электроспрейного ионизационного источника, показал наличие молекулярного иона [HAEE+H] с моноизотопной массой 526,2304 m/z и молекулярного иона [HAEE+K] с моноизотопной массой 564,1858 m/z. При использовании отрицательной моды электроспрейного ионизационного источника для анализа калиевых солей пептида НАЕЕ в водном растворе были идентифицированы молекулярный ион [HAEE-H] с моноизотопной массой 524,2164 m/z и молекулярный ион [HAEE+K-2H] с моноизотопной массой 562,1746 m/z.Mass-spectrometric analysis of an aqueous solution of potassium salts, carried out in the positive mode of an electrospray ionization source, showed the presence of a molecular ion [HAEE+H] with a monoisotopic mass of 526.2304 m/z and a molecular ion [HAEE+K] with a monoisotopic mass of 564.1858 m /z. When using the negative mode of an electrospray ionization source for the analysis of potassium salts of the HAEE peptide in an aqueous solution, the molecular ion [HAEE-H] with a monoisotopic mass of 524.2164 m/z and the molecular ion [HAEE+K-2H] with a monoisotopic mass of 562.1746 m/z.
Сравнительный анализ калиевых солей пептида НАЕЕ и нативного пептида НАЕЕ методом ВЭЖХ-МС (2,5 нг/мл, 0,5% FA - муравьиная кислота, 50% МеОН (1:1)) показал, что в водных растворах in vitro при физиологических значениях pH хроматографическая подвижность НАЕЕ-K и НАЕЕ-K2 практически идентична таковой для HAЕЕ в тех же хроматографических условиях. Время выхода хроматографического пика с колонки для НАЕЕ-K составляло 2,86 мин, для НАЕЕ-K2 - 2,87 мин, для НАЕЕ - 2,85 мин. С учетом известных из литературы данных молекулярного моделирования (Barykin E.P., Garifulina A.I., Tolstova A.P. et al. (2020). Tetrapeptide Ac-HAEE-NH2 Protects α4β2 nAChR from Inhibition by Aβ. International journal of molecular sciences, 21(17), 6272, doi: 10.3390/ijms21176272), вышеприведенные результаты указывают на то, что пространственные структуры основной пептидной цепи калиевой соли пептида HAEE и пептида HAEE в условиях in vitro идентичны и характеризуется «развернутой» конформацией.Comparative analysis of potassium salts of the HAEE peptide and native HAEE peptide by HPLC-MS (2.5 ng/ml, 0.5% FA - formic acid, 50% MeOH (1:1)) showed that in aqueous solutions in vitro at physiological pH values, the chromatographic mobility of HAEE-K and HAEE-K 2 is almost identical to that of HAEE under the same chromatographic conditions. The exit time of the chromatographic peak from the column for HAEEE-K was 2.86 minutes, for HAEEE-K 2 - 2.87 minutes, for HAEEE - 2.85 minutes. Taking into account the molecular modeling data known from the literature (Barykin EP, Garifulina AI, Tolstova AP et al. (2020). Tetrapeptide Ac-HAEE-NH 2 Protects α4β2 nAChR from Inhibition by Aβ. International journal of molecular sciences, 21(17), 6272, doi: 10.3390/ijms21176272), the above results indicate that the spatial structures of the main peptide chain of the potassium salt of the HAEE peptide and the HAEE peptide are identical under in vitro conditions and are characterized by an "unfolded" conformation.
После введения калиевых солей пептида НАЕЕ внутривенно в организм здоровых мышей (n = 5) с последующим забором крови у животных и экстракцией из забранных образцов крови фракции, содержащей HAEE, было найдено, что время выхода HAEE на хроматограммах проб, приготовленных из образцов крови животных, которым вводили НАЕЕ-K или НАЕЕ-K2, не изменялось и составляло 2,86 мин и 2,87 мин, соответственно. Однако, неожиданно было обнаружено, что время выхода основного пика HAEE на хроматограмме пробы, приготовленной из образцов крови животных, которым вводили пептид HAEE, стало 1,27 мин и только около 8% HAEE выходило в хроматографическом пике на времени 2,85 мин.After the introduction of potassium salts of the HAEE peptide intravenously into the body of healthy mice (n = 5), followed by blood sampling from animals and extraction of the fraction containing HAEE from the taken blood samples, it was found that the release time of HAEE on the chromatograms of samples prepared from animal blood samples, which were administered HAEE-K or HAEE-K 2 did not change and amounted to 2.86 min and 2.87 min, respectively. However, unexpectedly, it was found that the time of release of the main peak of HAEE in the chromatogram of a sample prepared from blood samples of animals injected with the HAEE peptide became 1.27 minutes and only about 8% of HAEE was released in the chromatographic peak at a time of 2.85 minutes.
Полученные данные свидетельствует о том, что в образцах крови конформация пептида HAEE резко отличается от конформации, наблюдаемой при тех же условиях для калиевой соли. Лишь 8% НАЕЕ находится в «развернутой» конформации после его взаимодействия с элементами плазмы крови. Таким образом, в образцах крови калиевая соль пептида HAEE сохраняет свою конформацию (предположительно, «развернутую») неизменной, в то время как HAEE приобретает иную конформацию, которая характеризуется гораздо более компактной структурой, предположительно, «спиральной». Это означает, что молекула НАЕЕ в форме калиевой соли устойчива к изменению конформации в плазме крови. Согласно настоящему изобретению, для достижения терапевтического эффекта от калиевых солей пептида HAEE, так и от HAEE требуется их введение в организм и присутствие в плазме крови, поэтому принципиальные различия в пространственной структуре этих молекул в плазме крови, исходя из общих представлений биохимии и физиологии, свидетельствуют о различном молекулярном механизме действия калиевой соли пептида НАЕЕ и нативного HAEE, что исключает их биоэквивалентность.The data obtained indicate that the conformation of the HAEE peptide in blood samples differs sharply from the conformation observed under the same conditions for the potassium salt. Only 8% of HAEE is in the "unfolded" conformation after its interaction with blood plasma elements. Thus, in blood samples, the potassium salt of the HAEE peptide retains its conformation (presumably "unfolded") unchanged, while HAEE acquires a different conformation, which is characterized by a much more compact structure, presumably "helical". This means that the HAEE molecule in the form of a potassium salt is resistant to changes in conformation in blood plasma. According to the present invention, in order to achieve a therapeutic effect, both the potassium salts of the HAEE peptide and HAEE require their introduction into the body and their presence in the blood plasma, therefore, the fundamental differences in the spatial structure of these molecules in the blood plasma, based on the general concepts of biochemistry and physiology, indicate about the different molecular mechanism of action of the potassium salt of the HAEE peptide and native HAEE, which excludes their bioequivalence.
Пример 4. Стабильность калиевых солей пептида НАЕЕ. Example 4 Stability of the potassium salts of the HAEE peptide.
Была определена стабильность калиевых солей пептида НАЕЕ в тесте ускоренного хранения в течение 6 месяцев, что соответствует 2 годам хранения в обычных условиях (Таблица 2). Калиевые соли пептида НАЕЕ сохранили свой цвет, консистенцию, не набирали воды (масса образца не увеличивалась в пределах 1-2%) и не теряли активное вещество. Образец НАЕЕ с течением времени набирал воду (до 7% масс.) и по данным ВЭЖХ деградировал до 67,4% активного вещества за 6 мес. Таким образом, стабильность калиевых солей пептида НАЕЕ оказалась значительно выше по сравнению с НАЕЕ.The stability of the potassium salts of the HAEE peptide was determined in the accelerated storage test for 6 months, which corresponds to 2 years of storage under normal conditions (Table 2). The potassium salts of the HAEE peptide retained their color and consistency, did not absorb water (the sample weight did not increase within 1–2%), and did not lose the active substance. The HAEE sample accumulated water over time (up to 7% wt.) and, according to HPLC data, degraded to 67.4% active substance in 6 months. Thus, the stability of the potassium salts of the HAEE peptide turned out to be significantly higher than that of the HAEE.
Пример 5. Фармацевтические композиции на основе калиевых солей пептида НАЕЕ. Example 5Pharmaceutical compositions based on potassium salts of the HAEEE peptide.
Фармацевтические композиции на основе калиевых солей пептида HAEE могут содержать активное вещество в эффективном количестве (Таблица 3). Указанные композиции получены отдельно для каждой из однозамещенной и двузамещенной калиевых солей пептида НАЕЕ. Состав дозы рассчитывается индивидуально и может варьироваться от 0,1 мг до 100 мг на человека в сутки, более предпочтительно от 1 до 50 мг.Pharmaceutical compositions based on potassium salts of the HAEE peptide may contain the active substance in an effective amount (Table 3). These compositions were prepared separately for each of the monosubstituted and disubstituted potassium salts of the HAEE peptide. The composition of the dose is calculated individually and can vary from 0.1 mg to 100 mg per person per day, more preferably from 1 to 50 mg.
Составы фармацевтических композиций представлены в Таблице 3. Пересчет выполнен на дозировку активного вещества. Возможны и другие соотношения активного вещества в фармацевтической композиции в диапазоне от 0,1 до 100 мг. Масса таблеток варьируется от 100 до 400 мг, таблетки могут быть покрыты оболочкой.The compositions of the pharmaceutical compositions are presented in Table 3. The conversion is made for the dosage of the active substance. Other ratios of the active substance in the pharmaceutical composition are also possible in the range from 0.1 to 100 mg. The weight of tablets varies from 100 to 400 mg, tablets can be coated.
Пример 6. Влияние калиевых солей пептида HAEE на поведенческие функции и степень тяжести церебрального амилоидоза у экспериментальных животных. Example 6. Effect of potassium salts of the HAEE peptide on behavioral functions and severity of cerebral amyloidosis in experimental animals.
Для моделирования нейродегенеративного заболевания была выбрана модель болезни Альцгеймера, являющейся основным по распространенности нейродегенеративным заболеванием у людей пожилого возраста.To model a neurodegenerative disease, a model of Alzheimer's disease, which is the most common neurodegenerative disease in the elderly, was chosen.
Для проведения экспериментов были использованы самцы трансгенных мышей линии APPswe/PSEN1dE9. Мыши данной линии также известны под названием APP/PS1. У мышей APP/PS1, начиная с 4-6-месячного возраста, проявляются характерные когнитивные признаки патологии, подобной болезни Альцгеймера, и имеется значительное количество конгофильных амилоидных бляшек в специфических отделах мозга, включая гиппокамп и кортекс (Borchelt D.R., Ratovitski T., Van Lare J., et al. (1997). Accelerated amyloid deposition in the brains of transgenic mice coexpressing mutant presenilin 1 and amyloid precursor proteins. Neuron, 19(4), 939-945, doi: 10.1016/S0896-6273(00)80974-5).Male transgenic mice of the APPswe/PSEN1dE9 line were used for the experiments. Mice of this strain are also known as APP/PS1. APP/PS1 mice, starting at 4-6 months of age, show characteristic cognitive signs of a pathology similar to Alzheimer's disease and have a significant amount of congophilic amyloid plaques in specific regions of the brain, including the hippocampus and cortex (Borchelt D.R., Ratovitski T., Van Lare J., et al (1997) Accelerated amyloid deposition in the brains of transgenic mice coexpressing
Для тестирования были использованы 8-месячные животные, сгруппированные в следующие экспериментальные группы (n = 12 в каждой группе):For testing, 8-month-old animals were used, grouped into the following experimental groups (n = 12 in each group):
1. контроль 1. Мыши дикого типа, которым внутривенно вводили физиологический раствор;1.
2. контроль 2. Трансгенные мыши APP/PS1, которым внутривенно вводили физиологический раствор;2.
3. трансгенные мыши APP/PS1, которым внутривенно вводили HAEE;3. APP/PS1 transgenic mice injected with HAEE intravenously;
4. трансгенные мыши APP/PS1, которым внутривенно вводили HAEE-K;4. APP/PS1 transgenic mice injected with HAEE-K intravenously;
5. трансгенные мыши APP/PS1, которым внутривенно вводили HAEE-K2.5. APP/PS1 transgenic mice injected with HAEE-K 2 intravenously.
Препараты HAEE и калиевые соли пептида НАЕЕ вводили в ретроорбитальное венозное сплетение в соответствии с известной процедурой (Yardeni T., Eckhaus M., Morris H.D. et al. (2011). Retro-orbital injections in mice. Lab animal, 40(5), 155-160, doi: 10.1038/laban0511-155). Инъекции в дозе 0,05 мг/кг проводили ежемесячно, в возрасте от 2 до 7 месяцев (включительно), всего было сделано 6 инъекций препаратами HAEE и калиевых солей пептида НАЕЕ.HAEE preparations and potassium salts of the HAEE peptide were injected into the retroorbital venous plexus according to a known procedure (Yardeni T., Eckhaus M., Morris H.D. et al. (2011). Retro-orbital injections in mice. Lab animal, 40(5), 155-160, doi: 10.1038/laban0511-155). Injections at a dose of 0.05 mg/kg were performed monthly, at the age of 2 to 7 months (inclusive), a total of 6 injections of HAEE and potassium salts of the HAEE peptide were made.
В возрасте 8 месяцев проводили тестирование поведенческих функций, затем животные подвергались эвтаназии с последующим забором мозга и гистохимическим анализом числа конгофильных бляшек в областях СА1, СА2, СА3 и зубчатой извилине гиппокампа согласно известной процедуре (Kozin S.A., Barykin E.P., Telegin G.B., et al. Intravenously Injected Amyloid-β Peptide With Isomerized Asp7 and Phosphorylated Ser8 Residues Inhibits Cerebral β-Amyloidosis in AβPP/PS1 Transgenic Mice Model of Alzheimer's Disease. Frontiers in neuroscience, 2018, 12, 518-518, doi: 10.3389/fnins.2018.00518).At the age of 8 months, behavioral functions were tested, then the animals were euthanized with subsequent brain sampling and histochemical analysis of the number of congophilic plaques in the areas of CA1, CA2, CA3 and the dentate gyrus of the hippocampus according to a known procedure (Kozin S.A., Barykin E.P., Telegin G.B., et al. Intravenously Injected Amyloid-β Peptide With Isomerized Asp7 and Phosphorylated Ser8 Residues Inhibits Cerebral β-Amyloidosis in AβPP/PS1 Transgenic Mice Model of Alzheimer's Disease Frontiers in neuroscience, 2018, 12, 518-518, doi: 10.3389/fnins.2018.00518).
6.1. Анализ улучшения поведенческих функций у 8-месячных самцов трансгенных мышей APP/PS1 под действием HAEE и калиевых солей пептида НАЕЕ был проведен с помощью теста «Закапывание шариков». В качестве контроля использовались трансгенные мыши APP/PS1 и мыши дикого типа. Для проведения теста мышей помещали в клетки со свежим подстилом с размещенными на нем восемнадцатью шариками, расположенными в виде матрицы 3 х 6. Мышей оставляли в клетке на 30 минут, после чего определяли количество более чем на 2/3 закопанных шариков (КЗШ) в процентах от общего количества шариков. Поведение закапывания является признаком обсессивно-компульсивного поведения. Из-за повторяющегося и персеверативного характера закапывания такое поведение может представлять нейропсихиатрические симптомы, такие как персеверативное поведение и/или стереотипное поведение. Оба являются нейропсихиатрическими симптомами, обычно присутствующими у пациентов с болезнью Альцгеймера и другими видами деменции. 6.1. An analysis of the improvement in behavioral functions in 8-month-old male APP/PS1 transgenic mice under the influence of HAEE and potassium salts of the HAEE peptide was carried out using the "Ball Burial" test. APP/PS1 transgenic mice and wild-type mice were used as controls. For the test, mice were placed in cages with fresh bedding with eighteen balls placed on it, arranged in a 3 x 6 matrix. of the total number of balls. Burrowing behavior is a sign of obsessive-compulsive behavior. Due to the repetitive and perseverative nature of instillation, such behavior may present with neuropsychiatric symptoms such as perseverative behavior and/or stereotyped behavior. Both are neuropsychiatric symptoms commonly present in patients with Alzheimer's disease and other types of dementia.
По результатам тестирования, уровень поведения контрольной группы мышей дикого типа характеризовался значением КЗШ = 50,6±13,3 (%). Это значение рассматривается в качестве референсного. У контрольной группы трансгенных мышей APP/PS1 значение КЗШ = 12,6±4,2 (%), что указывает на сильное ухудшение поведенческих рефлексов мышей APP/PS1 по сравнению с животными дикого типа и отражает инвалидизирующее влияние оверпродукции человеческого бета-амилоида на процессы нервной деятельности. В группе мышей, получавших HAEE, значения КЗШ составило 20,6±7,3 (%). Для групп мышей, получавших НАЕЕ-K и НАЕЕ-K2, значение КЗШ составило 44,3 ±9,9 (%) и 49,2±10,2 (%) соответственно (Таблица 4).According to the test results, the level of behavior of the control group of wild-type mice was characterized by the value of KZSh = 50.6±13.3 (%). This value is considered as a reference. In the control group of transgenic APP/PS1 mice, the value of KZS = 12.6 ± 4.2 (%), which indicates a strong deterioration in the behavioral reflexes of APP/PS1 mice compared to wild-type animals and reflects the disabling effect of overproduction of human beta-amyloid on the processes nervous activity. In the group of mice treated with HAEE, the KZS values were 20.6 ± 7.3 (%). For the groups of mice treated with HAEE-K and HAEE-K 2 , the KZS value was 44.3 ± 9.9 (%) and 49.2 ± 10.2 (%), respectively (Table 4).
Эти данные свидетельствуют о том, что использование калиевых солей пептида HAEE существенно улучшает поведенческие рефлексы трансгенных мышей APP/PS1, а эффект от этого использования значительно превышает таковой, наблюдаемый для HAEE.These data indicate that the use of potassium salts of the HAEE peptide significantly improves the behavioral reflexes of APP/PS1 transgenic mice, and the effect of this use is much higher than that observed for HAEE.
6.2. Гистохимический анализ конгофильных амилоидных бляшек в областях СА1, СА2, СА3 и зубчатой извилине гиппокампа был проведен согласно ранее описанным процедурам (Kozin S.A., Barykin E.P., Telegin G.B., et al. Intravenously Injected Amyloid-β Peptide With Isomerized Asp7 and Phosphorylated Ser8 Residues Inhibits Cerebral β-Amyloidosis in AβPP/PS1 Transgenic Mice Model of Alzheimer's Disease. Frontiers in neuroscience, 2018, 12, 518-518, doi: 10.3389/fnins.2018.00518). Мозг мышей извлекали и фиксировали в 10% формалине. Процесс заливки образца в парафин проводили следующим образом: заливали 75% этанолом и оставляли на ночь, далее сменяли на 96% этанол и выдерживали 5 мин, 96% этанол - 10 мин, 100% этанол - 10 мин (две замены), этанол-хлороформ (1:1) - 30 мин, и оставляли в чистом хлороформе на ночь. Заливку парафином проводили при 60°С в течение 3 ч (три смены). Заливку тканей в парафиновые блоки осуществляли на приборе Leica EG1160. Серийные срезы головного мозга (8 мкм) вырезали с помощью микротома Leica RM2265 и помещали на предметные стекла. Для депарафинизации, гидратации и окрашивания срезов проводили следующие этапы: предметные стекла последовательно помещали в ксилол три смены (по 10 минут), 96% этанол - 5 мин, 90% этанол - 2 мин, 75% этанол - 2 мин, вода - 5 мин (три смены), раствор конго красного - 5 мин, далее добавлялся раствор гидроксида калия и вода. Для монтирования использовали среду ImMu-Mount (Thermo Scientific). Срезы, охватывающие область мозга от 0,48 до 1,92 мм относительно средней линии в латеральных стереотаксических координатах (Franklin K., Paxinos, G. (2008). The Mouse Brain in Stereotaxic Coordinates. New York, NY: Academic Press), использовали для количественного определения конгофильных амилоидных бляшек в гиппокампе. Анализировали каждый 15-й срез, что давало 10 срезов на животное. Амилоидные бляшки идентифицировали окрашиванием конго красным и подсчитывали вручную. Для каждой группы мышей рассчитывали средние значения и стандартное отклонение количества бляшек на 1 срез. Для проверки нормальности распределения использовали критерий Шапиро-Уилка. Для попарного сравнения исследуемых групп использовали критерий Манна-Уитни. Применяемый уровень значимости составлял 99,9% (P <0,001). 6.2. Histochemical analysis of congophilic amyloid plaques in regions CA1, CA2, CA3 and the dentate gyrus of the hippocampus was performed according to previously described procedures (Kozin SA, Barykin EP, Telegin GB, et al. Intravenously Injected Amyloid-β Peptide With Isomerized Asp7 and Phosphorylated Ser8 Residues Inhibits Cerebral β-Amyloidosis in AβPP/PS1 Transgenic Mice Model of Alzheimer's Disease Frontiers in neuroscience, 2018, 12, 518-518, doi: 10.3389/fnins.2018.00518). The brains of mice were removed and fixed in 10% formalin. The process of embedding the sample in paraffin was carried out as follows: immersed in 75% ethanol and left overnight, then changed to 96% ethanol and kept for 5 min, 96% ethanol - 10 min, 100% ethanol - 10 min (two replacements), ethanol-chloroform (1:1) - 30 min, and left in pure chloroform overnight. Paraffin embedding was carried out at 60°С for 3 h (three shifts). Tissues were embedded in paraffin blocks using a Leica EG1160 device. Serial sections of the brain (8 μm) were cut using a Leica RM2265 microtome and placed on glass slides. For deparaffinization, hydration and staining of sections, the following steps were performed: slides were sequentially placed in xylene for three shifts (10 minutes each), 96% ethanol - 5 min, 90% ethanol - 2 min, 75% ethanol - 2 min, water - 5 min (three shifts), Congo red solution - 5 min, then potassium hydroxide solution and water were added. The ImMu-Mount medium (Thermo Scientific) was used for mounting. Sections covering the brain area from 0.48 to 1.92 mm relative to the midline in lateral stereotaxic coordinates (Franklin K., Paxinos, G. (2008). The Mouse Brain in Stereotaxic Coordinates. New York, NY: Academic Press), used to quantify congophilic amyloid plaques in the hippocampus. Every 15th section was analyzed, resulting in 10 sections per animal. Amyloid plaques were identified by Congo red staining and manually counted. For each group of mice, the mean values and standard deviation of the number of plaques per 1 section were calculated. The Shapiro-Wilk test was used to check the normality of the distribution. For pairwise comparison of the studied groups, the Mann-Whitney test was used. The applied significance level was 99.9% (P<0.001).
У контрольной группы мышей дикого типа (группа 1) никаких амилоидных бляшек обнаружено не было (Таблица 4). Конгофильные амилоидные бляшки, визуализированные в областях СА1, СА2, СА3 и зубчатой извилине гиппокампа головного мозга трансгенных животных были сходны по локализации и распределению размеров в паренхиме головного мозга. Однако, количественная оценка амилоидных бляшек выявила существенные различия между группами. В контрольной группе 2 (трансгенные мыши APP/PS1) среднее число бляшек в областях на один срез мозга (ЧБ) составляло ЧБ = 31,7 ± 4,9. В группе 3, в которой трангсенным мышам APP/PS1 вводили HAEE, значение ЧБ оказалось равным 24,7 ± 3,4. В группе 4, в которой трансгенным мышам APP/PS1 вводили HAEE-K, значение ЧБ составило 9,2 ± 3,1. В группе 5, в которой трансгенным мышам APP/PS1 вводили HAEE-K2, значение ЧБ оказалось равным 8,7 ± 2,8. Таким образом, результаты гистохимического анализа показали, что внутривенные инъекции калиевых солей пептида НАЕЕ приводили к почти 4-кратному уменьшению амилоидной нагрузки в гиппокампе трансгенных мышей APP/PS1, и по этому показателю эффективность калиевых солей пептида НАЕЕ примерно в три раза выше таковой, выявленной для HAEE.In the control group of wild-type mice (group 1), no amyloid plaques were found (Table 4). Congophilic amyloid plaques visualized in the areas of CA1, CA2, CA3 and the dentate gyrus of the brain hippocampus of transgenic animals were similar in localization and size distribution in the brain parenchyma. However, amyloid plaque quantification revealed significant differences between groups. In control group 2 (APP/PS1 transgenic mice), the mean number of plaques in areas per brain slice (BW) was BW = 31.7 ± 4.9. In
Пример 7. Специфическое связывание калиевых солей пептида HAEE с человеческим бета-амилоидом (Aβ42). Example 7 Specific binding of potassium salts of the HAEE peptide to human beta-amyloid (Aβ42).
Дополнительно была проведена оценка связывания калиевых солей пептида HAEE с бета-амилоидом как одного из механизмов действия данной соли при нейродегенеративных поражениях, связанных с бета-амилоидом. Образование соли между находящимся в растворе аналитом (калиевая соль пептида HAEE или нативный HAEE) и иммобилизованным 42-членным человеческим бета-амилоидом (лигандом) было исследовано с помощью БППР. По результатам таких экспериментов рассчитывали кинетические параметры взаимодействий и значение константы диссоциации (KD) взаимодействия. Если значение KD ≤ 10-4 М, то взаимодействие между калиевой солью пептида HAEE и бета-амилоидом является биологически значимым.Additionally, the binding of potassium salts of the HAEE peptide to beta-amyloid was evaluated as one of the mechanisms of action of this salt in neurodegenerative lesions associated with beta-amyloid. Salt formation between the analyte in solution (the potassium salt of the HAEE peptide or native HAEE) and the immobilized 42-mer human beta-amyloid (ligand) was investigated using BPPR. Based on the results of such experiments, the kinetic parameters of the interactions and the value of the dissociation constant (K D ) of the interaction were calculated. If the value of K D ≤ 10 -4 M, then the interaction between the potassium salt of the HAEE peptide and beta-amyloid is biologically significant.
Взаимодействий между HAEE и лигандом обнаружено не было. Напротив, при введении калиевых солей пептида HAEE было обнаружено их взаимодействие с иммобилизованным Aβ42 при его различных концентрациях 150, 300, 500, 1000, 1500 мкМ. На основании полученных данных были рассчитаны кинетические характеристики взаимодействия калиевых солей пептида НАЕЕ и иммобилизованного человеческого бета-амилоида, которые оказались равны kon = (1,43±0,06) × 103 M-1s-1; koff = (5,92±0,06) × 10-3 s-1; KD = (4,14±0,30) × 10-6 М для НАЕЕ-K и значения kon = (1,36±0,06) × 103 M-1s-1; koff = (5,84±0,06) × 10-3 s-1; KD = (4,29±0,3) × 10-6 для НАЕЕ-K2.No interactions between HAEE and the ligand were found. On the contrary, when potassium salts of the HAEE peptide were introduced, their interaction with immobilized Aβ42 was found at various concentrations of 150, 300, 500, 1000, and 1500 μM. Based on the data obtained, the kinetic characteristics of the interaction of potassium salts of the HAEE peptide and immobilized human beta-amyloid were calculated, which turned out to be equal to k on = (1.43±0.06) × 10 3 M -1 s -1 ; k off \u003d (5.92 ± 0.06) × 10 -3 s -1 ; K D = (4.14±0.30) × 10 -6 M for HAEEE-K and k on values = (1.36 ± 0.06) × 10 3 M -1 s -1 ; k off \u003d (5.84 ± 0.06) × 10 -3 s -1 ; K D = (4.29±0.3) × 10 -6 for HAE-K 2 .
Таким образом, на основании вышеприведенных результатов доказано образование стабильных межмолекулярных комплексов между 42-членным человеческим бета-амилоидом (Aβ42) и калиевыми солями пептида HAEE. В отличие от калиевых солей пептида HAEE, нативный пептид HAEE в идентичных экспериментальных условиях не взаимодействует с Aβ42.Thus, based on the above results, the formation of stable intermolecular complexes between the 42-mer human beta-amyloid (Aβ42) and the potassium salts of the HAEE peptide was proven. Unlike the potassium salts of the HAEE peptide, the native HAEE peptide does not interact with Aβ42 under identical experimental conditions.
Полученные в данном Примере настоящего изобретения результаты указывают на отсутствие способности HAEE связываться с Aβ42. Напротив, калиевые соли пептида HAEE способны связываться с Aβ42. Несмотря на то, что и HAEE и калиевые соли пептида HAEE при введении в кровеносную систему трансгенных мышей APP/PS1 улучшают когнитивные функции и снижают количество амилоидных бляшек у экспериментальных животных (Примеры 6.1 и 6.2 настоящего изобретения), полученные результаты свидетельствует о различных молекулярных механизмах терапевтического воздействия HAEE и калиевых солей пептида HAEE, что, в свою очередь, исключает биоэквивалентность HAEE и калиевых солей пептида HAEE при их использовании для лечения нейродегенеративных заболеваний. Поэтому можно заключить, что НАЕЕ и калиевые соли пептида HAEE небиоэквивалентны между собой.The results obtained in this Example of the present invention indicate the absence of the ability of HAEE to contact Aβ42. In contrast, the potassium salts of the HAEE peptide are able to bind to Aβ42. Although both HAEE and potassium salts of the HAEE peptide, when administered to the circulatory system of APP/PS1 transgenic mice, improve cognitive function and reduce the number of amyloid plaques in experimental animals (Examples 6.1 and 6.2 of the present invention), the results obtained indicate different molecular mechanisms of therapeutic exposure to HAEE and potassium salts of the HAEE peptide, which, in turn, excludes the bioequivalence of HAEE and potassium salts of the HAEE peptide when used for the treatment of neurodegenerative diseases. Therefore, it can be concluded that HAEEE and potassium salts of the HAEE peptide are not bioequivalent to each other.
Δ = 0.01/0.013.02/3.12
Δ = 0.01/0.01
Δ = 0.15/0.192.88/2.94
Δ = 0.15/0.19
Δ = 0.027.17
Δ = 0.02
Δ = 0.356.84
Δ = 0.35
Δ = 0.038.47
Δ = 0.03
Δ = 0.897.61
Δ = 0.89
Δ = 0.102.18
Δ = 0.10
Δ = 0.122.16
Δ = 0.12
Δ = 0.021.25
Δ = 0.02
Δ = 0.061.21
Δ = 0.06
Δ = 0.014.18
Δ = 0.01
Δ = 0.024.17
Δ = 0.02
Δ = 0.031.96
Δ = 0.03
Δ = 0.051.93
Δ = 0.05
Δ = 0.001.87
Δ = 0.00
Δ = 0.021.85
Δ = 0.02
повидон К 17 - 0,1 мгmannitol - 0.1 mg
povidone K 17 - 0.1 mg
повидон К 17 - 1 мгmannitol -1 mg
povidone K 17 - 1 mg
повидон К 17 - 17 мгmannitol -10 mg
povidone K 17 - 17
повидон К 17 - 104 мгmannitol -100 mg
povidone K 17 - 104
вода до 100%a set of salts to maintain an osmotic pressure of 290-310 mOsm/l,
water up to 100%
0,1 М раствор натрия гидроксида - до pH 5,0 - 7,5
вода - до 100%0.9% - sodium chloride
0.1 M sodium hydroxide solution - up to pH 5.0 - 7.5
water - up to 100%
0,1 М раствор хлористоводородной кислоты -до pH 5,0-7,5
вода - до 100%0.9% - sodium chloride
0.1 M hydrochloric acid solution - up to pH 5.0-7.5
water - up to 100%
регулятор pH до 5,5-7
сахароза - до 5%,
гистидин, полоксамер 407 - до 1%
вода - до 100%0.9% - sodium chloride,
pH regulator up to 5.5-7
sucrose - up to 5%,
histidine, poloxamer 407 - up to 1%
water - up to 100%
регулятор pH до 5,5-7,5
вода - до 100%0.9% - sodium chloride,
pH regulator up to 5.5-7.5
water - up to 100%
трометамол - 12 мг;
динатрия эдетат - 1 мг
вода - до 100%mannitol - 0.5 mg;
trometamol - 12 mg;
disodium edetate - 1 mg
water - up to 100%
Claims (40)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
PCT/RU2023/000207 WO2024014980A1 (en) | 2022-07-15 | 2023-07-12 | Potassium salt of haee peptide for treating neurodegenerative diseases |
Publications (1)
Publication Number | Publication Date |
---|---|
RU2784425C1 true RU2784425C1 (en) | 2022-11-24 |
Family
ID=
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2012056157A1 (en) * | 2010-10-27 | 2012-05-03 | Kimonella Ventures Ltd | Peptide compound useful for inhibiting amyloid plaque formation |
RU2709539C1 (en) * | 2019-08-15 | 2019-12-18 | Акционерное общество "Опытно-Экспериментальный завод "ВладМиВа" | Pharmaceutical composition based on haee peptide for treating neurodegenerative diseases |
RU2767030C1 (en) * | 2021-05-20 | 2022-03-16 | Акционерное общество "Опытно-Экспериментальный завод "ВладМиВа" | Ac-his-ala-glu-glu-nh2 peptide production method |
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2012056157A1 (en) * | 2010-10-27 | 2012-05-03 | Kimonella Ventures Ltd | Peptide compound useful for inhibiting amyloid plaque formation |
RU2709539C1 (en) * | 2019-08-15 | 2019-12-18 | Акционерное общество "Опытно-Экспериментальный завод "ВладМиВа" | Pharmaceutical composition based on haee peptide for treating neurodegenerative diseases |
RU2767030C1 (en) * | 2021-05-20 | 2022-03-16 | Акционерное общество "Опытно-Экспериментальный завод "ВладМиВа" | Ac-his-ala-glu-glu-nh2 peptide production method |
Non-Patent Citations (1)
Title |
---|
Evgeny P. Barykin et al "Tetrapeptide Ac-HAEE-NH2 Protects α4β2 nAChR from Inhibition by Aβ", Int J Mol Sci. 2020 Sep; 21(17): 6272. * |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP1623719B1 (en) | Treatment of alzheimer's disease and cerebral amyloid angiopathy | |
TWI613213B (en) | Exendin-4 derivatives as dual glp1/glucagon agonists | |
US20140296164A1 (en) | Compositions and methods of use for cell targeted inhibitors of the Cystic Fibrosis transmembrane regulator associated ligand | |
JP5893614B2 (en) | Compounds and methods for the treatment of Alzheimer's disease and familial dementia | |
WO2011094671A2 (en) | N-terminally conjugated polypeptides for targeted therapy and diagnosis | |
US10800812B2 (en) | Compstatin analogs with increased solubility and improved pharmacokinetic properties | |
JP4079775B2 (en) | Soluble cyclic analog of β-amyloid peptide | |
RU2784425C1 (en) | Potassium salt of haee peptide for the treatment of neurodegenerative diseases | |
RU2784326C1 (en) | Sodium salt of haee peptide for the treatment of neurodegenerative diseases | |
RU2784249C1 (en) | Ammonium salt of haee peptide for the treatment of neurodegenerative diseases | |
JP2023552824A (en) | Peptide therapeutics for treating Alzheimer's disease and related conditions | |
JP5801206B2 (en) | Compounds and methods for the treatment of Alzheimer's disease | |
RU2784732C1 (en) | Haee peptide copper complex for the treatment of neurodegenerative diseases | |
RU2784319C1 (en) | Haee peptide zinc complex for the treatment of neurodegenerative diseases | |
RU2785354C1 (en) | Peptide calcium complex for the treatment of neurodegenerative diseases | |
RU2784746C1 (en) | Haee peptide magnesium complex for the treatment of neurodegenerative diseases | |
WO2024014980A1 (en) | Potassium salt of haee peptide for treating neurodegenerative diseases | |
WO2024014981A1 (en) | Sodium salt of haee peptide for treating neurodegenerative diseases | |
US20080139456A1 (en) | Macrocyclic Sh2 Domain Binding Inhibitors | |
WO2024014985A1 (en) | Calcium complex of haee peptide for treating neurodegenerative diseases | |
WO2024014984A1 (en) | Ammonium salt of haee peptide for treating neurodegenerative diseases | |
WO2024014982A1 (en) | Copper complex of haee peptide for treating neurodegenerative diseases | |
EP1481007B1 (en) | Spheron components useful in determining compounds capable of treating symptoms of alzheimer's disease, treatments and animal models produced therefrom | |
WO2024014983A1 (en) | Zinc complex of haee peptide for treating neurodegenerative diseases | |
JP2008509915A (en) | Method for reducing the effect of Aβ and composition therefor |