WO2024014983A1 - Zinc complex of haee peptide for treating neurodegenerative diseases - Google Patents
Zinc complex of haee peptide for treating neurodegenerative diseases Download PDFInfo
- Publication number
- WO2024014983A1 WO2024014983A1 PCT/RU2023/000210 RU2023000210W WO2024014983A1 WO 2024014983 A1 WO2024014983 A1 WO 2024014983A1 RU 2023000210 W RU2023000210 W RU 2023000210W WO 2024014983 A1 WO2024014983 A1 WO 2024014983A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- haee
- zinc complex
- zinc
- peptide
- complex
- Prior art date
Links
- 239000011701 zinc Substances 0.000 title claims abstract description 215
- 229910052725 zinc Inorganic materials 0.000 title claims abstract description 169
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 title claims abstract description 168
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 97
- 230000004770 neurodegeneration Effects 0.000 title claims abstract description 38
- 208000015122 neurodegenerative disease Diseases 0.000 title claims abstract description 37
- 150000001450 anions Chemical class 0.000 claims abstract description 62
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 29
- PTFCDOFLOPIGGS-UHFFFAOYSA-N Zinc dication Chemical compound [Zn+2] PTFCDOFLOPIGGS-UHFFFAOYSA-N 0.000 claims abstract description 21
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 8
- 238000004519 manufacturing process Methods 0.000 claims abstract description 7
- 208000024827 Alzheimer disease Diseases 0.000 claims description 23
- 239000007864 aqueous solution Substances 0.000 claims description 18
- 238000000034 method Methods 0.000 claims description 15
- 150000003751 zinc Chemical class 0.000 claims description 14
- 230000003920 cognitive function Effects 0.000 claims description 13
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 claims description 12
- 239000007787 solid Substances 0.000 claims description 12
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 claims description 9
- 239000013543 active substance Substances 0.000 claims description 9
- 238000001938 differential scanning calorimetry curve Methods 0.000 claims description 9
- 239000011780 sodium chloride Substances 0.000 claims description 9
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 claims description 7
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 claims description 7
- 150000001875 compounds Chemical class 0.000 claims description 7
- 230000002757 inflammatory effect Effects 0.000 claims description 7
- 239000000654 additive Substances 0.000 claims description 6
- 238000001990 intravenous administration Methods 0.000 claims description 6
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 5
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical compound OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 claims description 5
- 229960001860 salicylate Drugs 0.000 claims description 5
- 229940095064 tartrate Drugs 0.000 claims description 5
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 claims description 4
- 229910002651 NO3 Inorganic materials 0.000 claims description 4
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 claims description 4
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 claims description 4
- 230000001771 impaired effect Effects 0.000 claims description 4
- 238000007918 intramuscular administration Methods 0.000 claims description 4
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 claims description 3
- ZGTMUACCHSMWAC-UHFFFAOYSA-L EDTA disodium salt (anhydrous) Chemical compound [Na+].[Na+].OC(=O)CN(CC([O-])=O)CCN(CC(O)=O)CC([O-])=O ZGTMUACCHSMWAC-UHFFFAOYSA-L 0.000 claims description 3
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 claims description 3
- 229930195725 Mannitol Natural products 0.000 claims description 3
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 claims description 3
- 229920003079 Povidone K 17 Polymers 0.000 claims description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 claims description 3
- 229930006000 Sucrose Natural products 0.000 claims description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 3
- 229960002885 histidine Drugs 0.000 claims description 3
- 238000007913 intrathecal administration Methods 0.000 claims description 3
- 239000000594 mannitol Substances 0.000 claims description 3
- 235000010355 mannitol Nutrition 0.000 claims description 3
- 229920001992 poloxamer 407 Polymers 0.000 claims description 3
- 229940044476 poloxamer 407 Drugs 0.000 claims description 3
- 229960002668 sodium chloride Drugs 0.000 claims description 3
- 239000005720 sucrose Substances 0.000 claims description 3
- 229960004793 sucrose Drugs 0.000 claims description 3
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 claims description 3
- 229960000281 trometamol Drugs 0.000 claims description 3
- 238000001361 intraarterial administration Methods 0.000 claims description 2
- 238000007912 intraperitoneal administration Methods 0.000 claims description 2
- 239000007788 liquid Substances 0.000 claims description 2
- 238000007920 subcutaneous administration Methods 0.000 claims description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 claims description 2
- FEWJPZIEWOKRBE-JCYAYHJZSA-L L-tartrate(2-) Chemical compound [O-]C(=O)[C@H](O)[C@@H](O)C([O-])=O FEWJPZIEWOKRBE-JCYAYHJZSA-L 0.000 claims 1
- 239000007853 buffer solution Substances 0.000 claims 1
- 150000002894 organic compounds Chemical class 0.000 claims 1
- 241000699670 Mus sp. Species 0.000 description 27
- 230000003993 interaction Effects 0.000 description 23
- 238000010175 APPswe/PSEN1dE9 Methods 0.000 description 22
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 21
- 241000699660 Mus musculus Species 0.000 description 21
- 238000011830 transgenic mouse model Methods 0.000 description 21
- 239000000243 solution Substances 0.000 description 19
- 210000002381 plasma Anatomy 0.000 description 18
- 230000000694 effects Effects 0.000 description 17
- 238000012360 testing method Methods 0.000 description 17
- 230000001225 therapeutic effect Effects 0.000 description 16
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 15
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 15
- 210000004556 brain Anatomy 0.000 description 14
- 239000000126 substance Substances 0.000 description 14
- 208000037259 Amyloid Plaque Diseases 0.000 description 13
- 108091006905 Human Serum Albumin Proteins 0.000 description 13
- 102000008100 Human Serum Albumin Human genes 0.000 description 13
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 12
- 238000004458 analytical method Methods 0.000 description 10
- 238000002329 infrared spectrum Methods 0.000 description 10
- 241001465754 Metazoa Species 0.000 description 9
- 230000015572 biosynthetic process Effects 0.000 description 9
- 239000000203 mixture Substances 0.000 description 9
- 239000000523 sample Substances 0.000 description 9
- 239000003814 drug Substances 0.000 description 8
- 210000001320 hippocampus Anatomy 0.000 description 8
- 238000001228 spectrum Methods 0.000 description 8
- 238000005160 1H NMR spectroscopy Methods 0.000 description 7
- -1 anions anions Chemical class 0.000 description 7
- 230000006399 behavior Effects 0.000 description 7
- 230000003542 behavioural effect Effects 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- 238000003860 storage Methods 0.000 description 7
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- 238000010171 animal model Methods 0.000 description 6
- 150000001793 charged compounds Chemical class 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 230000008018 melting Effects 0.000 description 6
- 238000002844 melting Methods 0.000 description 6
- 239000000546 pharmaceutical excipient Substances 0.000 description 6
- 230000027455 binding Effects 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 230000008499 blood brain barrier function Effects 0.000 description 5
- 210000001218 blood-brain barrier Anatomy 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 238000004128 high performance liquid chromatography Methods 0.000 description 5
- 230000001744 histochemical effect Effects 0.000 description 5
- 239000003446 ligand Substances 0.000 description 5
- 230000007170 pathology Effects 0.000 description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 5
- 239000007790 solid phase Substances 0.000 description 5
- 230000009261 transgenic effect Effects 0.000 description 5
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 230000034994 death Effects 0.000 description 4
- 238000000132 electrospray ionisation Methods 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 238000004949 mass spectrometry Methods 0.000 description 4
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 4
- 230000011514 reflex Effects 0.000 description 4
- JIAARYAFYJHUJI-UHFFFAOYSA-L zinc dichloride Chemical compound [Cl-].[Cl-].[Zn+2] JIAARYAFYJHUJI-UHFFFAOYSA-L 0.000 description 4
- ONDPHDOFVYQSGI-UHFFFAOYSA-N zinc nitrate Chemical compound [Zn+2].[O-][N+]([O-])=O.[O-][N+]([O-])=O ONDPHDOFVYQSGI-UHFFFAOYSA-N 0.000 description 4
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- 102000009027 Albumins Human genes 0.000 description 3
- 108010088751 Albumins Proteins 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 238000005481 NMR spectroscopy Methods 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- 206010002022 amyloidosis Diseases 0.000 description 3
- 230000002490 cerebral effect Effects 0.000 description 3
- 229940001468 citrate Drugs 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 239000010949 copper Substances 0.000 description 3
- 210000001947 dentate gyrus Anatomy 0.000 description 3
- 230000006866 deterioration Effects 0.000 description 3
- 238000000113 differential scanning calorimetry Methods 0.000 description 3
- 238000002149 energy-dispersive X-ray emission spectroscopy Methods 0.000 description 3
- 238000004108 freeze drying Methods 0.000 description 3
- 235000013922 glutamic acid Nutrition 0.000 description 3
- 239000004220 glutamic acid Substances 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 239000012535 impurity Substances 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 238000000302 molecular modelling Methods 0.000 description 3
- 239000012188 paraffin wax Substances 0.000 description 3
- 239000012071 phase Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 206010012289 Dementia Diseases 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 208000018737 Parkinson disease Diseases 0.000 description 2
- 208000037273 Pathologic Processes Diseases 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 238000002441 X-ray diffraction Methods 0.000 description 2
- 102000015296 acetylcholine-gated cation-selective channel activity proteins Human genes 0.000 description 2
- 108040006409 acetylcholine-gated cation-selective channel activity proteins Proteins 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 238000005571 anion exchange chromatography Methods 0.000 description 2
- 239000012062 aqueous buffer Substances 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 229940050390 benzoate Drugs 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 229940098773 bovine serum albumin Drugs 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 230000003930 cognitive ability Effects 0.000 description 2
- 230000001149 cognitive effect Effects 0.000 description 2
- IQFVPQOLBLOTPF-HKXUKFGYSA-L congo red Chemical compound [Na+].[Na+].C1=CC=CC2=C(N)C(/N=N/C3=CC=C(C=C3)C3=CC=C(C=C3)/N=N/C3=C(C4=CC=CC=C4C(=C3)S([O-])(=O)=O)N)=CC(S([O-])(=O)=O)=C21 IQFVPQOLBLOTPF-HKXUKFGYSA-L 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000001035 drying Methods 0.000 description 2
- 238000000921 elemental analysis Methods 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 235000019253 formic acid Nutrition 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 238000007710 freezing Methods 0.000 description 2
- 230000008014 freezing Effects 0.000 description 2
- 239000012520 frozen sample Substances 0.000 description 2
- 238000004896 high resolution mass spectrometry Methods 0.000 description 2
- 238000000589 high-performance liquid chromatography-mass spectrometry Methods 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000009878 intermolecular interaction Effects 0.000 description 2
- 238000010253 intravenous injection Methods 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- 239000004579 marble Substances 0.000 description 2
- 230000010534 mechanism of action Effects 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 230000009456 molecular mechanism Effects 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 230000003959 neuroinflammation Effects 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 230000008506 pathogenesis Effects 0.000 description 2
- 230000009054 pathological process Effects 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 238000004321 preservation Methods 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 238000003756 stirring Methods 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- 239000011592 zinc chloride Substances 0.000 description 2
- 235000005074 zinc chloride Nutrition 0.000 description 2
- 230000004572 zinc-binding Effects 0.000 description 2
- SXFBQAMLJMDXOD-UHFFFAOYSA-N (+)-hydrogentartrate bitartrate salt Chemical compound OC(=O)C(O)C(O)C(O)=O.OC(=O)C(O)C(O)C(O)=O SXFBQAMLJMDXOD-UHFFFAOYSA-N 0.000 description 1
- FBKFDSUZBVDZIX-FFGDOFBPSA-N (4s)-4-[[(2s)-2-[[(2s)-2-[[2-[[(2s)-2-[[(2s)-2-acetamido-3-phenylpropanoyl]amino]-4-methylsulfanylbutanoyl]amino]-2-methylpropanoyl]amino]-3-[4-(phosphonomethyl)phenyl]propanoyl]amino]-3-(6-chloro-1h-indol-3-yl)propanoyl]amino]-5-[[1-[[(2s)-1-amino-4-meth Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NC(C)(C)C(=O)N[C@@H](CC=1C=CC(CP(O)(O)=O)=CC=1)C(=O)N[C@@H](CC=1C2=CC=C(Cl)C=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)NC1(CC1)C(=O)N[C@@H](CC(C)C)C(N)=O)NC(C)=O)C1=CC=CC=C1 FBKFDSUZBVDZIX-FFGDOFBPSA-N 0.000 description 1
- VHBSECWYEFJRNV-UHFFFAOYSA-N 2-hydroxybenzoic acid Chemical compound OC(=O)C1=CC=CC=C1O.OC(=O)C1=CC=CC=C1O VHBSECWYEFJRNV-UHFFFAOYSA-N 0.000 description 1
- FZIPCQLKPTZZIM-UHFFFAOYSA-N 2-oxidanylpropane-1,2,3-tricarboxylic acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O.OC(=O)CC(O)(C(O)=O)CC(O)=O FZIPCQLKPTZZIM-UHFFFAOYSA-N 0.000 description 1
- 238000011825 3xTg-AD mouse Methods 0.000 description 1
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 101710137189 Amyloid-beta A4 protein Proteins 0.000 description 1
- 101710151993 Amyloid-beta precursor protein Proteins 0.000 description 1
- 102100022704 Amyloid-beta precursor protein Human genes 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- 208000028698 Cognitive impairment Diseases 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- LAQCZBYXNRANFU-UIAUUDGKSA-N Crotoxin Natural products CC=C/C(=O)O[C@@H]1C[C@H]2O[C@H]3C=C(C)[C@@H]4O[C@@H]4[C@]3(C)[C@]1(C)[C@]25CO5 LAQCZBYXNRANFU-UIAUUDGKSA-N 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 206010048554 Endothelial dysfunction Diseases 0.000 description 1
- 208000037487 Endotoxemia Diseases 0.000 description 1
- 238000004252 FT/ICR mass spectrometry Methods 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- 208000016285 Movement disease Diseases 0.000 description 1
- 241000896769 Multiple sclerosis associated retrovirus Species 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 208000036110 Neuroinflammatory disease Diseases 0.000 description 1
- CTQNGGLPUBDAKN-UHFFFAOYSA-N O-Xylene Chemical compound CC1=CC=CC=C1C CTQNGGLPUBDAKN-UHFFFAOYSA-N 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- KWYUFKZDYYNOTN-UHFFFAOYSA-M Potassium hydroxide Chemical compound [OH-].[K+] KWYUFKZDYYNOTN-UHFFFAOYSA-M 0.000 description 1
- 102000012412 Presenilin-1 Human genes 0.000 description 1
- 108010036933 Presenilin-1 Proteins 0.000 description 1
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 208000007400 Relapsing-Remitting Multiple Sclerosis Diseases 0.000 description 1
- 238000011869 Shapiro-Wilk test Methods 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- DTQVDTLACAAQTR-UHFFFAOYSA-M Trifluoroacetate Chemical compound [O-]C(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-M 0.000 description 1
- 201000004810 Vascular dementia Diseases 0.000 description 1
- 229940022663 acetate Drugs 0.000 description 1
- ZOIORXHNWRGPMV-UHFFFAOYSA-N acetic acid;zinc Chemical compound [Zn].CC(O)=O.CC(O)=O ZOIORXHNWRGPMV-UHFFFAOYSA-N 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- AEMOLEFTQBMNLQ-BKBMJHBISA-N alpha-D-galacturonic acid Chemical compound O[C@H]1O[C@H](C(O)=O)[C@H](O)[C@H](O)[C@H]1O AEMOLEFTQBMNLQ-BKBMJHBISA-N 0.000 description 1
- 230000003941 amyloidogenesis Effects 0.000 description 1
- 239000012491 analyte Substances 0.000 description 1
- 150000001449 anionic compounds Chemical class 0.000 description 1
- 239000010405 anode material Substances 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N aspartic acid group Chemical group N[C@@H](CC(=O)O)C(=O)O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229940077388 benzenesulfonate Drugs 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 1
- WXBLLCUINBKULX-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1.OC(=O)C1=CC=CC=C1 WXBLLCUINBKULX-UHFFFAOYSA-N 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 210000002459 blastocyst Anatomy 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- UXTMROKLAAOEQO-UHFFFAOYSA-N chloroform;ethanol Chemical compound CCO.ClC(Cl)Cl UXTMROKLAAOEQO-UHFFFAOYSA-N 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 208000010877 cognitive disease Diseases 0.000 description 1
- 238000010835 comparative analysis Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000009918 complex formation Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 229940124446 critical care medicine Drugs 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 1
- 230000009881 electrostatic interaction Effects 0.000 description 1
- 210000002257 embryonic structure Anatomy 0.000 description 1
- 230000008694 endothelial dysfunction Effects 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-L fumarate(2-) Chemical compound [O-]C(=O)\C=C\C([O-])=O VZCYOOQTPOCHFL-OWOJBTEDSA-L 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- JFCQEDHGNNZCLN-UHFFFAOYSA-N glutaric acid Chemical compound OC(=O)CCCC(O)=O JFCQEDHGNNZCLN-UHFFFAOYSA-N 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 230000000971 hippocampal effect Effects 0.000 description 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 230000036571 hydration Effects 0.000 description 1
- 238000006703 hydration reaction Methods 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000002883 imidazolyl group Chemical group 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 229910001412 inorganic anion Inorganic materials 0.000 description 1
- 238000000185 intracerebroventricular administration Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000005040 ion trap Methods 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 230000000626 neurodegenerative effect Effects 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 238000012261 overproduction Methods 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 108010091748 peptide A Proteins 0.000 description 1
- 230000006919 peptide aggregation Effects 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 238000001050 pharmacotherapy Methods 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- LUMVCLJFHCTMCV-UHFFFAOYSA-M potassium;hydroxide;hydrate Chemical compound O.[OH-].[K+] LUMVCLJFHCTMCV-UHFFFAOYSA-M 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 235000018102 proteins Nutrition 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 108090000623 proteins and genes Proteins 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 238000005057 refrigeration Methods 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000003998 snake venom Substances 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 239000002594 sorbent Substances 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 230000004006 stereotypic behavior Effects 0.000 description 1
- 230000035882 stress Effects 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- JBQYATWDVHIOAR-UHFFFAOYSA-N tellanylidenegermanium Chemical compound [Te]=[Ge] JBQYATWDVHIOAR-UHFFFAOYSA-N 0.000 description 1
- 210000004001 thalamic nuclei Anatomy 0.000 description 1
- 238000002411 thermogravimetry Methods 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 230000000472 traumatic effect Effects 0.000 description 1
- WGIWBXUNRXCYRA-UHFFFAOYSA-H trizinc;2-hydroxypropane-1,2,3-tricarboxylate Chemical compound [Zn+2].[Zn+2].[Zn+2].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O.[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O WGIWBXUNRXCYRA-UHFFFAOYSA-H 0.000 description 1
- 235000020799 vitamin D status Nutrition 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 238000004846 x-ray emission Methods 0.000 description 1
- 239000008096 xylene Substances 0.000 description 1
- 239000004246 zinc acetate Substances 0.000 description 1
- 229940006486 zinc cation Drugs 0.000 description 1
- 239000011746 zinc citrate Substances 0.000 description 1
- 235000006076 zinc citrate Nutrition 0.000 description 1
- 229940068475 zinc citrate Drugs 0.000 description 1
- VRGNUPCISFMPEM-ZVGUSBNCSA-L zinc;(2r,3r)-2,3-dihydroxybutanedioate Chemical compound [Zn+2].[O-]C(=O)[C@H](O)[C@@H](O)C([O-])=O VRGNUPCISFMPEM-ZVGUSBNCSA-L 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/07—Tetrapeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/10—Tetrapeptides
- C07K5/1024—Tetrapeptides with the first amino acid being heterocyclic
Definitions
- the present invention also relates to a method for producing the zinc complex of the HAEE peptide, to pharmaceutical compositions based thereon, and to the use of the zinc complex of the HAEE peptide for the treatment of neurodegenerative diseases.
- Neurodegenerative diseases have a number of common development factors and a number of other general mechanisms (Litvinenko I.V., Krasakov I.V., Bisaga G.N. et al. Modem conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy. Zhumal Nevrologii i Psikhiatrii imeni S.S. Korsakova. 2017;l 17( 6-2):3-10.
- Inflammation is one of the typical pathological processes of the human body.
- a typical pathological process is manifested by a certain set of characteristic signs. It is currently believed that the neurodegenerative process is secondary to the inflammatory process (Mostafa A., Jalilvand S., Shoja Z. Et al. Multiple sclerosis-associated retrovirus, Epstein-barr virus, and vitamin D status in patients with relapsing remitting multiple sclerosis. Journal of Medical Virology. 2017. doi: 10.1002/jmv.24774; Litvinenko IV, Krasakov IV, Bisaga GN et al. Modem conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy. Zhumal Nevrologii i Psikhiatrii imeni SS Korsakova. 2017;l 17(6-2):3-10. (In Russ.). doi: 10.17116/jnevro2017117623-10).
- Alzheimer's disease is one of the most common neurodegenerative diseases among older people and is characterized by neuritic plaques, the main component of which is the beta-amyloid (A) peptide.
- the N-terminal 1-16 region of amyloid beta is the metal-binding domain where zinc (Zn) and copper (Cu) are added to the AP peptide (Guilloreau L., Damian L., Coppel Y., et al. (2006). Structural and thermodynamical properties of Cull amyloid-P 16/28 complexes associated with Alzheimer's disease. JBIC Journal of Biological Inorganic Chemistry, 11(8), 1024-1038, doi: 10.1007/s00775-006-0154-l).
- HAEE Ac-HAEE-NH?
- the letters mean: H - histidine, A - alanine, E - glutamic acid.
- HAEE is capable of inhibiting the interaction of AP peptides with Zn(II) ions, causing a decrease or prevention of aggregation of peptide A in the presence of Zn(II) ions at physiological concentrations of Zn(II) ions of 100-400 ⁇ M.
- RF patent No. 2709539 From RF patent No. 2709539 it is known that short charged peptides of the HAEE type have a very short lifetime in the blood plasma (from several seconds to several minutes) and hardly pass through the blood-brain barrier (BBB), which significantly weakens the effectiveness of their therapeutic effects.
- BBB blood-brain barrier
- the authors of RF patent No. 2709539 have developed a pharmaceutical composition for the delivery of HAEE across the BBB for the treatment of neurodegenerative diseases, including dementia of the Alzheimer's type (Alzheimer's disease), which can improve the pharmacokinetic characteristics and increase the bioavailability of HAEE.
- This composition contains an effective amount of a substance in the form of a complex of HAEE with zinc and human serum albumin (HAEE-Zn-HSA) in the form of a solution for administration with a pharmaceutically acceptable carrier selected from a range of neutral carriers and diluents, for example, saline.
- a pharmaceutically acceptable carrier selected from a range of neutral carriers and diluents, for example, saline.
- RF patent No. 2709539 The invention according to RF patent No. 2709539 was chosen as the closest analogue, since it is the only complex known for HAEE. From RF patent No. 2709539 it is known that the HAEE peptide forms a specific ternary complex (HAEE-Zn-HSA) with human albumin (HSA) in the presence of zinc ions. However, in the absence of zinc ions, no interactions between HAEE and HSA were observed. This complex is characterized by the fact that with the help of a zinc ion it was possible to obtain intermolecular binding between the HAEE and HSA molecules. The zinc cation is the coordinating cation between these two molecules. This complex was not obtained in solid form. From RF patent No. 2709539 it is known that the pharmaceutical composition HAEE-Zn-HSA is stable in a suitable aqueous buffer system, in the pH range from 4 to 8, in the presence or absence of various salts.
- albumin in a neutral environment is -1, in an alkaline environment it is -2, and in a slightly acidic environment it is 0 (isoelectric state) and albumin precipitates (Biochemistry with exercises and tasks. Edited by A.I. Glukhov, E. S. Severina, GEOTAR-Media, Moscow, 2019, p. 19), therefore this complex should not exist in a slightly acidic environment at pH 4-5.5.
- HAEE-Zn-HSA suitable for preclinical studies, 5 mg of HAEE, 600 mg of human albumin and 0.5 mg of zinc chloride (ZnCb) were dissolved in 20 milliliters of physiological solution. A lyophilized preparation of the synthetic HAEE peptide (purity more than 98%) was used as a source of HAEE. With the known molecular weight of HAEE equal to 525.52 g/mol, the ratio of components in the HAEE-Zn-HSA complex is approximately HAEE: Zn: HSA ⁇ 1: 2.6: 1 by moles.
- the disadvantage of this invention is the high content of human albumin, which is 120 times greater by weight than the content of the active substance HAEE, as well as the high content of zinc, which is 2.6 times greater by weight than the content of the active substance HAEE and can lead to the formation of a complex with a non-stoichiometric ratio of the constituents components into it.
- HSA bovine serum albumin
- HSA can induce an immune response in mice after its administration (Favoretto V. S., Ricardi R., Silva, S. R. et al. (2011). Immunomodulatory effects of crotoxin isolated from Crotalus durissus terrificus venom in mice immunised with human serum albumin. Toxicon , 57(4), 600-607, doi: 10.1016/j.toxicon.2010.12.023). It is known that HSA can be used to improve cognitive function in the treatment of Alzheimer's disease, but only when administered intracerebroventricularly (intracranial).
- HSA HSA to blood plasma may reduce its effectiveness (Ezra, A., Rabinovich-Nikitin, I., Rabinovich-Toidman, R., & Solomon, V. (2016). Multifunctional effect of human serum albumin reduces Alzheimer's disease related pathologies in the 3xTg mouse model. Journal of Alzheimer's Disease, 50(1), 175-188, doi: 10.3233/JAD-150694).
- HAEE and the HAEE-Zn-HSA complex have not previously been characterized in the solid phase and their properties in the solid phase are unknown.
- the tasks to be solved by the invention are to obtain a new effective zinc complex of the HAEE peptide for the treatment of neurodegenerative diseases, including in solid form, to develop pharmaceutical compositions based on it and its use for the treatment of neurodegenerative diseases.
- the molar content of zinc(II) cation and HAEE peptide is equimolar (1:1).
- the claimed zinc complex of the HAEE peptide is described by the formula [Zn(HAEE)]X2.
- X is a doubly charged anion
- the claimed zinc complex of the HAEE peptide is described by the formula [Zn(HAEE)]X.
- X is a triply charged anion
- the claimed zinc complex of the HAEE peptide is described by the formula [Xn(HAEE)]3Xg.
- the interaction of the HAEE peptide with zinc was also observed at other molar ratios of HAEE: Zn, namely, in the range from 1:0.1 to 1:10, which is due to the presence there are many donor-acceptor centers (nitrogen, oxygen) in the HAEE molecule and the interaction between HAEE and Zn can be non-stoichiometric.
- the use of a higher zinc content (>1:10) led to the production in solid form of a mixture of the zinc complex of the HAEE peptide and the corresponding zinc salt; when using a small amount of zinc ( ⁇ 1:0.1), its interaction with the HAEE peptide was not detected physically. chemical methods.
- HAEE-Zn-HSA improves the pharmacokinetic parameters of the HAEE peptide
- the use of the zinc complex of the HAEE peptide for the treatment of neurodegenerative diseases changes the mechanism of action of the HAEE peptide associated with the conformational structure of the HAEE peptide, which leads to an unexpectedly high therapeutic effect.
- the 3D structure of the native HAEE peptide which in the form of an aqueous solution was placed for 2 minutes in the blood plasma of wild-type mice, differs from the 3D structure of native HAEE in the original aqueous solution, which is confirmed by HPLC by changing the time of release from chromatographic column of the HAEE sample extracted from blood plasma, relative to the time of release of the HAEE sample extracted from the original aqueous solution.
- the 3 D structure of the zinc complex of the HAEE peptide remained unchanged under similar experimental conditions (that is, after extraction from the initial aqueous solution of the zinc complex of the HAEE peptide and after extraction from the blood plasma of wild-type mice after a 2-minute exposure) and corresponded to 3 D-structure of the native HAEE peptide extracted from the original aqueous solution.
- mass spectrometry data the chemical structure of the HAEE peptide in all experimental samples remained unchanged for both the native peptide and the peptide in the zinc complex.
- Change in the release time of the native HAEE peptide or the zinc complex of the HAEE peptide from the chromatographic column is mainly due to differences in the hydrophobic interactions of the HAEE peptide with the column material, and these interactions, in turn, are determined by the prevailing EB structure of the HAEE peptide in a particular sample.
- the GS structure of the HAEE peptide which corresponds to the “unfolded” conformation of the peptide and is prevalent for the native HAEE peptide in the original aqueous solution, corresponds to the GS structure of the zinc complex of the HAEE peptide in an aqueous solution and remains unchanged in the case of exposure of the zinc complex of the HAEE peptide in the blood plasma, while the native HAEE peptide in the blood plasma loses its “unfolded” conformation.
- the term SV structure is used as a synonym for spatial structure or the relative arrangement of atoms in the HAEE molecule in three-dimensional space.
- the HPLC method is based primarily on intermolecular interactions at the interface.
- the change in the release time of HAEE from the chromatographic column reflects a change in the intermolecular interactions of HAEE with the sorbent, which is a consequence of differences in the spatial structure of HAEE molecules in the native state and in the form of a zinc complex.
- the imidazole group of the histidine amino acid residue can form stable polar bonds with the carboxyl groups of the side chains of glutamic acid amino acid residues, which does not contribute to maintaining the biologically significant “unfolded” conformation of this peptide and, as a result, reduces the beneficial therapeutic effects of HAEE.
- one of the advantages of this invention is to increase the therapeutic effectiveness of the zinc complex of the HAEE peptide due to the preservation of the 3B structure of this complex in the “unfolded” conformation.
- the difference between the present invention and its closest analogue, RF patent No. 2709539 is that the claimed zinc complex does not contain HSA, the molar concentration of zinc ions in this complex is reduced compared to the HAEE-Zn-HSA complex with 2.6, as described in the example of RF patent No. 2709539, up to 1 (equimolar amount), as described in the present invention.
- the invention also relates to the use of a zinc complex for the treatment of neurodegenerative diseases, as well as pathologies accompanied by neuroinflammatory processes.
- the inventive zinc complex can effectively influence neurodegenerative diseases, in particular those caused by inflammatory causes, restoring impaired cognitive functions.
- Zinc complex can be used in either solid or liquid form and remains stable for at least 2 years.
- the technical result of the invention is:
- the zinc complex claimed in the present invention in accordance with the production method used, can be obtained in an amorphous form, which is confirmed by X-ray phase analysis (Fig. 1, 2).
- the zinc complex is characterized by a differential scanning calorimetry (DSC) thermograviometry (TG) curve (DSC-TGA).
- DSC differential scanning calorimetry
- TG thermograviometry
- the HAEE molecule on the DSC curve is characterized by: a broad peak with an onset at 62 °C and a maximum at 89 °C; a double melting peak at 203 and 227.5 °C with an onset at 188 °C ( Figure 3). The error for multiple measurements is estimated at ⁇ 3 °C.
- the claimed zinc complex on the DSC curve is characterized by: a wide peak with an onset at 62 °C and a maximum at 87 °C; a broad melting peak with an onset at 224 °C and a maximum at 255 °C (Fig. 4).
- DSC curves show that the melting point of the zinc complex is higher compared to the melting point of HAEE, which provides higher stability of the complex, as confirmed by the results of the accelerated storage test.
- the IR spectrum with Fourier transform of the claimed zinc complex is presented in Fig. 5.
- the IR spectrum of the complex repeats all the main lines of the HAEE IR spectrum.
- the differences in the vibration bands of the complex compared to HAEE and their manifestation in the IR spectrum are the shift of the maximum at ISO cm 1 to the region of 1115 cm' 1 (CN val.) and a new maximum at 970 cm' 1 .
- the zinc complex using acetate as an example, differs from HAEE by the presence of maxima at 1115 cm' 1 and 970 cm' 1 .
- the inventive zinc complex can be obtained in the form of a lyophilisate using standard freeze-drying.
- Preparation of the zinc complex consists of mixing aqueous solutions of HAEE and water-soluble zinc salt in equimolar ratios at room temperature, stirring for 10-60 minutes, freezing the solution and freeze-drying.
- Water-soluble zinc salts are zinc nitrate, sulfate, acetate and zinc chloride.
- anion exchange chromatography or dialysis is performed to remove the primary anion.
- Another appropriate pharmaceutically acceptable anion is then added to the solution, the solution is frozen and freeze-dried.
- Anions can be single-, double- or triple-charged and selected from the group of sulfate, acetate, benzoate, nitrate, salicylate, tartrate, citrate.
- the need to remove anions from a solution is due to the replacement of one anion with another anion.
- the presence of anions of different nature in the composition of the complex in the liquid or solid phase does not affect the therapeutic effectiveness of the zinc complex. It is assumed that only the inner sphere of the zinc complex exhibits therapeutic efficacy, regardless of the nature of the anion.
- the anions for the zinc complex are selected from the group of gluconate, lactate, trifluoroacetate, pyruvate, galacturonate, bromide, glutarate, succinate, maleate, fumarate, benzenesulfonate, tosylate and other pharmaceutically acceptable anions.
- Another object of the invention is pharmaceutical compositions with an effective amount of zinc complex and the presence of excipients.
- the zinc complex can be used without excipients in the form of a lyophilized substance.
- the effective amount of zinc complex depends on the type of neurodegenerative disease, body weight, route of administration, and can therefore vary widely from 0.1 to 100 mg, more preferably from 5 to 50 mg.
- the pharmaceutical composition of the zinc complex may be in solid form or in the form of an aqueous solution.
- Solid compositions of zinc complex contain it effective amount and optional excipients.
- the solid pharmaceutical composition can be prepared by lyophilizing the zinc complex and a set of excipients or adding excipients to the lyophilized zinc complex.
- the lyophilized zinc complex can be in an amorphous form, which corresponds to the diffraction pattern in Fig. 1.2.
- Excipients are selected from pharmaceutically acceptable additives. Such substances may be mannitol, povidone K 17, trometamol, disodium edetate, sodium chloride, sucrose, histidine, poloxamer 407, and other pharmaceutically acceptable additives.
- the pharmaceutical composition of the zinc complex in the form of an aqueous solution contains an effective amount of the zinc complex, water, as well as a set of pharmaceutically acceptable additives and salts.
- Such substances may be mannitol, povidone K 17, trometamol, disodium edetate, sodium chloride, sucrose, histidine, poloxamer 407, and other pharmaceutically acceptable additives.
- Another object of the invention is the use of a zinc complex for the treatment of neurodegenerative diseases, which consists of administering a zinc complex as part of the described pharmaceutical compositions to a patient in an effective amount.
- the effective amount of zinc complex depends on the type of neurodegenerative disease, body weight, route of administration, and can therefore vary widely from 0.1 to 100 mg, preferably from 5 to 50 mg.
- Administration of the zinc complex to the patient can be carried out using all possible types of external, enteral, inhalation and parenteral administration (including intravenous, intraarterial, intraperitoneal, subcutaneous, cutaneous, transdermal, intramuscular, intrathecal, subarachnoid, oral, intranasal, sublingual, buccal, rectal administration ).
- external, enteral, inhalation and parenteral administration including intravenous, intraarterial, intraperitoneal, subcutaneous, cutaneous, transdermal, intramuscular, intrathecal, subarachnoid, oral, intranasal, sublingual, buccal, rectal administration ).
- the preferred route of administration is sublingual.
- the preferred routes of administration are intravenous and intranasal.
- the zinc complex [Zn(HAEE)](Ac)2 was administered six times intravenously at a dose of 0.05 mg/kg, after which a valid test for cognitive abilities “Marble Burying Test” [Santana- Santana M., Bayascas J. R., Gimenez-Llort L. (2021). Sex-Dependent Signatures, Time Frames and Longitudinal Fine-Tuning of the Marble Burying Test in Normal and AD-Pathological Aging Mice. Biomedicines, 9(8), 994, doi: 10.3390/biomedicines9080994), quantifying more than 2/3 of the buried beads as a percentage of the total number of beads. The greater the number of buried balls (BPS), the higher the cognitive abilities of mice.
- BPS number of buried balls
- the value of the CR was 50.6 ⁇ 13.3%. This value was taken as a reference value.
- the value of the CVS 12.6 ⁇ 4.2%, which indicates a strong deterioration in the behavioral reflexes of transgenic mice of the APP/PS1 line compared to wild-type animals and reflects the disabling effect overexpression of human beta-amyloid, associated with neuroinflammation and the formation of amyloid plaques, on the processes of nervous activity.
- the claimed zinc complex can be effectively used in the treatment of neurodegenerative diseases, in particular those caused by inflammatory complications, restoring cognitive functions to normal.
- PB plaques
- One of the mechanisms of action of the zinc complex on the possibility of treating neurodegenerative diseases may be its binding to beta-amyloid.
- the HAEE peptide did not bind to beta-amyloid under similar experimental conditions.
- This difference between native HAEE and the zinc complex may affect the pharmacological properties, which was confirmed by differing tests of cognitive function restoration - the effectiveness of HAEE was significantly lower than the effectiveness of the claimed zinc complex.
- This effect can be related to the above-mentioned HPLC-MS data, which showed changes in the 3D structure of native HAEE after its introduction into the blood plasma, while the zinc complex before and after its introduction into the blood plasma has the same retention time in the HPLC chromatogram and, accordingly, a stable 3D structure.
- Fig. 1 X-ray diffraction pattern of the zinc complex [Zn(HAEE)](Ac)2.
- Fig. 5 IR spectrum with Fourier transform of HAEE (1) and zinc complex [Zn(HAEE)](Ac) 2 (2), ([Zn(HAEE)]Cl 2 (3).
- Powder X-ray phase analysis was performed on a Rigaku Ultima IV diffractometer (Japan), tube voltage - 40 kV, tube current - 30 mA, tube anode material - Cu.
- Goniometer 0/0 vertical type, the sample is motionless.
- the maxima in the diffraction pattern accumulated over 1 hour.
- the angle 20 ranged from 3 to 70 degrees.
- Elemental analysis was performed by energy-dispersive X-ray spectroscopy with an EDXA attachment on a TESCAN MIRA3 microscope (Czech Republic). The area of the measured area is 0.04 mm 2 , the number of measurements is 3.
- Infrared radiation spectra were obtained on a Spectrum Two IR-Fourier spectrometer (Perkin Elmer, USA) with a diffuse reflection attachment in the range of 4000-600 cm'1 with a resolution of 2 cm'1 , the number of scans was 10.
- the formation of the complex was detected by a biosensor based on the effect of surface plasmon resonance (SPPR) in aqueous buffer systems at physiological pH values.
- SPPR surface plasmon resonance
- BPPR experiments were carried out on a BIAcore 3000 instrument (GE Healthcare, USA) using an CM4 optical chip in accordance with the manufacturer’s protocols.
- the ligand (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAGGGGC) was immobilized on the surface of the optical chip through the disulfide bond of the thiol group of the C-terminal cysteine residue.
- the analytes used were zinc complex or HAEE.
- Drying of frozen samples was carried out in penicillin vials on a Heto FD 2.5 sublimator at a pressure of 0.1 -0.2 mbar.
- the accelerated storage test was carried out in a Memmert HCP50 chamber at 40 °C and 75% humidity. Samples were taken once a month for 6 months and the content of the active substance was determined by HPLC.
- a HAEE solution with a concentration of 10'5 M was prepared.
- a solution of zinc salt with a concentration of 10'3 M was added to it (Table 1).
- Mixing was carried out for 5-60 minutes.
- Equimolar zinc complexes were formed with a molar ratio of HAEE and zinc salts equal to 1:1.
- the solution was slowly frozen in a refrigeration unit at -20 or -80 °C and then freeze-dried in a standard manner. Next, the properties of the resulting lyophilized zinc complex were studied in detail.
- a water-soluble zinc salt (nitrate, acetate, chloride, sulfate) was used in the first stage; the anion was removed using a known method. method - anion exchange chromatography or dialysis and another compound - tartaric acid, citric acid, etc. was added to the solution in equimolar quantities. After that, similar operations were performed to freeze and freeze-dry the zinc complex.
- obtaining a zinc complex [Zn(HAEE)] m X n where X is benzoate, salicylate, tartrate, citrate, etc. was carried out in three stages.
- a solution of the zinc complex was prepared according to the ratios described in Table 1, then inorganic anions were separated chromatographically and added to obtain benzoate - benzoic acid, salicylate - salicylic acid, tartrate - tartaric acid, citrate - citric acid in equimolar quantities.
- the resulting solutions were frozen in a freezer (-20 °C) in penicillin vials for 2 hours.
- the frozen samples were placed in a sublimator with pre-cooled shelves and dried for 16-30 hours. All dried samples were white color.
- the resulting solid samples of the complex are characterized by an amorphous form in the diffraction pattern (Fig. 1, 2).
- the complex In the DSC curve, in contrast to E1AEE (Fig. 3), the complex is characterized by a broad peak with an onset at 62 °C and a maximum at 87 °C; a broad melting peak with an onset at 224 °C and a maximum at 255 °C (Fig. 4).
- the IR spectrum with Fourier transform of the complex is characterized by the presence of maxima at 1115 cm' 1 and 970 cm' 1 (Fig. 5), which distinguishes the claimed zinc complex from HAEE.
- the position of the chemical shifts of protons in the HAEE molecule changed and is shown in Fig. 8, which indicates the preservation of the complex after its dissolution in water, which is important for the pharmacological properties of the resulting complex.
- the signal at CH(12) shifted from 8.5 to 8.42 ppm, at CH(10) from 7.19 to 7.14 ppm, at CH 2 (8) from 3.13 and 3 .03 to 3.10 and 3.01, with 2CH 2 (22.34) from 2.28 to 2.21, with CH 3 (16) from 1.27 to 1.26 (Table 2).
- Characterization of the zinc complex [Zn(HAEE)](Ac) 2 in aqueous solution was carried out by high-resolution mass spectrometry using Fourier transform ion cyclotron resonance technology by measuring the exact mass of characteristic molecular ions in both positive and negative ionization modes.
- samples of the zinc complex [Zn(HAEE)](Ac) 2 in an aqueous solution with a concentration of 20 ⁇ M were added to a mixture of water and acetonitrile in a 1:1 ratio with the addition of formic acid (to achieve a final concentration of 0.1%).
- Mass spectrometric analysis of an aqueous solution of the zinc complex [Zn(HAEE)](Ac) 2 carried out in a positive mode electrospray ionization source showed the presence of the molecular ion [HAEE+H] +1 with a monoisotopic mass of 526.2270 m/z and the molecular ion [HAEE-H+Zn] +1 with a monoisotopic mass of 588.1449 m/z.
- both the zinc complex of the HAEE peptide and HAEE require their introduction into the body and presence in the blood plasma, therefore, the fundamental differences in the spatial structure of these molecules in the blood plasma, based on the general concepts of biochemistry and physiology, indicate a different molecular mechanism of action of the zinc complex and HAEE, which excludes their bioequivalence.
- the stability of the zinc complex was determined in an accelerated storage test for 6 months, which corresponds to 2 years of storage under normal conditions (Table 3).
- the zinc complex both purified from anions and in a mixture with the indicated anions, retained its color and consistency during storage, did not gain water (the mass of the sample did not increase within 1-2%) and did not lose the active substance.
- the HAEE sample gained water over time (up to 7% wt.) and, according to HPLC data, degraded to 67.4% of the active substance in 6 months.
- the sample obtained under RF patent No. 2709539 which is a HAEE-Zn-HSA complex, also took on water (up to 16% by weight) and degraded to a content of 71.9% of the original amount.
- the stability of the proposed zinc complex turned out to be significantly higher compared to HAEE and HAEE-Zn-HSA.
- Example 2 Pharmaceutical compositions based on the zinc complex of the HAEE peptide.
- compositions based on the HAEE peptide zinc complex may contain the active substance in an effective amount (Table 4).
- the dosage composition is calculated individually and can vary from 0.1 mg to 100 mg per person per day, more preferably from 1 to 50 mg.
- the compositions of the pharmaceutical compositions are presented in Table 3. The conversion was made to the dosage of the active substance.
- Other ratios of the active substance in the pharmaceutical composition are possible in the range from 0.1 to 100 mg.
- the weight of the tablets varies from 100 to 400 mg, the tablets can be coated.
- Example 3 Effect of the zinc complex of the HAEE peptide on behavioral functions and severity of cerebral amyloidosis in experimental animals.
- Alzheimer's disease To model a neurodegenerative disease, a model of Alzheimer's disease was chosen, which is the most common neurodegenerative disease in older people.
- mice of the APPswe/PSENldE9 line Male transgenic mice of the APPswe/PSENldE9 line were used for the experiments. Mice of this line are also known as APP/PS1: Control APP/PS1 mice, starting at 4-6 months of age, display characteristic cognitive signs of Alzheimer's disease-like pathology and have significant amounts of congophilic amyloid plaques in specific brain regions, including the hippocampus and cortex (Borchelt DR, Ratovitski T. , Van bare J., et al. (1997). Accelerated amyloid deposition in the brains of transgenic mice coexpressing mutant presenilin 1 and amyloid precursor proteins. Neuron, 19(4), 939-945, doi: 10.1016/S0896-6273( 00)80974-5).
- control Wild-type mice injected intravenously with saline;
- control APP/PS1 transgenic mice injected intravenously with saline;
- HAEE, HAEE-Zn-HSA and the claimed zinc complex were injected into the retro-orbital venous plexus in accordance with a known procedure (Yardeni T., Eckhaus M., Morris H.D. et al. (2011). Retro-orbital injections in mice. Lab animal, 40(5), 155- 160, doi: 10.1038/laban0511-155).
- Injections at a dose of 0.05 mg/kg were carried out monthly, from 2 to 7 months of age (inclusive), a total of 6 injections were made with HAEE and zinc complex preparations, however, only two injections were made with HAEE-Zn-HSA, and then experiments with this drug were stopped due to signs of deterioration in the appearance of experimental animals after the first injection and the death of 5 transgenic mice immediately after the second injection. This is most likely due to the effects of high concentrations of HSA, which is structurally different from endogenous murine albumin (MSA).
- MSA endogenous murine albumin
- the value of the CR 12.6 ⁇ 4.2%, which indicates a strong deterioration in the behavioral reflexes of APP/PS1 mice compared to wild-type animals and reflects the disabling effect of overproduction of human beta-amyloid on the processes of nervous activity .
- the process of pouring the sample into paraffin was carried out as follows: poured 75% ethanol and left overnight, then changed to 96% ethanol and kept for 5 minutes, 96% ethanol - 10 minutes, 100% ethanol - 10 minutes (two changes), ethanol-chloroform (1:1) - 30 minutes, and left in pure chloroform overnight. Paraffin embedding was carried out at 60°C for 3 hours (three shifts). Embedding of tissues in paraffin blocks was carried out on a Leica EG 1160 device. Serial sections of the brain (8 ⁇ m) were cut using a Leica RM2265 microtome and placed on glass slides.
- Example 4 Specific binding of the zinc complex of the HAEE peptide to human beta-amyloid (Ap42).
- the binding of the proposed zinc complex to beta-amyloid was assessed as one of the mechanisms of action of this complex in neurodegenerative lesions associated with beta-amyloid.
- the formation of complexes between the analyte in solution (the claimed zinc complex or HAEE) and the immobilized 42-membered human beta-amyloid (ligand) was studied using BPPR. Based on the results of such experiments, the kinetic parameters of interactions and the value of the dissociation constant (KD) of the interaction between the zinc and immobilized ligand were calculated. If the value of KD ⁇ 10" 4 M, then the interaction between the zinc complex and beta-amyloid is biologically significant.
- results obtained in this Example of the present invention indicate the absence of the ability of HAEE to bind to Ap42.
- the zinc complex of the HAEE peptide binds to Ap42.
- both HAEE and the claimed zinc complex when introduced into the circulatory system of APP/PS1 transgenic mice, improve cognitive function and reduce the number of amyloid plaques in experimental animals (Examples 3.1 and 3.2 of the present invention), the results obtained indicates different molecular mechanisms of the therapeutic effects of HAEE and the claimed zinc complex, which, in turn, excludes the bioequivalence of HAEE and the claimed zinc complex when used for the treatment of neurodegenerative diseases.
- Table 1 Volumes of reagents for the preparation of zinc complexes of HAEE with various anions.
- composition of pharmaceutical compositions with the zinc complex of the HAEE peptide IM - intramuscular administration, IV - intravenous administration.
Abstract
The invention relates to a zinc complex of the peptide HAEE described by the formula [Zn(HAEE)]mXn, where Zn is a doubly-charged zinc (II) cation, m=1 for singly-charged and doubly-charged anions, m=3 for triply-charged anions, HAEE is a synthetic peptide that is acetylated at the N-terminus and amidated at the C-terminus and has the amino acid sequence His-Ala-Glu-Glu, X is a pharmaceutically acceptable anion, n=1 for doubly-charged anions, and n=2 for singly-charged and triply-charged anions. The present invention further relates to a method for producing a zinc complex of the peptide HAEE, pharmaceutical compositions based on a zinc complex of the peptide HAEE, and the use of a zinc complex of the peptide HAEE for treating neurodegenerative diseases.
Description
ЦИНКОВЫЙ КОМПЛЕС ПЕПТИДА НАЕЕ ДЛЯ ЛЕЧЕНИЯ НЕЙРО ДЕГЕНЕРАТИВНЫХ ЗАБОЛЕВАНИЙ ZINC COMPLEX PEPTIDE NEE FOR THE TREATMENT OF NEURO DEGENERATIVE DISEASES
Изобретение относится к цинковому комплексу пептида НАЕЕ для лечения нейродегенеративных заболеваний, который описывается формулой [Zn(HAEE)]mXn, где Zn представляет собой двухзарядный катион цинка (II), m = 1 для однозарядных и двухзарядных анионов, m = 3 для трехзарядных анионов, НАЕЕ представляет собой синтетический пептид, ацетилированный по N-концу и амидированный по С-концу, с аминокислотной последовательностью His-Ala-Glu-Glu, X - фармацевтически приемлемый анион, n = 1 для двухзарядных анионов, п = 2 для однозарядных и трехзарядных анионов. Настоящее изобретение также относится к способу получения цинкового комплекса пептида НАЕЕ, к фармацевтическим композициям на его основе и применению цинкового комплекса пептида НАЕЕ для лечения нейродегенеративных заболеваний. The invention relates to a zinc complex of the HAEE peptide for the treatment of neurodegenerative diseases, which is described by the formula [Zn(HAEE)] m X n , where Zn is a doubly charged zinc (II) cation, m = 1 for singly and doubly charged anions, m = 3 for triply charged anions anions, HAEE is a synthetic peptide, acetylated at the N-terminus and amidated at the C-terminus, with the amino acid sequence His-Ala-Glu-Glu, X is a pharmaceutically acceptable anion, n = 1 for doubly charged anions, n = 2 for singly charged and triply charged anions. The present invention also relates to a method for producing the zinc complex of the HAEE peptide, to pharmaceutical compositions based thereon, and to the use of the zinc complex of the HAEE peptide for the treatment of neurodegenerative diseases.
Предшествующий уровень техники Prior Art
Нейродегенеративные заболевания имеют ряд общих факторов развития и целый ряд других обобщающих механизмов (Litvinenko I.V., Krasakov I.V., Bisaga G.N. et al. Modem conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy. Zhumal Nevrologii i Psikhiatrii imeni S.S. Korsakova. 2017;l 17(6-2):3-10. (In Russ.), doi: 10.17116/jnevro2017117623-10), что может связывать болезнь Альцгеймера (БА), сосудистую деменцию, нейродегенерацию при рассеянном склерозе (PC), болезнь Паркинсона, а также болезнь Альцгеймера в условиях активации системного воспаления (Williams-Gray С.Н., Wijeyekoon R., Yamall A. J. et al. ICICLE-PD study group. Serum immune markers and disease progression in an incident Parkinson’s disease cohort (ICICLE- PD). Movement Disorders. 2016;31(7):995-1003. https://doi.org/10.1002/mds.26563).Neurodegenerative diseases have a number of common development factors and a number of other general mechanisms (Litvinenko I.V., Krasakov I.V., Bisaga G.N. et al. Modem conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy. Zhumal Nevrologii i Psikhiatrii imeni S.S. Korsakova. 2017;l 17( 6-2):3-10. (In Russ.), doi: 10.17116/jnevro2017117623-10), which may link Alzheimer's disease (AD), vascular dementia, neurodegeneration in multiple sclerosis (MS), Parkinson's disease, and Alzheimer's disease in conditions of activation of systemic inflammation (Williams-Gray S.N., Wijeyekoon R., Yamall A.J. et al. ICICLE-PD study group. Serum immune markers and disease progression in an incident Parkinson's disease cohort (ICICLE-PD). Movement Disorders 2016;31(7):995-1003. https://doi.org/10.1002/mds.26563).
Воспаление относится к типовым патологическим процессам организма человека. Типовой патологический процесс проявляется определенным набором характерных признаков. В настоящее время считается, что нейродегенеративный процесс является вторичным по отношению к воспалительному (Mostafa A., Jalilvand S., Shoja Z. Et al. Multiple sclerosis-associated retrovirus, Epstein-barr virus, and vitamin D status in patients with relapsing remitting multiple sclerosis. Journal of Medical Virology. 2017. doi: 10.1002/jmv.24774; Litvinenko I.V., Krasakov I.V., Bisaga G.N. et al. Modem conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy. Zhumal Nevrologii i
Psikhiatrii imeni S.S. Korsakova. 2017;l 17(6-2):3-10. (In Russ.). doi: 10.17116/jnevro2017117623-10). Inflammation is one of the typical pathological processes of the human body. A typical pathological process is manifested by a certain set of characteristic signs. It is currently believed that the neurodegenerative process is secondary to the inflammatory process (Mostafa A., Jalilvand S., Shoja Z. Et al. Multiple sclerosis-associated retrovirus, Epstein-barr virus, and vitamin D status in patients with relapsing remitting multiple sclerosis. Journal of Medical Virology. 2017. doi: 10.1002/jmv.24774; Litvinenko IV, Krasakov IV, Bisaga GN et al. Modem conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy. Zhumal Nevrologii i Psikhiatrii imeni SS Korsakova. 2017;l 17(6-2):3-10. (In Russ.). doi: 10.17116/jnevro2017117623-10).
Болезнь Альцгеймера является одним из наиболее распространённых нейродегенеративных заболеваний среди людей пожилого возраста и характеризуется нейритными бляшками, основным компонентом которых является пептид бета-амилоид (А ). N-концевая область 1-16 бета-амилоида является металл-связывающим доменом, где цинк (Zn) и медь (Си) присоединяются к пептиду АР (Guilloreau L., Damian L., Coppel Y., et al. (2006). Structural and thermodynamical properties of Cull amyloid-P 16/28 complexes associated with Alzheimer’s disease. JBIC Journal of Biological Inorganic Chemistry, 11(8), 1024-1038, doi: 10.1007/s00775-006-0154-l). Снижение уровня ионов цинка в крови за счет связывания ионов цинка специфическими хелатирующими агентами и/или блокирование взаимодействий пептида Ар с ионами цинка может предотвратить патологии, связанные с этими взаимодействиями (Ayton S., Lei Р., Bush A. Biometals and Their Therapeutic Implications in Alzheimer’s Disease. Neurotherapeutics. 2015. 12(1): p. 109-120). Высокие концентрации цинка вызывают преципитацию пептида Ар и влияют на образование в специфических отделах мозга (гиппокамп, кортекс, таламические ядра) внеклеточных агрегатов Ар (амилоидных бляшек), которые ассоциированы с развитием болезни Альцгеймера ((Frederickson C.J., Bush A.I. (2001). Synaptically released zinc: physiological functions and pathological effects. Biometals, 14(3), 353-366, doi: 10.1023/A:1012934207456). Таким образом, применение ионов цинка в фармацевтических препаратах для лечения нейродегенеративных заболеваний, в частности болезнь Альцгеймера, является нетривиальной решением. Alzheimer's disease is one of the most common neurodegenerative diseases among older people and is characterized by neuritic plaques, the main component of which is the beta-amyloid (A) peptide. The N-terminal 1-16 region of amyloid beta is the metal-binding domain where zinc (Zn) and copper (Cu) are added to the AP peptide (Guilloreau L., Damian L., Coppel Y., et al. (2006). Structural and thermodynamical properties of Cull amyloid-P 16/28 complexes associated with Alzheimer's disease. JBIC Journal of Biological Inorganic Chemistry, 11(8), 1024-1038, doi: 10.1007/s00775-006-0154-l). Reducing the level of zinc ions in the blood by binding zinc ions with specific chelating agents and/or blocking the interactions of the Ap peptide with zinc ions may prevent pathologies associated with these interactions (Ayton S., Lei R., Bush A. Biometals and Their Therapeutic Implications in Alzheimer's Disease. Neurotherapeutics. 2015. 12(1): pp. 109-120). High concentrations of zinc cause precipitation of the Ap peptide and affect the formation in specific parts of the brain (hippocampus, cortex, thalamic nuclei) of extracellular Ap aggregates (amyloid plaques), which are associated with the development of Alzheimer's disease ((Frederickson C.J., Bush A.I. (2001). Synaptically released zinc: physiological functions and pathological effects. Biometals, 14(3), 353-366, doi: 10.1023/A:1012934207456. Thus, the use of zinc ions in pharmaceuticals for the treatment of neurodegenerative diseases, in particular Alzheimer's disease, is a non-trivial solution .
На сегодняшний день нет действующих эффективных препаратов, которые бы излечивали нейродегенеративные заболевания. Из научной и патентной литературы известны ряд пептидов, которые могли бы применяться при лечении таких заболеваний. To date, there are no current effective drugs that would cure neurodegenerative diseases. A number of peptides are known from the scientific and patent literature that could be used in the treatment of such diseases.
Из WO 2012/056157 и патента РФ № 2679080 известно соединение, представляющее собой Ac-HAEE-NH? (далее — НАЕЕ). В аббревиатуре НАЕЕ буквы означают: Н -гистидин, А - аланин, Е - глутаминовая кислота. НАЕЕ способно ингибировать взаимодействие пептидов АР с ионами Zn (II), вызывая уменьшение или предотвращение агрегации пептида А в присутствии ионов Zn (II) при физиологических концентрациях ионов Zn (II) 100-400 мкМ. Более высокие концентрации ионов Zn (II), порядка 1 ммоль (мМ), подавляют взаимодействия между НАЕЕ и 1-16 областью Ар. Было показано, что инкубация агрегатов Ар с НАЕЕ в течение минимум 1 часа при 20, 40, 80, 100 и 150 мкМ НАЕЕ приводит к дезагрегации таких агрегатов.
Из патента РФ № 2679059 известно, что несмотря на ингибирование образования амилоидных бляшек, влияние известных препаратов, в частности НАЕЕ, на улучшение когнитивных функций при болезни Альцгеймера в среднем является очень ограниченным и существует необходимость получения альтернативных эффективных средств для лечения болезни Альцгеймера, в том числе за счет снижения или предотвращения связывания ионов Zn(II) с пептидом Ар. В качестве альтернативного средства для лечения болезни Альцгеймера было предложено использовать пептид с аминокислотной последовательностью (в стандартных однобуквенных кодах) H[isoD][pS]GYEVHH (где isoD обозначает изомеризованный остаток аспарагиновой кислоты, a pS относится к фосфорилированному остатку серина) с открытыми или защищенными концами основной полипептидной цепи. From WO 2012/056157 and RF patent No. 2679080 a compound is known that is Ac-HAEE-NH? (hereinafter referred to as NAEE). In the abbreviation HAEE, the letters mean: H - histidine, A - alanine, E - glutamic acid. HAEE is capable of inhibiting the interaction of AP peptides with Zn(II) ions, causing a decrease or prevention of aggregation of peptide A in the presence of Zn(II) ions at physiological concentrations of Zn(II) ions of 100-400 μM. Higher concentrations of Zn(II) ions, on the order of 1 mmol (mM), suppress interactions between HAEE and the 1-16 region of Ap. It has been shown that incubation of Ap aggregates with HAEE for at least 1 hour at 20, 40, 80, 100 and 150 μM HAEE leads to disaggregation of such aggregates. From RF patent No. 2679059 it is known that despite the inhibition of the formation of amyloid plaques, the effect of known drugs, in particular HAEE, on improving cognitive functions in Alzheimer's disease is on average very limited and there is a need to obtain alternative effective drugs for the treatment of Alzheimer's disease, including by reducing or preventing the binding of Zn(II) ions to the Ap peptide. As an alternative treatment for Alzheimer's disease, it has been proposed to use a peptide with the amino acid sequence (in standard single-letter codes) H[isoD][pS]GYEVHH (where isoD refers to the isomerized aspartic acid residue and pS refers to the phosphorylated serine residue) with open or protected ends of the main polypeptide chain.
Из патента РФ № 2709539 известно, что короткие заряженные пептиды типа НАЕЕ имеют очень короткое время жизни в плазме крови (от нескольких секунд до нескольких минут) и с трудом проходят через гематоэнцефалический барьер (ГЭБ), что существенно ослабляет эффективность их терапевтического воздействия. С целью преодоления этих недостатков авторы патента РФ № 2709539 разработали фармацевтическую композицию для доставки НАЕЕ через ГЭБ для лечения нейродегенеративных заболеваний, включая деменцию Альцгеймеровского типа (болезнь Альцгеймера), которая позволяет улучшить фармакокинетические характеристики и увеличить био доступность НАЕЕ. From RF patent No. 2709539 it is known that short charged peptides of the HAEE type have a very short lifetime in the blood plasma (from several seconds to several minutes) and hardly pass through the blood-brain barrier (BBB), which significantly weakens the effectiveness of their therapeutic effects. In order to overcome these shortcomings, the authors of RF patent No. 2709539 have developed a pharmaceutical composition for the delivery of HAEE across the BBB for the treatment of neurodegenerative diseases, including dementia of the Alzheimer's type (Alzheimer's disease), which can improve the pharmacokinetic characteristics and increase the bioavailability of HAEE.
Данная композиция содержит эффективное количество субстанции в виде комплекса НАЕЕ с цинком и человеческим сывороточным альбумином (HAEE-Zn-HSA) в форме раствора для введения с фармацевтически приемлемым носителем, выбранным из круга нейтральных носителей и разбавителей, например, в физиологическом растворе. Полученная фармацевтическая композиция позволяет увеличить в пять раз биодоступность субстанции в мозге, увеличить время полувыведения из организма в два раза; улучшить когнитивные функции экспериментальных животных на 20%. This composition contains an effective amount of a substance in the form of a complex of HAEE with zinc and human serum albumin (HAEE-Zn-HSA) in the form of a solution for administration with a pharmaceutically acceptable carrier selected from a range of neutral carriers and diluents, for example, saline. The resulting pharmaceutical composition allows the bioavailability of the substance in the brain to be increased fivefold and the half-life from the body to be doubled; improve the cognitive functions of experimental animals by 20%.
Изобретение по патенту РФ № 2709539 было выбрано в качестве ближайшего аналога, поскольку только оно представляет собой единственный известный для НАЕЕ комплекс. Из патента РФ № 2709539 известно, что с человеческим альбумином (HSA) пептид НАЕЕ в присутствии ионов цинка образует специфический тройной комплекс (HAEE-Zn-HSA). При этом в отсутствии ионов цинка взаимодействий между НАЕЕ и HSA не наблюдалось. Данный комплекс характеризуется тем, что с помощью иона цинка удалось получить межмолекулярное связывание между молекулами НАЕЕ и HSA. Катион цинка является координирующим катионом между этими двумя молекулами. В твердом виде данный комплекс получен не был.
Из патента РФ № 2709539 известно, что фармацевтическая композиция HAEE-Zn- HSA является стабильной в подходящей водной буферной системе, в диапазоне значений pH от 4 до 8, в присутствии или в отсутствии различных солей. The invention according to RF patent No. 2709539 was chosen as the closest analogue, since it is the only complex known for HAEE. From RF patent No. 2709539 it is known that the HAEE peptide forms a specific ternary complex (HAEE-Zn-HSA) with human albumin (HSA) in the presence of zinc ions. However, in the absence of zinc ions, no interactions between HAEE and HSA were observed. This complex is characterized by the fact that with the help of a zinc ion it was possible to obtain intermolecular binding between the HAEE and HSA molecules. The zinc cation is the coordinating cation between these two molecules. This complex was not obtained in solid form. From RF patent No. 2709539 it is known that the pharmaceutical composition HAEE-Zn-HSA is stable in a suitable aqueous buffer system, in the pH range from 4 to 8, in the presence or absence of various salts.
Известно, что заряд альбумина в нейтральной среде равен -1, в щелочной среде равен -2, а в слабокислой среде равен 0 (изоэлектрическое состояние) и альбумин выпадает в осадок (Биохимия с упражнениями и задачами. Под ред. А.И. Глухова, Е.С. Северина. ГЭОТАР-Медиа, Москва. 2019. С.19), поэтому данный комплекс не должен существовать в слабокислой среде при pH 4-5,5. It is known that the charge of albumin in a neutral environment is -1, in an alkaline environment it is -2, and in a slightly acidic environment it is 0 (isoelectric state) and albumin precipitates (Biochemistry with exercises and tasks. Edited by A.I. Glukhov, E. S. Severina, GEOTAR-Media, Moscow, 2019, p. 19), therefore this complex should not exist in a slightly acidic environment at pH 4-5.5.
Из патента РФ № 2709539 известно, что для приготовления фармацевтической композиции HAEE-Zn-HSA, пригодной для проведения доклинических исследований, 5 мг НАЕЕ, 600 мг человеческого альбумина и 0,5 мг хлорида цинка (ZnCb) растворяли в 20 миллилитрах физиологического раствора. В качестве источника НАЕЕ использовался лиофилизированный препарат синтетического пептида НАЕЕ (чистота более 98%). При известной молекулярной массе НАЕЕ равной 525,52 г/моль соотношение компонентов в комплексе HAEE-Zn-HSA составляет примерно НАЕЕ : Zn : HSA ~ 1 : 2,6 : 1 по молям. From RF patent No. 2709539 it is known that to prepare the pharmaceutical composition HAEE-Zn-HSA, suitable for preclinical studies, 5 mg of HAEE, 600 mg of human albumin and 0.5 mg of zinc chloride (ZnCb) were dissolved in 20 milliliters of physiological solution. A lyophilized preparation of the synthetic HAEE peptide (purity more than 98%) was used as a source of HAEE. With the known molecular weight of HAEE equal to 525.52 g/mol, the ratio of components in the HAEE-Zn-HSA complex is approximately HAEE: Zn: HSA ~ 1: 2.6: 1 by moles.
Недостатком данного изобретения является высокое содержание человеческого альбумина, которое превышает в 120 раз по массе содержание активного вещества НАЕЕ, а также высокое содержание цинка, которое в 2,6 раза превышает по массе содержание активного вещества НАЕЕ и может привести к образованию комплекса с нестехиометрическим соотношением входящих в него компонентов. The disadvantage of this invention is the high content of human albumin, which is 120 times greater by weight than the content of the active substance HAEE, as well as the high content of zinc, which is 2.6 times greater by weight than the content of the active substance HAEE and can lead to the formation of a complex with a non-stoichiometric ratio of the constituents components into it.
Высокие концентрации человеческого альбумина могут оказывать различные негативные эффекты на организм как экспериментальных животных, так и человека (GalesHigh concentrations of human albumin can have various negative effects on the body in both experimental animals and humans (Gales
B.J., Erstad B.L. (1993). Adverse reactions to human serum albumin. Annals of Pharmacotherapy, 27(1), 87-94, doi: 10.1177/106002809302700119; Kremer H., Baron-MenguyB.J., Erstad B.L. (1993). Adverse reactions to human serum albumin. Annals of Pharmacotherapy, 27(1), 87-94, doi: 10.1177/106002809302700119; Kremer H., Baron-Menguy
C., Tesse A. et al. (2011). Human serum albumin improves endothelial dysfunction and survival during experimental endotoxemia: concentration-dependent properties. Critical care medicine, 39(6), 1414-1422, doi: 10.1097/CCM. ObO13e31821 lff6e). Некоторые образцы HSA, в отличие от бычьего сывороточного альбумина (BSA), при культивировании мышиных эмбрионов не доводили их до стадии бластоцисты (Leveille М.С., Carnegie J., Tanphaichitr N. (1992). Effects of human sera and human serum albumin on mouse embryo culture. Journal of assisted reproduction and genetics, 9(1), 45-52, doi: 10.1007/BF01204114). HSA может вызывать иммунный ответ у мышей после его введения (Favoretto В. С., Ricardi R., Silva, S.R. et al. (2011). Immunomodulatory effects of crotoxin isolated from Crotalus durissus terrificus venom in mice immunised with human serum albumin. Toxicon, 57(4), 600-607, doi: 10.1016/j .toxicon.2010.12.023).
Известно, что HSA может быть использован для улучшения когнитивных функций при лечении болезни Альцгеймера, однако только при интрацеребровентрикулярном (внутричерепном) введении. Введение HSA в плазму крови может снижать его эффективность (Ezra, A., Rabinovich-Nikitin, I., Rabinovich-Toidman, Р., & Solomon, В. (2016). Multifunctional effect of human serum albumin reduces Alzheimer’s disease related pathologies in the 3xTg mouse model. Journal of Alzheimer's Disease, 50(1), 175-188, doi: 10.3233/JAD- 150694). C., Tesse A. et al. (2011). Human serum albumin improves endothelial dysfunction and survival during experimental endotoxemia: concentration-dependent properties. Critical care medicine, 39(6), 1414-1422, doi: 10.1097/CCM. ObO13e31821 lff6e). Some samples of HSA, unlike bovine serum albumin (BSA), when culturing mouse embryos did not bring them to the blastocyst stage (Leveille M. S., Carnegie J., Tanphaichitr N. (1992). Effects of human sera and human serum albumin on mouse embryo culture. Journal of assisted reproduction and genetics, 9(1), 45-52, doi: 10.1007/BF01204114). HSA can induce an immune response in mice after its administration (Favoretto V. S., Ricardi R., Silva, S. R. et al. (2011). Immunomodulatory effects of crotoxin isolated from Crotalus durissus terrificus venom in mice immunised with human serum albumin. Toxicon , 57(4), 600-607, doi: 10.1016/j.toxicon.2010.12.023). It is known that HSA can be used to improve cognitive function in the treatment of Alzheimer's disease, but only when administered intracerebroventricularly (intracranial). Administration of HSA to blood plasma may reduce its effectiveness (Ezra, A., Rabinovich-Nikitin, I., Rabinovich-Toidman, R., & Solomon, V. (2016). Multifunctional effect of human serum albumin reduces Alzheimer's disease related pathologies in the 3xTg mouse model. Journal of Alzheimer's Disease, 50(1), 175-188, doi: 10.3233/JAD-150694).
Поэтому уменьшение количества человеческого альбумина или возможность полностью отказаться от него в лекарственном препарате, замена сложного и травмоопасного интрацеребровентрикулярного введения на внутривенное, при одновременном усилении терапевтического эффекта является важной медицинской задачей при лечении нейродегенеративных заболеваний. Therefore, reducing the amount of human albumin or the ability to completely eliminate it from a drug, replacing complex and traumatic intracerebroventricular administration with intravenous administration, while simultaneously enhancing the therapeutic effect, is an important medical task in the treatment of neurodegenerative diseases.
Ранее НАЕЕ и комплекс HAEE-Zn-HSA не характеризовались в твердой фазе и их свойства в твердой фазе неизвестны. HAEE and the HAEE-Zn-HSA complex have not previously been characterized in the solid phase and their properties in the solid phase are unknown.
Таким образом, задачи, на решение которых направлено изобретение, заключаются в получении нового эффективного цинкового комплекса пептида НАЕЕ для лечения нейродегенеративных заболеваний, в том числе в твердой форме, разработке фармацевтических композиций на его основе и его применении для лечения нейродегенеративных заболеваний. Thus, the tasks to be solved by the invention are to obtain a new effective zinc complex of the HAEE peptide for the treatment of neurodegenerative diseases, including in solid form, to develop pharmaceutical compositions based on it and its use for the treatment of neurodegenerative diseases.
В соответствии с настоящим изобретением описывается цинковый комплекс пептида НАЕЕ для лечения нейродегенеративных заболеваний, который описывается формулой [Zn(HAEE)]mXn, где Zn представляет собой двухзарядный катион цинка (II), m = 1 для однозарядных и двухзарядных анионов, m = 2 для трехзарядных анионов, НАЕЕ представляет собой синтетический пептид, ацетилированный по N-концу и амидированный по С-концу, с аминокислотной последовательностью His-Ala-Glu-Glu, X - фармацевтически приемлемый анион, n = 1 для двухзарядных анионов, п = 2 для однозарядных и трехзарядных анионов. The present invention discloses a zinc complex of the HAEE peptide for the treatment of neurodegenerative diseases, which is described by the formula [Zn(HAEE)] m X n where Zn is a doubly charged zinc(II) cation, m = 1 for singly and doubly charged anions, m = 2 for triply charged anions, HAEE is a synthetic peptide, acetylated at the N-terminus and amidated at the C-terminus, with the amino acid sequence His-Ala-Glu-Glu, X is a pharmaceutically acceptable anion, n = 1 for doubly charged anions, n = 2 for singly and triply charged anions.
В описываемом комплексе мольное содержание катиона цинка (II) и пептида НАЕЕ является эквимолярным (1:1). Таким образом, если X является однозарядным анионом, то заявляемый цинковый комплекс пептида НАЕЕ описывается формулой [Zn(HAEE)]X2. Если X является двухзарядным анионом, то заявляемый цинковый комплекс пептида НАЕЕ описывается формулой [Zn(HAEE)]X. Если X является трёхзарядным анионом, то заявляемый цинковый комплекс пептида НАЕЕ описывается формулой [Хп(НАЕЕ)]зХг. In the described complex, the molar content of zinc(II) cation and HAEE peptide is equimolar (1:1). Thus, if X is a singly charged anion, then the claimed zinc complex of the HAEE peptide is described by the formula [Zn(HAEE)]X2. If X is a doubly charged anion, then the claimed zinc complex of the HAEE peptide is described by the formula [Zn(HAEE)]X. If X is a triply charged anion, then the claimed zinc complex of the HAEE peptide is described by the formula [Xn(HAEE)]3Xg.
Взаимодействие пептида НАЕЕ с цинком наблюдалось и при других молярных соотношениях НАЕЕ : Zn, а именно, в диапазоне от 1:0,1 до 1:10, что связано с наличием
множества донорно-акцепторных центров (азот, кислород) в молекуле НАЕЕ и взаимодействие между НАЕЕ и Zn может быть нестехиометрическим. Использование более высокого содержания цинка (>1:10) приводили к получению в твердой форме смеси из цинкового комплекса пептида НАЕЕ и соответствующей соли цинка, при использование малого количества цинка (<1 :0, 1 ) его взаимодействие с пептидом НАЕЕ не фиксировали физико-химическими методами. The interaction of the HAEE peptide with zinc was also observed at other molar ratios of HAEE: Zn, namely, in the range from 1:0.1 to 1:10, which is due to the presence there are many donor-acceptor centers (nitrogen, oxygen) in the HAEE molecule and the interaction between HAEE and Zn can be non-stoichiometric. The use of a higher zinc content (>1:10) led to the production in solid form of a mixture of the zinc complex of the HAEE peptide and the corresponding zinc salt; when using a small amount of zinc (<1:0.1), its interaction with the HAEE peptide was not detected physically. chemical methods.
В настоящем изобретении было обнаружено, что для усиления терапевтического действия пептида НАЕЕ для лечения нейроденегеративных заболеваний, в частности опосредованно вызываемых воспалительными причинами, нет необходимости использования одновременно ионов цинка и человеческого альбумина. Для улучшения когнитивных функций, нарушенных вследствие нейродегенеративных заболеваний, достаточным является использование только пептида НАЕЕ и цинка в одном комплексе без необходимости использования высоких количеств человеческого альбумина. Также, если использование HAEE-Zn-HSA улучшает фармакокинетические параметры пептида НАЕЕ, то в настоящем изобретении использование цинкового комплекса пептида НАЕЕ для лечения нейродегенеративных заболеваний изменяет механизм действия пептида НАЕЕ, связанный с конформационной структурой пептида НАЕЕ, что приводит к неожиданно высокому терапевтическому эффекту. In the present invention, it has been found that in order to enhance the therapeutic effect of the HAEE peptide for the treatment of neurodegenerative diseases, in particular those indirectly caused by inflammatory causes, it is not necessary to use both zinc ions and human albumin. To improve cognitive functions impaired due to neurodegenerative diseases, it is sufficient to use only HAEE peptide and zinc in one complex without the need to use high amounts of human albumin. Also, if the use of HAEE-Zn-HSA improves the pharmacokinetic parameters of the HAEE peptide, then in the present invention the use of the zinc complex of the HAEE peptide for the treatment of neurodegenerative diseases changes the mechanism of action of the HAEE peptide associated with the conformational structure of the HAEE peptide, which leads to an unexpectedly high therapeutic effect.
Это подтверждается экспериментальным введением нативного пептида НАЕЕ и полученного по данному изобретению цинкового комплекса пептида НАЕЕ в организм экспериментальных животных. Было обнаружено, что 3D -структура нативного пептида НАЕЕ, который в виде водного раствора был помещён на 2 минуты в плазму крови мышей дикого типа, отличается от ЗИ-структуры нативного НАЕЕ в исходном водном растворе, что подтверждается методом ВЭЖХ по изменению времени выхода с хроматографической колонки пробы НАЕЕ, экстрагированной из плазмы крови, относительно времени выхода пробы НАЕЕ, экстрагированной из исходного водного раствора. В то же время 3 D-структура цинкового комплекса пептида НАЕЕ оставалась неизменной в аналогичных экспериментальных условиях (то есть после экстрагирования из исходного водного раствора цинкового комплекса пептида НАЕЕ и после экстрагирования из плазмы крови мышей дикого типа после 2-х минутной экспозиции) и соответствовала 3 D-структуре нативного пептида НАЕЕ, экстрагированного из исходного водного раствора. По данным масс-спектрометрии химическая структура пептида НАЕЕ во всех экспериментальных пробах сохранялась неизменной как для нативного пептида, так и для пептида в составе цинкового комплекса. Изменение времени выхода нативного пептида НАЕЕ или цинкового комплекса пептида НАЕЕ с хроматографической колонки
связано в основном с различиями в гидрофобных взаимодействиях пептида НАЕЕ с материалом колонки, а эти взаимодействия в свою очередь определяются превалирующей ЗВ-структурой пептида НАЕЕ в конкретной пробе. Таким образом, из полученных экспериментальных данных следует, что ЗВ-структура пептида НАЕЕ, которая соответствует «развёрнутой» конформации пептида и является превалирующей для нативного пептида НАЕЕ в исходном водном растворе, соответствует ЗВ-структуре цинкового комплекса пептида НАЕЕ в водном растворе и остаётся неизменной в случае экспозиции цинкового комплекса пептида НАЕЕ в плазме крови, в то время как нативный пептид НАЕЕ в плазме крови утрачивает «развёрнутую» конформацию. This is confirmed by the experimental introduction of the native HAEE peptide and the zinc complex of the HAEE peptide obtained according to this invention into the body of experimental animals. It was found that the 3D structure of the native HAEE peptide, which in the form of an aqueous solution was placed for 2 minutes in the blood plasma of wild-type mice, differs from the 3D structure of native HAEE in the original aqueous solution, which is confirmed by HPLC by changing the time of release from chromatographic column of the HAEE sample extracted from blood plasma, relative to the time of release of the HAEE sample extracted from the original aqueous solution. At the same time, the 3 D structure of the zinc complex of the HAEE peptide remained unchanged under similar experimental conditions (that is, after extraction from the initial aqueous solution of the zinc complex of the HAEE peptide and after extraction from the blood plasma of wild-type mice after a 2-minute exposure) and corresponded to 3 D-structure of the native HAEE peptide extracted from the original aqueous solution. According to mass spectrometry data, the chemical structure of the HAEE peptide in all experimental samples remained unchanged for both the native peptide and the peptide in the zinc complex. Change in the release time of the native HAEE peptide or the zinc complex of the HAEE peptide from the chromatographic column is mainly due to differences in the hydrophobic interactions of the HAEE peptide with the column material, and these interactions, in turn, are determined by the prevailing EB structure of the HAEE peptide in a particular sample. Thus, from the experimental data obtained, it follows that the GS structure of the HAEE peptide, which corresponds to the “unfolded” conformation of the peptide and is prevalent for the native HAEE peptide in the original aqueous solution, corresponds to the GS structure of the zinc complex of the HAEE peptide in an aqueous solution and remains unchanged in the case of exposure of the zinc complex of the HAEE peptide in the blood plasma, while the native HAEE peptide in the blood plasma loses its “unfolded” conformation.
В данном случае термин ЗВ-структура используется как синоним пространственной структуры или взаимного расположения атомов в молекуле НАЕЕ в трехмерном пространстве. Метод ВЭЖХ основан на преимущественно межмолекулярных взаимодействиях на границе раздела фаз. Изменение времени выхода НАЕЕ с хроматографической колонки отражает изменение межмолекулярных взаимодействий НАЕЕ с сорбентом, что является следствием различий пространственной структуры молекул НАЕЕ в нативном состоянии и в виде цинкового комплекса. In this case, the term SV structure is used as a synonym for spatial structure or the relative arrangement of atoms in the HAEE molecule in three-dimensional space. The HPLC method is based primarily on intermolecular interactions at the interface. The change in the release time of HAEE from the chromatographic column reflects a change in the intermolecular interactions of HAEE with the sorbent, which is a consequence of differences in the spatial structure of HAEE molecules in the native state and in the form of a zinc complex.
Известно, что нарушение ЗВ-структуры олигопептидов может приводить к снижению их функций и уменьшению терапевтического действия (Sikora, К., Jaskiewicz, М., Neubauer, В., Migon, В., & Kamysz, W. (2020). The role of counter-ions in peptides — an overview. Pharmaceuticals, 13(12), 442.). Ранее было показано, что для оптимального взаимодействия с партнёрами белковой природы пептид НАЕЕ должен находиться в «развёрнутой» конформации (Barykin Е. Р., Garifulina A. I., Tolstova А. Р., Anashkina А. А., Adzhubei A. A., Mezentsev Y. V., Shelukhina I. V., Kozin S. A., Tsetlin V. I., Makarov A. A. Tetrapeptide Ac-HAEE-NH(2) Protects a402 nAChR from Inhibition by A // International journal of molecular sciences. - 2020. - T. 21, № 17. - C. 6272; Zolotarev YA, Mitkevich VA, Shram SI, Adzhubei AA, Tolstova AP, Talibov OB, Badayan AK, Myasoyedov NF, Makarov AA, Kozin SA. Pharmacokinetics and Molecular Modeling Indicate nAChRa4-Berived Peptide HAEE Goes through the Blood-Brain Barrier. Biomolecules. 2021 Jim 18;11(6):909). В нативном пептиде НАЕЕ имидазольная группа аминокислотного остатка гистидина может образовывать стабильные полярные связи с карбоксильными группами боковых цепей аминокислотных остатков глутаминовой кислоты, что не способствует поддержанию биологически значимой «развёрнутой» конформации данного пептида и, как следствие, снижает полезные терапевтические эффекты НАЕЕ.
Таким образом, одним из преимуществ данного изобретения является повышение терапевтической эффективности цинкового комплекса пептида НАЕЕ вследствие сохранения ЗБ-структуры данного комплекса в «развернутой» конформации. It is known that disruption of the EG structure of oligopeptides can lead to a decrease in their functions and a decrease in therapeutic effect (Sikora, K., Jaskiewicz, M., Neubauer, V., Migon, V., & Kamysz, W. (2020). The role of counter-ions in peptides - an overview. Pharmaceuticals, 13(12), 442.). It was previously shown that for optimal interaction with protein partners, the HAEE peptide must be in an “unfolded” conformation (Barykin E. R., Garifulina A. R., Tolstova A. R., Anashkina A. A., Adzhubei A. A., Mezentsev Y. V., Shelukhina IV, Kozin SA, Tsetlin VI, Makarov AA Tetrapeptide Ac-HAEE-NH(2) Protects a402 nAChR from Inhibition by A // International journal of molecular sciences. - 2020. - T. 21, No. 17. - P. 6272; Zolotarev YA, Mitkevich VA, Shram SI, Adzhubei AA, Tolstova AP, Talibov OB, Badayan AK, Myasoyedov NF, Makarov AA, Kozin SA. Pharmacokinetics and Molecular Modeling Indicate nAChRa4-Berived Peptide HAEE Goes through the Blood-Brain Barrier. Biomolecules. 2021 Jim 18;11(6):909). In the native HAEE peptide, the imidazole group of the histidine amino acid residue can form stable polar bonds with the carboxyl groups of the side chains of glutamic acid amino acid residues, which does not contribute to maintaining the biologically significant “unfolded” conformation of this peptide and, as a result, reduces the beneficial therapeutic effects of HAEE. Thus, one of the advantages of this invention is to increase the therapeutic effectiveness of the zinc complex of the HAEE peptide due to the preservation of the 3B structure of this complex in the “unfolded” conformation.
Также было обнаружено, что введение в плазму крови мышей комплекса HAEE-Zn- HSA, полученного по описанному в патенте РФ № 2709539 способу, приводит к их стрессу, изменению внешнего вида и даже гибели, что может быть связано с высокой массовой концентрацией HSA в этом комплексе. Напротив, введение в плазму крови здоровых мышей цинкового комплекса пептида НАЕЕ не приводило к каким-либо нарушениям в поведении и в физическом состоянии животных по сравнению с животными контрольной группы, которым вводился физиологический раствор, что указывает на отсутствие побочных эффектов цинкового комплекса пептида НАЕЕ и является дополнительным преимуществом настоящего изобретения. It was also found that the introduction of the HAEE-Zn-HSA complex into the blood plasma of mice, obtained according to the method described in RF patent No. 2709539, leads to their stress, changes in appearance and even death, which may be due to the high mass concentration of HSA in this complex. On the contrary, the introduction of the zinc complex of the HAEE peptide into the blood plasma of healthy mice did not lead to any disturbances in the behavior and physical condition of the animals compared to animals in the control group that were injected with saline, which indicates the absence of side effects of the zinc complex of the HAEE peptide and is an additional advantage of the present invention.
Таким образом, отличием настоящего изобретения от ближайшего аналога, патента РФ № 2709539, состоит в том, что заявляемый цинковый комплекс не содержит HSA, молярная концентрация ионов цинка в этом комплексе снижена по сравнению с комплексом HAEE-Zn-HSA с 2,6, как описано в примере патента РФ № 2709539, до 1 (эквимолярное количество), как описано в настоящем изобретении. Thus, the difference between the present invention and its closest analogue, RF patent No. 2709539, is that the claimed zinc complex does not contain HSA, the molar concentration of zinc ions in this complex is reduced compared to the HAEE-Zn-HSA complex with 2.6, as described in the example of RF patent No. 2709539, up to 1 (equimolar amount), as described in the present invention.
Изобретение также имеет отношение к применению цинкового комплекса для лечения нейродегенеративных заболеваний, а также патологий, сопровождающихся нейровоспалительными процессами. Заявляемый цинковый комплекс может эффективно влиять на нейродегенеративные заболевания, в частности, вызванные воспалительными причинами, восстанавливая нарушенные когнитивные функции. The invention also relates to the use of a zinc complex for the treatment of neurodegenerative diseases, as well as pathologies accompanied by neuroinflammatory processes. The inventive zinc complex can effectively influence neurodegenerative diseases, in particular those caused by inflammatory causes, restoring impaired cognitive functions.
Цинковый комплекс может быть использован как в твердой, так и в жидкой форме, сохраняя свою стабильность в течение по меньшей мере 2 лет. Zinc complex can be used in either solid or liquid form and remains stable for at least 2 years.
Техническим результатом изобретения является: The technical result of the invention is:
- возможность использования заявляемого цинкового комплекса при лечении нейродегенеративных заболеваний, в частности вызванных опосредованно воспалительными причинами, которое приводит к эффективному восстановлению когнитивных функций; - the possibility of using the claimed zinc complex in the treatment of neurodegenerative diseases, in particular those caused indirectly by inflammatory causes, which leads to the effective restoration of cognitive functions;
- повышенная стабильность заявляемого цинкового комплекса по сравнению с НАЕЕ; - increased stability of the proposed zinc complex compared to HAEE;
- устойчивость «развернутой» конформации 3 D-структуры заявляемого цинкового комплекса в плазме крови по сравнению с НАЕЕ; - stability of the “unfolded” conformation of the 3 D-structure of the proposed zinc complex in blood plasma compared to HAEE;
- отсутствие побочных эффектов у заявляемого цинкового комплекса по сравнению с HAEE-Zn-HSA.
Заявляемый в настоящем изобретении цинковый комплекс в соответствии с используемым способом получения может быть получен в аморфной форме, что подтверждается рентгенофазовым анализом (Фиг. 1 ,2). - absence of side effects from the proposed zinc complex compared to HAEE-Zn-HSA. The zinc complex claimed in the present invention, in accordance with the production method used, can be obtained in an amorphous form, which is confirmed by X-ray phase analysis (Fig. 1, 2).
Сравнение данных рентгенофазового анализа комплекса HAEE-Zn-HSA нецелесообразно, поскольку при соотношении масс HSA:HAEE ~ 120 на дифрактограмме будет представлен только HSA, а вещество НАЕЕ будет представлено в виде минорной примеси, не проявляющейся на дифрактограмме. Comparison of X-ray phase analysis data for the HAEE-Zn-HSA complex is impractical, since with a mass ratio of HSA:HAEE ~ 120, only HSA will be represented in the diffraction pattern, and the HAEE substance will be presented as a minor impurity that does not appear in the diffraction pattern.
Цинковый комплекс характеризуется кривой дифференциальной сканирующей калориметрии (ДСК) с термогравиометрией (ТГ) (ДСК-ТГА). Молекула НАЕЕ на ДСК- кривой характеризуется: широким пиком с началом при 62 °C и максимумом при 89 °C; двойным пиком плавления при температуре 203 и 227,5 °C с началом при 188 °C (Фиг. 3). Погрешность при многократном измерении оценивается в ± 3 °C. Заявляемый цинковый комплекс на ДСК-кривой характеризуется: широким пиком с началом при 62 °C и максимумом при 87 °C; широким пиком плавления с началом при 224 °C и максимумом при 255 °C (Фиг. 4). The zinc complex is characterized by a differential scanning calorimetry (DSC) thermograviometry (TG) curve (DSC-TGA). The HAEE molecule on the DSC curve is characterized by: a broad peak with an onset at 62 °C and a maximum at 89 °C; a double melting peak at 203 and 227.5 °C with an onset at 188 °C (Figure 3). The error for multiple measurements is estimated at ± 3 °C. The claimed zinc complex on the DSC curve is characterized by: a wide peak with an onset at 62 °C and a maximum at 87 °C; a broad melting peak with an onset at 224 °C and a maximum at 255 °C (Fig. 4).
ДСК-кривые показывают, что температура плавления цинкового комплекса выше по сравнению с температурой плавления НАЕЕ, что обеспечивает более высокую стабильность комплекса, что подтверждается результатами теста ускоренного хранения. DSC curves show that the melting point of the zinc complex is higher compared to the melting point of HAEE, which provides higher stability of the complex, as confirmed by the results of the accelerated storage test.
Сравнение данных ДСК-анализа комплекса HAEE-Zn-HSA нецелесообразно, поскольку при соотношении масс HSA:HAEE > 120 на ДСК-кривой будет представлен только HSA, а вещество НАЕЕ представлено в виде минорной примеси, не проявляющейся на ДСК-кривой. Comparison of DSC analysis data for the HAEE-Zn-HSA complex is impractical, since with a mass ratio of HSA:HAEE > 120, only HSA will be represented on the DSC curve, and the HAEE substance is presented as a minor impurity that does not appear on the DSC curve.
ИК-спектр с Фурье преобразованием заявляемого цинкового комплекса представлен на Фиг. 5. ИК-спектр комплекса повторяет все основные линии ИК-спектра НАЕЕ. Отличиями в полосах колебаний комплекса по сравнению с НАЕЕ и проявлением их в ИК-спектре являются смещение максимума при ИЗО см 1 в область 1115 см’1 (C-N вал.) и новый максимум при 970 см'1. Таким образом цинковый комплекс, на примере ацетата, отличается от НАЕЕ наличием максимумов при 1115 см’1 и 970 см'1. The IR spectrum with Fourier transform of the claimed zinc complex is presented in Fig. 5. The IR spectrum of the complex repeats all the main lines of the HAEE IR spectrum. The differences in the vibration bands of the complex compared to HAEE and their manifestation in the IR spectrum are the shift of the maximum at ISO cm 1 to the region of 1115 cm' 1 (CN val.) and a new maximum at 970 cm' 1 . Thus, the zinc complex, using acetate as an example, differs from HAEE by the presence of maxima at 1115 cm' 1 and 970 cm' 1 .
Сравнение ИК-спектра комплекса HAEE-Zn-HSA нецелесообразно, поскольку при соотношении масс HSA:HAEE > 120 на ИК-спектре будет представлен только HSA, а вещество НАЕЕ представлено в виде минорной примеси, не проявляющейся на ИК- спектре. Comparison of the IR spectrum of the HAEE-Zn-HSA complex is impractical, since with a mass ratio of HSA:HAEE > 120, only HSA will be represented in the IR spectrum, and the HAEE substance is presented as a minor impurity that does not appear in the IR spectrum.
Заявляемый цинковый комплекс может быть получен в виде лиофилизата методом стандартной сублимационной (лиофильной) сушки.
Получение цинкового комплекса заключается в смешивании водных растворов НАЕЕ и водорастворимой цинковой соли в эквимолярных соотношениях при комнатной температуре, перемешивании в течение 10-60 мин, замораживании раствора и лиофильном высушивании. The inventive zinc complex can be obtained in the form of a lyophilisate using standard freeze-drying. Preparation of the zinc complex consists of mixing aqueous solutions of HAEE and water-soluble zinc salt in equimolar ratios at room temperature, stirring for 10-60 minutes, freezing the solution and freeze-drying.
Водорастворимые цинковые соли представляют собой нитрат, сульфат, ацетат и хлорид цинка. Для получения цинкового комплекса с другим фармацевтически приемлемым анионом, после перемешивания раствора и перед замораживанием проводится анионно-обменная хроматография или диализ, для удаления первичного аниона. После чего в раствор добавляется другой соответствующий фармацевтически приемлемый анион, раствор замораживается и лиофильно высушивается. Water-soluble zinc salts are zinc nitrate, sulfate, acetate and zinc chloride. To obtain a zinc complex with another pharmaceutically acceptable anion, after stirring the solution and before freezing, anion exchange chromatography or dialysis is performed to remove the primary anion. Another appropriate pharmaceutically acceptable anion is then added to the solution, the solution is frozen and freeze-dried.
Анионы могут быть одно-, дву- или трехзарядными и выбираться из группы сульфата, ацетата, бензоата, нитрата, салицилата, тартрата, цитрата. Необходимость удаления анионов из раствора обусловлена заменой одного аниона на другой анион. Наличие анионов разной природы в составе комплекса в жидкой или в твердой фазе не влияет на терапевтическую эффективность цинкового комплекса. Предполагается, что только внутренняя сфера цинкового комплекса проявляет терапевтическую эффективность независимо от природы аниона. Anions can be single-, double- or triple-charged and selected from the group of sulfate, acetate, benzoate, nitrate, salicylate, tartrate, citrate. The need to remove anions from a solution is due to the replacement of one anion with another anion. The presence of anions of different nature in the composition of the complex in the liquid or solid phase does not affect the therapeutic effectiveness of the zinc complex. It is assumed that only the inner sphere of the zinc complex exhibits therapeutic efficacy, regardless of the nature of the anion.
Также анионы для цинкового комплекса выбираются из группы глюконата, лактата, трифторацетата, пирувата, галактуроната, бромида, глутарата, сукцината, малеата, фумарата, бензолсульфоната, тозилата и других фармацевтически приемлемых анионов. Also, the anions for the zinc complex are selected from the group of gluconate, lactate, trifluoroacetate, pyruvate, galacturonate, bromide, glutarate, succinate, maleate, fumarate, benzenesulfonate, tosylate and other pharmaceutically acceptable anions.
Использование каждого из вышеперечисленных анионов для получения цинкового комплекса в твердой фазе методом сублимационной сушки показало, что в таком комплексе может частично оставаться гидратированная или связанная вода, однако, данный комплекс не набирает дополнительную воду при хранении и стабилен в течение длительного времени. The use of each of the above anions to obtain a zinc complex in the solid phase by freeze-drying has shown that such a complex may partially retain hydrated or bound water, however, this complex does not accumulate additional water during storage and is stable for a long time.
Еще одним объектом изобретения является фармацевтические композиции с эффективным количеством цинкового комплекса и наличием вспомогательных веществ. В качестве лекарственного средства цинковый комплекс может быть использован без вспомогательных веществ в виде лиофилизированной субстанции. Another object of the invention is pharmaceutical compositions with an effective amount of zinc complex and the presence of excipients. As a medicine, the zinc complex can be used without excipients in the form of a lyophilized substance.
Эффективное количество цинкового комплекса зависит от типа нейродегенеративного заболевания, веса тела, способа введения, поэтому может варьироваться в широких пределах от 0,1 до 100 мг, более желательно от 5 до 50 мг. The effective amount of zinc complex depends on the type of neurodegenerative disease, body weight, route of administration, and can therefore vary widely from 0.1 to 100 mg, more preferably from 5 to 50 mg.
Фармацевтическая композиция цинкового комплекса может быть в твердом виде или в виде водного раствора. Твердые композиции цинкового комплекса содержат его
эффективное количество и необязательно вспомогательные вещества. Твердая фармацевтическая композиция может быть получена лиофилизацией цинкового комплекса и набором вспомогательных компонентов или добавлением вспомогательных веществ к лиофилизированному цинковому комплексу. The pharmaceutical composition of the zinc complex may be in solid form or in the form of an aqueous solution. Solid compositions of zinc complex contain it effective amount and optional excipients. The solid pharmaceutical composition can be prepared by lyophilizing the zinc complex and a set of excipients or adding excipients to the lyophilized zinc complex.
Лиофилизированной цинковый комплекс может быть в аморфной форме, которая соответствует дифрактограмме на Фиг. 1,2. The lyophilized zinc complex can be in an amorphous form, which corresponds to the diffraction pattern in Fig. 1.2.
Вспомогательные вещества выбираются из фармацевтически приемлемых добавок. Такими веществами могут быть маннитол, повидон К 17, трометамол, динатрия эдетат, натрия хлорид, сахароза, гистидин, полоксамер 407, и другие фармацевтически приемлемые добавки. Excipients are selected from pharmaceutically acceptable additives. Such substances may be mannitol, povidone K 17, trometamol, disodium edetate, sodium chloride, sucrose, histidine, poloxamer 407, and other pharmaceutically acceptable additives.
Фармацевтическая композиция цинкового комплекса в виде водного раствора содержат эффективное количество цинкового комплекса, воду, а также набор фармацевтически приемлемых добавок и солей. Такими веществами могут быть маннитол, повидон К 17, трометамол, динатрия эдетат, натрия хлорид, сахароза, гистидин, полоксамер 407, и другие фармацевтически приемлемые добавки. The pharmaceutical composition of the zinc complex in the form of an aqueous solution contains an effective amount of the zinc complex, water, as well as a set of pharmaceutically acceptable additives and salts. Such substances may be mannitol, povidone K 17, trometamol, disodium edetate, sodium chloride, sucrose, histidine, poloxamer 407, and other pharmaceutically acceptable additives.
Еще одним объектом изобретения является применение цинкового комплекса для лечения нейродегенеративных заболеваний, которое заключается во введении цинкового комплекса в составе описанных фармацевтических композиций пациенту в эффективном количестве. Эффективное количество цинкового комплекса зависит от типа нейродегенеративного заболевания, веса тела, способа введения, поэтому может варьироваться в широких пределах от 0,1 до 100 мг, предпочтительно от 5 до 50 мг. Another object of the invention is the use of a zinc complex for the treatment of neurodegenerative diseases, which consists of administering a zinc complex as part of the described pharmaceutical compositions to a patient in an effective amount. The effective amount of zinc complex depends on the type of neurodegenerative disease, body weight, route of administration, and can therefore vary widely from 0.1 to 100 mg, preferably from 5 to 50 mg.
Введение цинкового комплекса пациенту может осуществляться с помощью всех возможных видов наружного, энтерального, ингаляционного и парентерального способов применения (включая внутривенное, внутриартериальное, внутрибрюшинное, подкожное, накожное, трансдермальное, внутримышечное, интратекальное, субарахноидальное, пероральное, интраназальное, сублингвальное, буккальное, ректальное введение). При введении цинкового комплекса в твердой форме предпочтительным способом введения является сублингвальный. При введении цинкового комплекса в форме раствора предпочтительными способами введения являются внутривенный и интраназальный. Administration of the zinc complex to the patient can be carried out using all possible types of external, enteral, inhalation and parenteral administration (including intravenous, intraarterial, intraperitoneal, subcutaneous, cutaneous, transdermal, intramuscular, intrathecal, subarachnoid, oral, intranasal, sublingual, buccal, rectal administration ). When administering zinc complex in solid form, the preferred route of administration is sublingual. When administering the zinc complex in solution form, the preferred routes of administration are intravenous and intranasal.
Возможность терапевтического лечения нейродегенеративных заболеваний была показана на примере болезни Альцгеймера, смоделированной на трансгенных мышах линии APPswe/PSENldE9 (APP/PS1) (Jankowsky, J. L., Slunt, H. H., Ratovitski, T., Jenkins, N. A., Copeland, N. G., & Borchelt, D. R. (2001). Co-expression of multiple transgenes in mouse CNS: a comparison of strategies. Biomolecular engineering, 17(6), 157-165, doi: 10.1016/S1389-0344(01)00067-3), которые проявляют характерные когнитивные признаки
патологии. Данная модель может считаться моделью опосредованного воспалительного действия при нарушении когнитивных функций. The possibility of therapeutic treatment of neurodegenerative diseases has been demonstrated in the example of Alzheimer's disease modeled in transgenic mice of the APPswe/PSENldE9 (APP/PS1) line (Jankowsky, JL, Slunt, HH, Ratovitski, T., Jenkins, NA, Copeland, NG, & Borchelt, DR (2001). Co-expression of multiple transgenes in mouse CNS: a comparison of strategies. Biomolecular engineering, 17(6), 157-165, doi: 10.1016/S1389-0344(01)00067-3), which exhibit characteristic cognitive signs pathology. This model can be considered a model of indirect inflammatory action in cognitive impairment.
В настоящем изобретении цинковый комплекс [Zn(HAEE)](Ac)2, вводили шестикратно внутривенно в дозе 0,05 мг/кг, после чего проводили валидный тест на когнитивные способности «Закапывание шариков» (англ. Marble Burying Test) [Santana- Santana M., Bayascas J.R., Gimenez-Llort L. (2021). Sex-Dependent Signatures, Time Frames and Longitudinal Fine-Tuning of the Marble Burying Test in Normal and AD-Pathological Aging Mice. Biomedicines, 9(8), 994, doi: 10.3390/biomedicines9080994), определяя количество более чем на 2/3 закопанных шариков в процентах от общего количества шариков. Чем больше количество закопанных шариков (КЗШ), тем выше когнитивные способности у мышей. In the present invention, the zinc complex [Zn(HAEE)](Ac)2 was administered six times intravenously at a dose of 0.05 mg/kg, after which a valid test for cognitive abilities “Marble Burying Test” [Santana- Santana M., Bayascas J. R., Gimenez-Llort L. (2021). Sex-Dependent Signatures, Time Frames and Longitudinal Fine-Tuning of the Marble Burying Test in Normal and AD-Pathological Aging Mice. Biomedicines, 9(8), 994, doi: 10.3390/biomedicines9080994), quantifying more than 2/3 of the buried beads as a percentage of the total number of beads. The greater the number of buried balls (BPS), the higher the cognitive abilities of mice.
По результатам тестирования у контрольной группы мышей дикого типа, которым вводили физиологический раствор, значение КЗШ равнялось 50,6 ±13,3 %. Это значение принималось в качестве референсного. У контрольной группы трансгенных мышей линии APP/PS1, которым вводили физиологический раствор, значение КЗШ = 12,6 ±4,2 %, что указывает на сильное ухудшение поведенческих рефлексов трансгенных мышей линии APP/PS1 по сравнению с животными дикого типа и отражает инвалидизирующее влияние оверэкспрессии человеческого бета-амилоида, ассоциированное с нейроваоспалением и образования амилоидных бляшек, на процессы нервной деятельности. Трансгенные мыши линии APP/PS 1 , инъецированные препаратами НАЕЕ или цинкового комплекса, показали значения КЗШ = 20,6 ±7,3(%) или КЗШ = 45,6 ±11,9(%), соответственно. Эти данные свидетельствуют о том, что использование цинкового комплекса существенно улучшает поведенческие рефлексы трансгенных мышей APP/PS1, а эффект от этого использования значительно превышает таковой, наблюдаемый для НАЕЕ. According to the results of testing in the control group of wild-type mice, which were injected with saline, the value of the CR was 50.6 ± 13.3%. This value was taken as a reference value. In the control group of transgenic mice of the APP/PS1 line, which were injected with saline, the value of the CVS = 12.6 ± 4.2%, which indicates a strong deterioration in the behavioral reflexes of transgenic mice of the APP/PS1 line compared to wild-type animals and reflects the disabling effect overexpression of human beta-amyloid, associated with neuroinflammation and the formation of amyloid plaques, on the processes of nervous activity. Transgenic mice of the APP/PS 1 line, injected with HAEE or zinc complex preparations, showed values of NRS = 20.6 ± 7.3 (%) or NRS = 45.6 ± 11.9 (%), respectively. These data indicate that the use of a zinc complex significantly improves the behavioral reflexes of APP/PS1 transgenic mice, and the effect of this use is significantly greater than that observed for HAEE.
Таким образом, заявляемый цинковый комплекс может эффективно применяться при лечении нейродегенеративных заболеваний, в частности вызванными воспалительными осложнениями, восстанавливая когнитивные функции до нормального состояния. Thus, the claimed zinc complex can be effectively used in the treatment of neurodegenerative diseases, in particular those caused by inflammatory complications, restoring cognitive functions to normal.
Гистохимический анализ области гиппокампа головного мозга экспериментальных мышей показал, что число бляшек (ЧБ) на один срез мозга у контрольной группы диких мышей равно нулю, у контрольной группы трансгенных мышей APP/PS1 значение ЧБ оказалось равным 31,7 ± 4,9, в группе получавших НАЕЕ значение ЧБ составило 24,7 ± 3,4, в группе получавших цинковый комплекс значение ЧБ составило 8,2 ±2,9. Histochemical analysis of the hippocampal region of the brain of experimental mice showed that the number of plaques (PB) per brain section in the control group of wild mice was zero, in the control group of transgenic APP/PS1 mice the PB value was 31.7 ± 4.9, in the group those receiving HAEE, the BF value was 24.7 ± 3.4; in the group receiving the zinc complex, the BF value was 8.2 ± 2.9.
Таким образом, результаты гистохимического анализа показали, что внутривенные инъекции цинкового комплекса приводили к почти 4-кратному уменьшению амилоидной
нагрузки в гиппокампе трансгенных мышей APP/PS1, и по этому показателю эффективность цинкового комплекса примерно в три раза выше таковой, выявленной для НАЕЕ. Для ближайшего аналога HAEE-Zn-BSA данный тест не проводился из-за гибели мышей в группе и нарушения их функционального состояния на ранних этапах исследования. Thus, the results of histochemical analysis showed that intravenous injections of the zinc complex led to an almost 4-fold decrease in amyloid load in the hippocampus of transgenic APP/PS1 mice, and according to this indicator, the effectiveness of the zinc complex is approximately three times higher than that detected for HAEE. For the closest analogue of HAEE-Zn-BSA, this test was not performed due to the death of mice in the group and disruption of their functional state in the early stages of the study.
В качестве одного из механизмов действия цинкового комплекса на возможность лечения нейродегенеративных заболеваний может являться его связывание с бета- амилоидом. Были рассчитаны кинетические характеристики взаимодействия цинкового комплекса и иммобилизованного человеческого бета-амилоида, которые оказались равны коп = (1,37±0,06) х 103
Поскольку значение KD < Ю’4 М, то такое взаимодействие является биологически значимым. В отличие от цинкового комплекса, пептид НАЕЕ не связывался с бета-амилоидом в аналогичных экспериментальных условиях. One of the mechanisms of action of the zinc complex on the possibility of treating neurodegenerative diseases may be its binding to beta-amyloid. The kinetic characteristics of the interaction of the zinc complex and immobilized human beta-amyloid were calculated, which turned out to be equal to kop = (1.37 ± 0.06) x 10 3 Since the value of KD <10' 4 M, this interaction is biologically significant. Unlike the zinc complex, the HAEE peptide did not bind to beta-amyloid under similar experimental conditions.
Это различие между нативным НАЕЕ и цинковым комплексом может влиять на фармакологические свойства, что подтвердили различающиеся тесты восстановления когнитивных функций - эффективность НАЕЕ была значительно ниже эффективности заявляемого цинкового комплекса. Этот эффект можно связать с вышеупомянутыми данными ВЭЖХ-МС, которые показали изменения в 3D структуре нативного НАЕЕ после его введения в плазму крови, тогда как цинковый комплекс до и после его введения в плазму крови имеет одно и то же время удерживания на хроматограмме ВЭЖХ и, соответственно, устойчивую 3D структуру. Это означает, что ион цинка в цинковом комплексе играет защитную роль для сохранения «развёрнутой» конформации пептида НАЕЕ в данном комплексе, что, возможно, также предотвращает взаимодействия цинкового комплекса с элементами плазмы крови, поскольку известно, что введение нативного НАЕЕ в периферическую кровеносную систему мышей, крыс и кроликов приводит к образованию стабильных комплексов НАЕЕ с транспортными и рецепторными белками (Zolotarev Y.A., Mitkevich V.A., Shram S.I. et al. Pharmacokinetics and Molecular Modeling Indicate nAChRa4-Derived Peptide HAEE Goes through the Blood- Brain Barrier. Biomolecules. 2021. 11(6): p. 909, doi: 10.3390/bioml 1060909). This difference between native HAEE and the zinc complex may affect the pharmacological properties, which was confirmed by differing tests of cognitive function restoration - the effectiveness of HAEE was significantly lower than the effectiveness of the claimed zinc complex. This effect can be related to the above-mentioned HPLC-MS data, which showed changes in the 3D structure of native HAEE after its introduction into the blood plasma, while the zinc complex before and after its introduction into the blood plasma has the same retention time in the HPLC chromatogram and, accordingly, a stable 3D structure. This means that the zinc ion in the zinc complex plays a protective role to maintain the “unfolded” conformation of the HAEE peptide in this complex, which may also prevent the interaction of the zinc complex with elements of the blood plasma, since it is known that the introduction of native HAEE into the peripheral circulatory system of mice , rats and rabbits leads to the formation of stable HAEE complexes with transport and receptor proteins (Zolotarev Y.A., Mitkevich V.A., Shram S.I. et al. Pharmacokinetics and Molecular Modeling Indicate nAChRa4-Derived Peptide HAEE Goes through the Blood-Brain Barrier. Biomolecules. 2021. 11 (6): p. 909, doi: 10.3390/bioml 1060909).
В совокупности можно сделать вывод о том, что цинковый комплекс имеет намного большую терапевтическую эффективность по сравнению с НАЕЕ и эти вещества между собой бионеэквивалентны, поскольку цинковый комплекс существует в растворе плазмы крови в «развернутой» конформации и имеет отличный от НАЕЕ механизм действия. Taken together, we can conclude that the zinc complex has much greater therapeutic efficacy compared to HAEE and these substances are not bioequivalent to each other, since the zinc complex exists in a blood plasma solution in an “unfolded” conformation and has a mechanism of action different from HAEE.
Описание фигур.
Фиг. 1. Дифрактограмма цинкового комплекса [Zn(HAEE)](Ac)2. Description of the figures. Fig. 1. X-ray diffraction pattern of the zinc complex [Zn(HAEE)](Ac)2.
Фиг. 2. Дифрактограмма цинкового комплекса [Zn(HAEE)]C12. Fig. 2. X-ray diffraction pattern of the zinc complex [Zn(HAEE)]C12.
Фиг. 3. ДСК-ТГА кривая НАЕЕ. 1 -- ДСК-кривая; 2 - ТГ-кривая. Fig. 3. DSC-TGA curve HAEE. 1 -- DSC curve; 2 - TG curve.
Фиг. 4. ДСК-ТГА кривая цинкового комплекса [Zn(HAEE)](Ac)2 ; 1 - ДСК-кривая; 2 - ТГ -кривая. Fig. 4. DSC-TGA curve of the zinc complex [Zn(HAEE)](Ac)2; 1 - DSC curve; 2 - TG curve.
Фиг. 5. ИК-спектр с Фурье преобразованием НАЕЕ (1) и цинкового комплекса [Zn(HAEE)](Ac)2 (2), ([Zn(HAEE)]Cl2. (3). Fig. 5. IR spectrum with Fourier transform of HAEE (1) and zinc complex [Zn(HAEE)](Ac) 2 (2), ([Zn(HAEE)]Cl 2 (3).
Фиг. 6. Расположение атомов в молекуле НАЕЕ для 'Н-ЯМР-анализа. Fig. 6. Arrangement of atoms in the HAEE molecule for 'H-NMR analysis.
Фиг. 7. 'Н-ЯМР спектр НАЕЕ. Fig. 7. 'H-NMR spectrum of HAEE.
Фиг. 8. 'Н-ЯМР спектр [Zn(HAEE)](Ac)2. Fig. 8. 'H-NMR spectrum of [Zn(HAEE)](Ac)2.
Описание приборов. Description of devices.
Порошковый рентгенофазовый анализ (РФ А) выполнялся на дифрактометре Rigaku Ultima IV (Япония), напряжение на трубке - 40 кВ, ток трубки - 30 мА, материал анода трубки - Си. Гониометр: 0/0 вертикального типа, образец неподвижен. Радиус гониометра - 185 мм /285 мм. Максимумы на дифрактограмме накапливались в течение 1 ч. Угол 20 составил от 3 до 70 градусов. Powder X-ray phase analysis (XRF A) was performed on a Rigaku Ultima IV diffractometer (Japan), tube voltage - 40 kV, tube current - 30 mA, tube anode material - Cu. Goniometer: 0/0 vertical type, the sample is motionless. Goniometer radius - 185 mm/285 mm. The maxima in the diffraction pattern accumulated over 1 hour. The angle 20 ranged from 3 to 70 degrees.
Исследование температуры плавления, термического поведения и потери массы выполняли методом дифференциальной сканирующей калориметрии и термогравиметрии (ДСК-ТГА) на приборе NETZSCH STA 449 С (Германия) в инертной атмосфере при скорости нагрева 10 град/мин. The study of melting point, thermal behavior and mass loss was carried out by differential scanning calorimetry and thermogravimetry (DSC-TGA) on a NETZSCH STA 449 C device (Germany) in an inert atmosphere at a heating rate of 10 deg/min.
Элементный анализ выполнен методом энергодисперсионной рентгеновской спектроскопии с приставкой EDXA на микроскопе TESCAN MIRA3 (Чехия). Площадь измеряемого участка 0,04 мм2, количество измерений - 3. Elemental analysis was performed by energy-dispersive X-ray spectroscopy with an EDXA attachment on a TESCAN MIRA3 microscope (Czech Republic). The area of the measured area is 0.04 mm 2 , the number of measurements is 3.
Спектры инфракрасного излучения (ИК-спектры) получали на ИК-Фурье спектрометре Spectrum Two (Perkin Elmer, США) с приставкой диффузного отражения в диапазоне 4000-600 см’1 с разрешением 2 см'1, количество сканов - 10. Infrared radiation spectra (IR spectra) were obtained on a Spectrum Two IR-Fourier spectrometer (Perkin Elmer, USA) with a diffuse reflection attachment in the range of 4000-600 cm'1 with a resolution of 2 cm'1 , the number of scans was 10.
'Н-спектры ЯМР получали на ЯМР-спектрометре Bruker Avance IIIHD 500, рабочая частота 500,13 Mhz для ядер 1Н. 'H-NMR spectra were obtained on a Bruker Avance IIIHD 500 NMR spectrometer, operating frequency 500.13 MHz for 1 H nuclei.
Характеризация цинкового комплекса [Zn(HAEE)](Ac)2 в водном растворе проводилась методом масс-спектрометрии высокого разрешения с использованием масс- спектрометра LTQ FT Ultra (Thermo Scientific, Германия), который сочетает в себе технологии ионного циклотронного резонанса с преобразованием Фурье и ионной ловушки. Ионизацию электрораспылением (ESI) проводили с использованием источника Ion Max (Thermo Scientific, Германия) с металлическим капилляром для распыления. Использовались следующие параметры источника lonMax: скорость потока составляла 3
мкл/мин; температура нагретого капилляра составляла 200°С; распыляемый газ был отключен; напряжение на капилляре электрораспыления составляло +3,8 кВ в положительной моде и -2,5кВ в отрицательно моде. Идентификация молекулярных ионов проводилась с помощью специализированного программного обеспечения Qual Browser (Thermo Corp., Germany). Возможность характеризации катионных комплексов пептидов с помощью метода масс-спектрометрии была ранее описана (Zirah S., Rebuffat S., Kozin, S.A. et al (2003). Zinc binding properties of the amyloid fragment Ap(l-16) studied by electrospray-ionization mass spectrometry. International Journal of Mass Spectrometry, 228(2- 3), 999-101. Characterization of the zinc complex [Zn(HAEE)](Ac)2 in aqueous solution was carried out by high-resolution mass spectrometry using an LTQ FT Ultra mass spectrometer (Thermo Scientific, Germany), which combines ion cyclotron resonance technologies with Fourier transform and ion trap. Electrospray ionization (ESI) was performed using an Ion Max source (Thermo Scientific, Germany) with a metal spray capillary. The following lonMax source parameters were used: flow rate was 3 µl/min; the temperature of the heated capillary was 200°C; the atomizing gas was turned off; the electrospray capillary voltage was +3.8 kV in the positive mode and -2.5 kV in the negative mode. Identification of molecular ions was carried out using specialized software Qual Browser (Thermo Corp., Germany). The ability to characterize cationic peptide complexes using mass spectrometry has been previously described (Zirah S., Rebuffat S., Kozin, SA et al (2003). Zinc binding properties of the amyloid fragment Ap(l-16) studied by electrospray-ionization mass spectrometry.International Journal of Mass Spectrometry, 228(2-3), 999-101.
Образование комплекса фиксировали биосенсором на эффекте поверхностного плазмонного резонанса (БППР) в водных буферных системах при физиологических значениях pH. БППР эксперименты были проведены на инструменте «BIAcore 3000» (GE Healthcare, США) с использованием оптического чипа СМ4 в соответствии с протоколами компании-производителя. Синтетический аналог 42-членного человеческого бета- амилоида (А042), на С-конце которого добавлен тетраглицилцистеиновый пептидный фрагмент (-Gly-Gly-Gly-Gly-Cys), был использован в качестве лиганда. Лиганд (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAGGGGC) иммобилизовали на поверхности оптического чипа через дисульфидную связь тиоловой группы С-концевого остатка цистеина. В качестве аналитов использовали цинковый комплекс или НАЕЕ. The formation of the complex was detected by a biosensor based on the effect of surface plasmon resonance (SPPR) in aqueous buffer systems at physiological pH values. BPPR experiments were carried out on a BIAcore 3000 instrument (GE Healthcare, USA) using an CM4 optical chip in accordance with the manufacturer’s protocols. A synthetic analogue of the 42-membered human beta-amyloid (A042), with a tetraglycylcysteine peptide fragment (-Gly-Gly-Gly-Gly-Cys) added at the C-terminus, was used as a ligand. The ligand (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAGGGGC) was immobilized on the surface of the optical chip through the disulfide bond of the thiol group of the C-terminal cysteine residue. The analytes used were zinc complex or HAEE.
Высушивание замороженных образцов выполнялось в пенициллиновых пузырьках на сублиматоре Heto FD 2.5 при давлении 0,1 -0,2 мбар. Drying of frozen samples was carried out in penicillin vials on a Heto FD 2.5 sublimator at a pressure of 0.1 -0.2 mbar.
Тест ускоренного хранения проводили в камере Memmert НСР50 при 40 °C и 75% влажности. Образцы отбирали раз в месяц в течение 6 месяцев и определяли содержание действующего вещества методом ВЭЖХ. The accelerated storage test was carried out in a Memmert HCP50 chamber at 40 °C and 75% humidity. Samples were taken once a month for 6 months and the content of the active substance was determined by HPLC.
Варианты осуществления изобретения Embodiments of the Invention
Изобретение иллюстрируется нижеприведенными примерами, но не ограничивается ими. The invention is illustrated by the following examples, but is not limited to them.
Пример 1. Получение цинкового комплекса пептида НАЕЕ. Example 1. Preparation of the zinc complex of the HAEE peptide.
Для получения комплекса в качестве источника цинка использовались ацетат, хлорид, сульфат и нитрат цинка в разных соотношениях. В таблице 1 приведены различные соотношения солей цинка для получения комплекса. To obtain the complex, zinc acetate, chloride, sulfate and zinc nitrate were used as a source of zinc in different proportions. Table 1 shows various ratios of zinc salts to obtain the complex.
Для получения комплекса готовили раствор НАЕЕ с концентрацией 10'5 М. В него добавляли раствор соли цинка с концентрацией 10'3 М (Таблица 1). Перемешивание осуществляли в течение 5-60 мин. Эквимолярные цинковые комплексы образовывались
при молярном соотношении НАЕЕ и соли цинка равные 1:1. Раствор медленно замораживали в холодильной установке при -20 или -80 °C и затем осуществляли лиофильную сушку в стандартном режиме. Далее детально изучали свойства полученного лиофилизированного цинкового комплекса. To obtain the complex, a HAEE solution with a concentration of 10'5 M was prepared. A solution of zinc salt with a concentration of 10'3 M was added to it (Table 1). Mixing was carried out for 5-60 minutes. Equimolar zinc complexes were formed with a molar ratio of HAEE and zinc salts equal to 1:1. The solution was slowly frozen in a refrigeration unit at -20 or -80 °C and then freeze-dried in a standard manner. Next, the properties of the resulting lyophilized zinc complex were studied in detail.
При молярном соотношении компонентов менее 0,1 комплекс в растворе не обнаруживался методом ЯМР (сигналы основного вещества не смещались). При увеличении концентрации соли цинка более 1:10 образовывались смесь из цинкового комплекса и соответствующей соли цинка. When the molar ratio of the components was less than 0.1, the complex in solution was not detected by NMR (the signals of the main substance were not shifted). When the zinc salt concentration increased to more than 1:10, a mixture of the zinc complex and the corresponding zinc salt was formed.
При получении цинкового комплекса с анионом, который изначально мало или совсем не растворяется в воде (например, тартрат цинка, цитрат цинка и т.п.) использовали на первой стадии водорастворимую соль цинка (нитрат, ацетат, хлорид, сульфат), анион удаляли известным способом - анион-обменной хроматографией или диализом и добавляли в раствор другое соединение - винную кислоту, лимонную кислоту и т.п в эквимолярных количествах. После чего совершали аналогичные операции по замораживанию и лиофильному высушиванию цинкового комплекса. When preparing a zinc complex with an anion that is initially little or not at all soluble in water (for example, zinc tartrate, zinc citrate, etc.), a water-soluble zinc salt (nitrate, acetate, chloride, sulfate) was used in the first stage; the anion was removed using a known method. method - anion exchange chromatography or dialysis and another compound - tartaric acid, citric acid, etc. was added to the solution in equimolar quantities. After that, similar operations were performed to freeze and freeze-dry the zinc complex.
Таким образом, получение цинкового комплекса [Zn(HAEE)]mXn, где X - бензоат, салицилат, тартрат, цитрат и т.п. осуществляли в три этапа. Сначала готовили раствор цинкового комплекса по описанным в Таблице 1 соотношениям, затем хроматографически отделяли неорганические анионы и добавляли для получения бензоата - бензойную кислоту, салицилата - салициловую кислоту, тартрата - винную кислоту, цитрата - лимонную кислоту в эквимолярных количествах. Thus, obtaining a zinc complex [Zn(HAEE)] m X n , where X is benzoate, salicylate, tartrate, citrate, etc. was carried out in three stages. First, a solution of the zinc complex was prepared according to the ratios described in Table 1, then inorganic anions were separated chromatographically and added to obtain benzoate - benzoic acid, salicylate - salicylic acid, tartrate - tartaric acid, citrate - citric acid in equimolar quantities.
Для получения цинкового комплекса в твердой форме полученные растворы замораживали в морозильной камере (-20 °C) в пенициллиновых пузырьках в течение 2 ч. Замороженные образцы помещали в сублиматор с предварительно охлажденными полками и высушивали в течение 16-30 ч. Все высушенные образцы имели белый цвет. Выход продукта 99%. Высокий выход продукта обусловлен отсутствием потерь при высушивании образцов. To obtain the zinc complex in solid form, the resulting solutions were frozen in a freezer (-20 °C) in penicillin vials for 2 hours. The frozen samples were placed in a sublimator with pre-cooled shelves and dried for 16-30 hours. All dried samples were white color. Product yield 99%. The high yield of the product is due to the absence of losses during drying of the samples.
Полученные твердые образцы комплекса характеризуются аморфной формой на дифрактограмме (Фиг. 1,2). На ДСК кривой в отличие от Е1АЕЕ (Фиг. 3) комплекс характеризуется широким пиком с началом при 62 °C и максимумом при 87 °C; широким пиком плавления с началом при 224 °C и максимумом при 255 °C (Фиг. 4). Методом ДСК- ТГА было показано, что цинковый комплекс в твердой форме может содержать гидратированную или остаточную воду, содержание которой для разных образцов не превышало 5% (потеря массы при нагревании до 100 °C).
Элементный анализ (EDXA) цинкового комплекса показал содержание цинка в образцах (при молекулярном соотношении НАЕЕ : Zn = 1:1), от 5±0,5 до 10±1 % масс, в зависимости от природы аниона. The resulting solid samples of the complex are characterized by an amorphous form in the diffraction pattern (Fig. 1, 2). In the DSC curve, in contrast to E1AEE (Fig. 3), the complex is characterized by a broad peak with an onset at 62 °C and a maximum at 87 °C; a broad melting peak with an onset at 224 °C and a maximum at 255 °C (Fig. 4). Using the DSC-TGA method, it was shown that the zinc complex in solid form can contain hydrated or residual water, the content of which for different samples did not exceed 5% (weight loss when heated to 100 °C). Elemental analysis (EDXA) of the zinc complex showed the zinc content in the samples (at a molecular ratio of HAEE: Zn = 1:1), from 5±0.5 to 10±1 wt%, depending on the nature of the anion.
ИК-спектр с Фурье преобразованием комплекса характеризуется наличием максимумов при 1115 см'1 и 970 см'1 (Фиг. 5), что отличает заявляемый цинковый комплекс от НАЕЕ. The IR spectrum with Fourier transform of the complex is characterized by the presence of maxima at 1115 cm' 1 and 970 cm' 1 (Fig. 5), which distinguishes the claimed zinc complex from HAEE.
Исходный образец НАЕЕ характеризовался ЯМР 'H[500.13Mhz; D2O; 298К; d, м.д.]: 1.27 (ЗН, d, j=7.13Hz, СН3(16)), 1.87 (5Н, ш, СН3(3), 1/2СН2(21),1/2СН2(33)), 1.92 (0.22Н, s, CH3(Imp. - Ас)), 1.99 (2Н, sx, j=7.45Hz 1/2СН2(21),1/2СН2(33)), 2.28 (4Н, т, 2СН2(22,34 )), 3.13, 3,03 (2Н, т, СН2(8)), 4.19 (ЗН, т, ЗСН (15,20,29)), 4.56 (1Н, t, j=6.86Hz, СН(5)), 7.19 (1Н, s, СН(10)), 8.50 (1Н, s, СН(12)) (Фиг. 6,7). The original HAEE sample was characterized by NMR 'H[500.13Mhz;D2O;298K; d, ppm]: 1.27 (ZN, d, j=7.13Hz, CH 3 (16)), 1.87 (5H, w, CH 3 (3), 1/2CH 2 (21),1/2CH 2 (33)), 1.92 (0.22Н, s, CH 3 (Imp. - Ac)), 1.99 (2Н, sx, j=7.45Hz 1/2СН 2 (21),1/2СН 2 (33)), 2.28 (4H, t, 2CH 2 (22.34)), 3.13, 3.03 (2H, t, CH 2 (8)), 4.19 (ZN, t, ZSN (15,20,29)), 4.56 (1H , t, j=6.86Hz, CH(5)), 7.19 (1H, s, CH(10)), 8.50 (1H, s, CH(12)) (Fig. 6,7).
После образования цинкового комплекса положение химических сдвигов протонов в молекуле НАЕЕ изменялась и представлено на Фиг. 8, что свидетельствует о сохранении комплекса после его растворения в воде, что важно для фармакологических свойств полученного комплекса. Так, сигнал при СН(12) смещался с 8,5 до 8,42 м.д., при СН(10) с 7.19 до 7,14 м.д., при СН2(8) с 3,13 и 3,03 до 3,10 и 3,01, при 2СН2(22,34 ) с 2,28 до 2,21, при СН3(16) с 1,27 до 1,26 (Таблица 2). Смещение протонных сигналов от определенных групп в молекуле показывает их вклад в электростатическое взаимодействие с ионом цинка при образовании комплекса; чем больше взаимодействие, тем большее смещение наблюдается в 'Н-ЯМР-спсктре у определенных СН-групп молекулы. Поэтому наибольшее взаимодействие наблюдается у СН(12) группы имидазола гистидинового фрагмента и а-групп (22, 34) глутаминовых фрагментов, что связано с координированием -СООН групп глутаминовой кислоты. After the formation of the zinc complex, the position of the chemical shifts of protons in the HAEE molecule changed and is shown in Fig. 8, which indicates the preservation of the complex after its dissolution in water, which is important for the pharmacological properties of the resulting complex. Thus, the signal at CH(12) shifted from 8.5 to 8.42 ppm, at CH(10) from 7.19 to 7.14 ppm, at CH 2 (8) from 3.13 and 3 .03 to 3.10 and 3.01, with 2CH 2 (22.34) from 2.28 to 2.21, with CH 3 (16) from 1.27 to 1.26 (Table 2). The displacement of proton signals from certain groups in the molecule shows their contribution to the electrostatic interaction with the zinc ion during complex formation; The greater the interaction, the greater the shift observed in the H-NMR spectrum for certain CH groups of the molecule. Therefore, the greatest interaction is observed between the CH(12) group of the imidazole of the histidine fragment and the a-groups (22, 34) of glutamic fragments, which is associated with the coordination of the -COOH groups of glutamic acid.
При наличии в твердой фазе ацетата, бензоата, салицилата, тартрата в *Н-ЯМР- спектре цинкового комплекса помимо молекулы НАЕЕ фиксировались сигналы от этих анионов, например от ацетата (СН3 - 1,92 м.д.). In the presence of acetate, benzoate, salicylate, and tartrate in the solid phase, in the *H-NMR spectrum of the zinc complex, in addition to the HAEE molecule, signals from these anions were recorded, for example, from acetate (CH 3 - 1.92 ppm).
Характеризация цинкового комплекса [Zn(HAEE)](Ac)2 в водном растворе проводилась методом масс-спектрометрии высокого разрешения с использованием технологии ионного циклотронного резонанса с преобразованием Фурье путем измерения точной массы характерных молекулярных ионов как при положительной, так и при отрицательной модах ионизации. Для проведения измерений образцы цинкового комплекса [Zn(HAEE)](Ac)2 в водном растворе с концентрацией 20 мкМ вносили в смесь воды и ацетонитрила в соотношении 1:1 с добавлением муравьиной кислоты (для достижении финальной концентрации 0,1%). Масс-спектрометрический анализ водного раствора цинкового комплекса [Zn(HAEE)](Ac)2, проведенный при положительной моде
электроспрейного ионизационного источника, показал наличие молекулярного иона [НАЕЕ+Н]+1 с моноизотопной массой 526,2270 m/z и молекулярного иона [HAEE-H+Zn]+1 с моноизотопной массой 588,1449 m/z. При использовании отрицательной моды электроспрейного ионизационного источника для анализа цинкового комплекса [Zn(HAEE)](Ac)2 в водном растворе были идентифицированы молекулярный ион [НАЕЕ-Н]-1 с моноизотопной массой 524,2189 m/z и молекулярный ион [HAEE-3H+Zn] 1 с моноизотопной массой 586,1345 m/z. Таким образом, полученные данные подтверждают специфическое связывание катиона цинка (II) с пептидом НАЕЕ, которое характеризует внутреннюю координационную сферу цинкового комплекса [Zn(HAEE)]2+ в водном растворе. Characterization of the zinc complex [Zn(HAEE)](Ac) 2 in aqueous solution was carried out by high-resolution mass spectrometry using Fourier transform ion cyclotron resonance technology by measuring the exact mass of characteristic molecular ions in both positive and negative ionization modes. To carry out measurements, samples of the zinc complex [Zn(HAEE)](Ac) 2 in an aqueous solution with a concentration of 20 μM were added to a mixture of water and acetonitrile in a 1:1 ratio with the addition of formic acid (to achieve a final concentration of 0.1%). Mass spectrometric analysis of an aqueous solution of the zinc complex [Zn(HAEE)](Ac) 2 carried out in a positive mode electrospray ionization source showed the presence of the molecular ion [HAEE+H] +1 with a monoisotopic mass of 526.2270 m/z and the molecular ion [HAEE-H+Zn] +1 with a monoisotopic mass of 588.1449 m/z. When using the negative mode of an electrospray ionization source to analyze the zinc complex [Zn(HAEE)](Ac)2 in an aqueous solution, the molecular ion [HAEE-H]- 1 with a monoisotopic mass of 524.2189 m/z and the molecular ion [HAEE- 3H+Zn] 1 with a monoisotopic mass of 586.1345 m/z. Thus, the data obtained confirm the specific binding of the zinc (II) cation to the HAEE peptide, which characterizes the internal coordination sphere of the zinc complex [Zn(HAEE)] 2+ in an aqueous solution.
Сравнительный анализ цинкового комплекса методом ВЭЖХ-МС (2,5 нг/мл, 0,5% FA — муравьиная кислота, 50% МеОН (1:1)) показал, что в водных растворах in vitro при физиологических значениях pH его хроматографическая подвижность практически идентична НАЕЕ в тех же хроматографических условиях. Время выхода хроматографического пика с колонки составляло 2,77 и 2,85 мин, соответственно. С учетом известных из литературы данных молекулярного моделирования (Barykin Е.Р., Garifulina A.I., Tolstova А.Р. et al. (2020). Tetrapeptide AC-HAEE-NH2 Protects a4p2 nAChR from Inhibition by A0. International journal of molecular sciences, 21(17), 6272, doi: 10.3390/ijms21176272), вышеприведённые результаты указывают на то, что пространственные структуры основной пептидной цепи цинкового комплекса и пептида НАЕЕ в условиях in vitro идентичны и характеризуется «развернутой» конформацией. A comparative analysis of the zinc complex by HPLC-MS (2.5 ng/ml, 0.5% FA - formic acid, 50% MeOH (1:1)) showed that in aqueous solutions in vitro at physiological pH values, its chromatographic mobility is almost identical to HAEE under the same chromatographic conditions. The time for the chromatographic peak to leave the column was 2.77 and 2.85 minutes, respectively. Taking into account molecular modeling data known from the literature (Barykin E.R., Garifulina A.I., Tolstova A.R. et al. (2020). Tetrapeptide AC-HAEE-NH2 Protects a4p2 nAChR from Inhibition by A0. International journal of molecular sciences, 21(17), 6272, doi: 10.3390/ijms21176272), the above results indicate that the spatial structures of the main peptide chain of the zinc complex and the HAEE peptide under in vitro conditions are identical and are characterized by an “unfolded” conformation.
После введения цинкового комплекса НАЕЕ внутривенно в организм здоровых мышей (п = 5) было показано, что время выхода хроматографического пика НАЕЕ, экстрагированного из образцов крови мыши, не изменялось и также составляло 2,77 мин. Однако, для НАЕЕ, введенного в организм в нативной форме, экстрагированного из образцов крови, было неожиданно обнаружено, что время выхода хроматографического пика стало 1,27 мин. Только около 8% вещества продолжало выходить из колонки на времени 2,85 мин. After intravenous administration of the HAEE zinc complex into the body of healthy mice (n = 5), it was shown that the time of release of the chromatographic peak of HAEE extracted from mouse blood samples did not change and was also 2.77 minutes. However, for HAEE introduced into the body in its native form, extracted from blood samples, it was unexpectedly found that the chromatographic peak time became 1.27 minutes. Only about 8% of the substance continued to exit the column at 2.85 minutes.
Полученные данные свидетельствует о том, что в образцах крови человека или мыши конформация пептида НАЕЕ резко отличается от конформации, наблюдаемой при тех же условиях для цинкового комплекса. Лишь 8% НАЕЕ находится в «развернутой» конформации после его взаимодействия с элементами плазмы крови. Таким образом, в образцах крови цинковый комплекс сохраняет свою конформацию (предположительно, «развёрнутую») неизменной, в то время как НАЕЕ приобретает иную конформацию, которая характеризуется гораздо более компактной структурой, предположительно,
«спиральной». Это означает, что цинковый комплекс устойчив к изменению конформации в плазме крови. Согласно настоящему изобретению, для достижения терапевтического эффекта как от цинкового комплекса пептида НАЕЕ, так и от НАЕЕ требуется их введение в организм и присутствие в плазме крови, поэтому принципиальные различия в пространственной структуре этих молекул в плазме крови, исходя из общих представлений биохимии и физиологии, свидетельствуют о различном молекулярном механизме действия цинкового комплекса и НАЕЕ, что исключает их биоэквивалентность. The data obtained indicate that in human or mouse blood samples the conformation of the HAEE peptide differs sharply from the conformation observed under the same conditions for the zinc complex. Only 8% of HAEE is in the “unfolded” conformation after its interaction with blood plasma elements. Thus, in blood samples, the zinc complex retains its conformation (presumably “unfolded”) unchanged, while HAEE acquires a different conformation, which is characterized by a much more compact structure, presumably "spiral". This means that the zinc complex is resistant to changes in conformation in blood plasma. According to the present invention, in order to achieve a therapeutic effect, both the zinc complex of the HAEE peptide and HAEE require their introduction into the body and presence in the blood plasma, therefore, the fundamental differences in the spatial structure of these molecules in the blood plasma, based on the general concepts of biochemistry and physiology, indicate a different molecular mechanism of action of the zinc complex and HAEE, which excludes their bioequivalence.
Была определена стабильность цинкового комплекса в тесте ускоренного хранения в течение 6 месяцев, что соответствует 2 годам хранения в обычных условиях (Таблица 3). Цинковый комплекс, как очищенный от анионов, так и в смеси с указанными анионами за время хранения сохранил свой цвет, консистенцию, не набирал воды (масса образца не увеличивалась в пределах 1-2%) и не терял активное вещество. Образец НАЕЕ с течением времени набирал воду (до 7% масс.) и по данным ВЭЖХ деградировал до 67,4% активного вещества за 6 мес. Образец, полученный по патенту РФ № 2709539, представляющий собой комплекс HAEE-Zn-HSA также набирал воду (до 16% масс.) и деградировал до содержания 71,9% от исходного количества. Таким образом, стабильность заявляемого цинкового комплекса оказалась значительно выше по сравнению с НАЕЕ и HAEE-Zn-HSA. The stability of the zinc complex was determined in an accelerated storage test for 6 months, which corresponds to 2 years of storage under normal conditions (Table 3). The zinc complex, both purified from anions and in a mixture with the indicated anions, retained its color and consistency during storage, did not gain water (the mass of the sample did not increase within 1-2%) and did not lose the active substance. The HAEE sample gained water over time (up to 7% wt.) and, according to HPLC data, degraded to 67.4% of the active substance in 6 months. The sample obtained under RF patent No. 2709539, which is a HAEE-Zn-HSA complex, also took on water (up to 16% by weight) and degraded to a content of 71.9% of the original amount. Thus, the stability of the proposed zinc complex turned out to be significantly higher compared to HAEE and HAEE-Zn-HSA.
Пример 2. Фармацевтические композиции на основе цинкового комплекса пептида НАЕЕ. Example 2. Pharmaceutical compositions based on the zinc complex of the HAEE peptide.
Фармацевтические композиции на основе цинкового комплекса пептида НАЕЕ могут содержать активное вещество в эффективном количестве (Таблица 4). Состав дозы рассчитывается индивидуально и может варьироваться от 0,1 мг до 100 мг на человека в сутки, более предпочтительно от 1 до 50 мг. Составы фармацевтических композиций представлены в Таблице 3. Пересчет выполнен на дозировку активного вещества. Возможны и другие соотношения активного вещества в фармацевтической композиции в диапазоне от 0,1 до 100 мг. Масса таблеток варьируется от 100 до 400 мг, таблетки могут быть покрыты оболочкой. Pharmaceutical compositions based on the HAEE peptide zinc complex may contain the active substance in an effective amount (Table 4). The dosage composition is calculated individually and can vary from 0.1 mg to 100 mg per person per day, more preferably from 1 to 50 mg. The compositions of the pharmaceutical compositions are presented in Table 3. The conversion was made to the dosage of the active substance. Other ratios of the active substance in the pharmaceutical composition are possible in the range from 0.1 to 100 mg. The weight of the tablets varies from 100 to 400 mg, the tablets can be coated.
Пример 3. Влияние цинкового комплекса пептида НАЕЕ на поведенческие функции и степень тяжести церебрального амилоидоза у экспериментальных животных. Example 3. Effect of the zinc complex of the HAEE peptide on behavioral functions and severity of cerebral amyloidosis in experimental animals.
Для моделирования нейродегенеративного заболевания была выбрана модель болезни Альцгеймера, являющейся основным по распространённости нейродегенеративным заболеванием у людей пожилого возраста. To model a neurodegenerative disease, a model of Alzheimer's disease was chosen, which is the most common neurodegenerative disease in older people.
Для проведения экспериментов были использованы самцы трансгенных мышей линии APPswe/PSENldE9. Мыши данной линии также известны под названием APP/PS1:
у контрольной группы мышей APP/PS1, начиная с 4-6-месячного возраста, проявляются характерные когнитивные признаки патологии, подобной болезни Альцгеймера, и имеется значительное количество конгофильных амилоидных бляшек в специфических отделах мозга, включая гиппокамп и кортекс (Borchelt D.R., Ratovitski Т., Van bare J., et al. (1997). Accelerated amyloid deposition in the brains of transgenic mice coexpressing mutant presenilin 1 and amyloid precursor proteins. Neuron, 19(4), 939-945, doi: 10.1016/S0896-6273(00)80974- 5). Male transgenic mice of the APPswe/PSENldE9 line were used for the experiments. Mice of this line are also known as APP/PS1: Control APP/PS1 mice, starting at 4-6 months of age, display characteristic cognitive signs of Alzheimer's disease-like pathology and have significant amounts of congophilic amyloid plaques in specific brain regions, including the hippocampus and cortex (Borchelt DR, Ratovitski T. , Van bare J., et al. (1997). Accelerated amyloid deposition in the brains of transgenic mice coexpressing mutant presenilin 1 and amyloid precursor proteins. Neuron, 19(4), 939-945, doi: 10.1016/S0896-6273( 00)80974-5).
Для тестирования были использованы 8 -месячные животные, сгруппированные в следующие экспериментальные группы (п = 12 в каждой группе): For testing, 8-month-old animals were used, grouped into the following experimental groups (n = 12 in each group):
1. контроль 1. Мыши дикого типа, которым внутривенно вводили физиологический раствор; 1. control 1. Wild-type mice injected intravenously with saline;
2. контроль 2. Трансгенные мыши APP/PS1, которым внутривенно вводили физиологический раствор; 2. control 2. APP/PS1 transgenic mice injected intravenously with saline;
3. трансгенные мыши APP/PS1, которым внутривенно вводили НАЕЕ; 3. APP/PS1 transgenic mice injected intravenously with HAEE;
4. трансгенные мыши APP/PS1, которым внутривенно вводили HAEE-Zn-HSA (1 :2,6);4. APP/PS1 transgenic mice injected intravenously with HAEE-Zn-HSA (1 : 2.6);
5. трансгенные мыши APP/PS1, которым внутривенно вводили [Zn(HAEE)](Ac)2. 5. APP/PS1 transgenic mice injected intravenously with [Zn(HAEE)](Ac)2.
Препараты НАЕЕ, HAEE-Zn-HSA и заявляемый цинковый комплекс вводили в ретроорбитальное венозное сплетение в соответствии с известной процедурой (Yardeni Т., Eckhaus М., Morris H.D. et al. (2011). Retro-orbital injections in mice. Lab animal, 40(5), 155- 160, doi: 10.1038/laban0511-155). Инъекции в дозе 0,05 мг/кг проводили ежемесячно, в возрасте от 2 до 7 месяцев (включительно), всего было сделано 6 инъекций препаратами НАЕЕ и цинкового комплекса, однако, препаратом HAEE-Zn-HSA было сделано только две инъекции, а далее эксперименты с этим препаратом были прекращены из-за появления признаков ухудшения внешнего вида экспериментальных животных после первой инъекции и гибели 5 трансгенных мышей непосредственно после второй инъекции. Скорее всего, это связано с влиянием высоких концентраций HSA, который отличается по структуре от эндогенного мышиного альбумина (MSA). Preparations HAEE, HAEE-Zn-HSA and the claimed zinc complex were injected into the retro-orbital venous plexus in accordance with a known procedure (Yardeni T., Eckhaus M., Morris H.D. et al. (2011). Retro-orbital injections in mice. Lab animal, 40(5), 155- 160, doi: 10.1038/laban0511-155). Injections at a dose of 0.05 mg/kg were carried out monthly, from 2 to 7 months of age (inclusive), a total of 6 injections were made with HAEE and zinc complex preparations, however, only two injections were made with HAEE-Zn-HSA, and then experiments with this drug were stopped due to signs of deterioration in the appearance of experimental animals after the first injection and the death of 5 transgenic mice immediately after the second injection. This is most likely due to the effects of high concentrations of HSA, which is structurally different from endogenous murine albumin (MSA).
В возрасте 8 месяцев проводили тестирование поведенческих функций, затем животные подвергались эвтаназии с последующим забором мозга и гистохимическим анализом числа конгофильных бляшек в областях CAI, СА2, САЗ и зубчатой извилине гиппокампа согласно известной процедуре (Kozin S.A., Barykin Е.Р., Telegin G.B., et al. Intravenously Injected Amyloid-0 Peptide With Isomerized Asp7 and Phosphorylated Ser8 Residues Inhibits Cerebral 0- Amyloidosis in A0PP/PS 1 Transgenic Mice Model of Alzheimer's Disease. Frontiers in neuroscience, 2018, 12, 518-518, doi: 10.3389/fnins.2018.00518).
3.1 Анализ улучшения поведенческих функций у 8-месячных самцов трансгенных мышей APP/PS1 под действием НАЕЕ и цинкового комплекса пептида ELAEE был проведён с помощью теста «Закапывание шариков». В качестве контроля использовались трансгенные мыши APP/PS1 и мыши дикого типа. Для проведения теста мышей помещали в клетки со свежим подстилом с размещенными на нем восемнадцатью шариками, расположенными в виде матрицы 3 x 6. Мышей оставляли в клетке на 30 минут, после чего определяли количество более чем на 2/3 закопанных шариков (КЗШ) в процентах от общего количества шариков. Поведение закапывания является признаком обсессивно-компульсивного поведения. Из-за повторяющегося и персеверативного характера закапывания такое поведение может представлять нейропсихиатрические симптомы, такие как персеверативное поведение и/или стереотипное поведение. Оба являются нейропсихиатрическими симптомами, обычно присутствующими у пациентов с болезнью Альцгеймера и другими видами деменции. At the age of 8 months, testing of behavioral functions was carried out, then the animals were euthanized, followed by brain sampling and histochemical analysis of the number of congophilic plaques in the areas CAI, CA2, CAZ and the dentate gyrus of the hippocampus according to a well-known procedure (Kozin SA, Barykin E.R., Telegin GB, et al. Intravenously Injected Amyloid-0 Peptide With Isomerized Asp7 and Phosphorylated Ser8 Residues Inhibits Cerebral 0- Amyloidosis in A0PP/PS 1 Transgenic Mice Model of Alzheimer's Disease. Frontiers in neuroscience, 2018, 12, 518-518, doi: 10.3389/fnins .2018.00518). 3.1 Analysis of the improvement in behavioral functions in 8-month-old male APP/PS1 transgenic mice under the influence of HAEE and the zinc complex of the ELAEE peptide was carried out using the Burying Balls test. APP/PS1 transgenic mice and wild-type mice were used as controls. For the test, mice were placed in cages with fresh bedding containing eighteen beads arranged in a 3 x 6 matrix. The mice were left in the cage for 30 minutes, after which the percentage of more than two-thirds of beads buried was determined. of the total number of balls. The burying behavior is a sign of obsessive-compulsive behavior. Due to the repetitive and perseverative nature of burying, this behavior may represent neuropsychiatric symptoms such as perseverative behavior and/or stereotypic behavior. Both are neuropsychiatric symptoms commonly present in patients with Alzheimer's disease and other types of dementia.
По результатам тестирования, уровень поведения контрольной группы мышей дикого типа характеризовался значением КЗШ = 50,6 ±13,3 %. Это значение рассматривается в качестве референсного. У контрольной группы трансгенных мышей APP/PS1 значение КЗШ = 12,6 ±4,2 %, что указывает на сильное ухудшение поведенческих рефлексов мышей APP/PS1 по сравнению с животными дикого типа и отражает инвалидизирующее влияние оверпродукции человеческого бета-амилоида на процессы нервной деятельности. Мыши, инъецированные НАЕЕ и цинковым комплексом пептида НАЕЕ, показали значения КЗШ = 20,6 ±7,3 % и КЗШ = 45,6 ±11,9 %, соответственно (Таблица 5). According to the testing results, the level of behavior of the control group of wild-type mice was characterized by the value of CVS = 50.6 ± 13.3%. This value is considered as a reference value. In the control group of transgenic APP/PS1 mice, the value of the CR = 12.6 ± 4.2%, which indicates a strong deterioration in the behavioral reflexes of APP/PS1 mice compared to wild-type animals and reflects the disabling effect of overproduction of human beta-amyloid on the processes of nervous activity . Mice injected with HAEE and the zinc complex of the HAEE peptide showed values of IR = 20.6 ± 7.3% and IR = 45.6 ± 11.9%, respectively (Table 5).
Эти данные свидетельствуют о том, что использование цинкового комплекса пептида НАЕЕ существенно улучшает поведенческие рефлексы трансгенных мышей APP/PS1, а эффект от этого использования значительно превышает таковой, наблюдаемый для НАЕЕ. Сравнительные эксперименты цинкового комплекса с другими анионами не выявили статистически значимых различий в биологическом эффекте. Введение ближайшего аналога HAEE-Zn-HSA приводило к нарушению физического состояния у мышей и к их гибели, что, по-видимому, связано с высокой дозировкой HSA. These data indicate that the use of the zinc complex of the HAEE peptide significantly improves the behavioral reflexes of APP/PS1 transgenic mice, and the effect of this use is significantly greater than that observed for HAEE. Comparative experiments of the zinc complex with other anions did not reveal statistically significant differences in the biological effect. Administration of the closest analogue of HAEE-Zn-HSA led to impairment of the physical condition of mice and to their death, which was apparently associated with a high dosage of HSA.
3.2. Гистохимический анализ конгофильных амилоидных бляшек в областях CAI, СА2, САЗ и зубчатой извилине гиппокампа был проведен согласно ранее описанным процедурам (Kozin S.A., Barykin Е.Р., Telegin G.B., et al. Intravenously Injected Amyloid-P Peptide With Isomerized Asp7 and Phosphorylated Ser8 Residues Inhibits Cerebral P- Amyloidosis in ApPP/PSl Transgenic Mice Model of Alzheimer's Disease. Frontiers in neuroscience, 2018, 12, 518-518, doi: 10.3389/fnins.2018.00518). Мозг мышей извлекали и
фиксировали в 10% формалине. Процесс заливки образца в парафин проводили следующим образом: заливали 75% этанолом и оставляли на ночь, далее сменяли на 96% этанол и выдерживали 5 мин, 96% этанол — 10 мин, 100% этанол — 10 мин (две замены), этанол-хлороформ (1:1) - 30 мин, и оставляли в чистом хлороформе на ночь. Заливку парафином проводили при 60°С в течение 3 ч (три смены). Заливку тканей в парафиновые блоки осуществляли на приборе Leica EG 1160. Серийные срезы головного мозга (8 мкм) вырезали с помощью микротома Leica RM2265 и помещали на предметные стекла. Для депарафинизации, гидратации и окрашивания срезов проводили следующие этапы: предметные стекла последовательно помещали в ксилол три смены (по 10 минут), 96% этанол - 5 мин, 90% этанол - 2 мин, 75% этанол - 2 мин, вода - 5 мин (три смены), раствор конго красного - 5 мин, далее добавлялся раствор гидроксида калия и вода. Для монтирования использовали среду ImMu-Mount (Thermo Scientific). Срезы, охватывающие область мозга от 0,48 до 1,92 мм относительно средней линии в латеральных стереотаксических координатах (Franklin К., Paxinos, G. (2008). The Mouse Brain in Stereotaxic Coordinates. New York, NY: Academic Press), использовали для количественного определения конгофильных амилоидных бляшек в гиппокампе. Анализировали каждый 15-й срез, что давало 10 срезов на животное. Амилоидные бляшки идентифицировали окрашиванием конго красным и подсчитывали вручную. Для каждой группы мышей рассчитывали средние значения и стандартное отклонение количества бляшек на 1 срез. Для проверки нормальности распределения использовали критерий Шапиро-Уилка. Для попарного сравнения исследуемых групп использовали критерий Манна-Уитни. Применяемый уровень значимости составлял 99,9% (Р <0,001). 3.2. Histochemical analysis of congophilic amyloid plaques in the areas CAI, CA2, CAZ and the dentate gyrus of the hippocampus was carried out according to previously described procedures (Kozin SA, Barykin E.R., Telegin GB, et al. Intravenously Injected Amyloid-P Peptide With Isomerized Asp7 and Phosphorylated Ser8 Residues Inhibits Cerebral P-Amyloidosis in ApPP/PSl Transgenic Mice Model of Alzheimer's Disease. Frontiers in neuroscience, 2018, 12, 518-518, doi: 10.3389/fnins.2018.00518). The brains of mice were removed and fixed in 10% formalin. The process of pouring the sample into paraffin was carried out as follows: poured 75% ethanol and left overnight, then changed to 96% ethanol and kept for 5 minutes, 96% ethanol - 10 minutes, 100% ethanol - 10 minutes (two changes), ethanol-chloroform (1:1) - 30 minutes, and left in pure chloroform overnight. Paraffin embedding was carried out at 60°C for 3 hours (three shifts). Embedding of tissues in paraffin blocks was carried out on a Leica EG 1160 device. Serial sections of the brain (8 μm) were cut using a Leica RM2265 microtome and placed on glass slides. For deparaffinization, hydration and staining of sections, the following steps were carried out: slides were sequentially placed in xylene for three shifts (10 minutes each), 96% ethanol - 5 minutes, 90% ethanol - 2 minutes, 75% ethanol - 2 minutes, water - 5 minutes (three shifts), Congo red solution - 5 minutes, then potassium hydroxide solution and water were added. ImMu-Mount medium (Thermo Scientific) was used for mounting. Slices covering the brain region from 0.48 to 1.92 mm relative to the midline in lateral stereotaxic coordinates (Franklin K., Paxinos, G. (2008). The Mouse Brain in Stereotaxic Coordinates. New York, NY: Academic Press), used to quantify congophilic amyloid plaques in the hippocampus. Every 15th section was analyzed, resulting in 10 sections per animal. Amyloid plaques were identified by Congo red staining and manually counted. For each group of mice, the average values and standard deviation of the number of plaques per section were calculated. The Shapiro-Wilk test was used to check the normality of the distribution. For pairwise comparison of the study groups, the Mann-Whitney test was used. The significance level used was 99.9% (P < 0.001).
У контрольной группы мышей дикого типа (группа 1) никаких амилоидных бляшек обнаружено не было (Таблица 4). Конгофильные амилоидные бляшки, визуализированные в областях CAI, СА2, САЗ и зубчатой извилине гиппокампа головного мозга трансгенных животных были сходны по локализации и распределению размеров в паренхиме головного мозга. Однако, количественная оценка амилоидных бляшек выявила существенные различия между группами. В контрольной группе 2 (трансгенные мыши APP/PS1) среднее число бляшек в областях на один срез мозга (ЧБ) составляло ЧБ = 31,7 ± 4,9. В группе 3, где трангсенным мышам APP/PS1 вводили НАЕЕ, ЧБ = 24,7 ± 3,4. В группе 4, в которой трансгенным мышам APP/PS1 вводили заявляемый цинковый комплекс, ЧБ = 8,2 ±2,9. Таким образом, результаты гистохимического анализа показали, что внутривенные инъекции цинкового комплекса приводили к почти 4-кратному уменьшению амилоидной нагрузки в гиппокампе трансгенных мышей APP/PS1, и по
этому показателю эффективность цинкового комплекса примерно в три раза выше таковой, выявленной для НАЕЕ. In the control group of wild-type mice (group 1), no amyloid plaques were detected (Table 4). Congophilic amyloid plaques visualized in the CAI, CA2, CAZ and dentate gyrus of the hippocampus of the brain of transgenic animals were similar in localization and size distribution in the brain parenchyma. However, quantification of amyloid plaques revealed significant differences between groups. In control group 2 (APP/PS1 transgenic mice), the average number of plaques per region per brain section (BS) was BL = 31.7 ± 4.9. In group 3, where transgenic APP/PS1 mice were treated with HAEE, BF = 24.7 ± 3.4. In group 4, in which APP/PS1 transgenic mice were administered the claimed zinc complex, BW = 8.2 ± 2.9. Thus, the results of histochemical analysis showed that intravenous injections of the zinc complex led to an almost 4-fold decrease in the amyloid load in the hippocampus of APP/PS1 transgenic mice, and With this indicator, the effectiveness of the zinc complex is approximately three times higher than that found for HAEE.
Пример 4. Специфическое связывание цинкового комплекса пептида НАЕЕ с человеческим бета-амилоидом (Ар42). Example 4. Specific binding of the zinc complex of the HAEE peptide to human beta-amyloid (Ap42).
Дополнительно была проведена оценка связывания заявляемого цинкового комплекса с бета-амилоидом как одного из механизмов действия данного комплекса при нейродегенеративных поражениях, связанных с бета-амилоидом. Образование комплексов между находящимся в растворе аналитом (заявляемый цинковый комплекс или НАЕЕ) и иммобилизованным 42-членным человеческим бета-амилоидом (лигандом) было исследовано с помощью БППР. По результатам таких экспериментов рассчитывали кинетические параметры взаимодействий и значение константы диссоциации (KD) взаимодействия цинкового и иммобилизованного лиганда. Если значение KD < Ю"4 М, то взаимодействие между цинковым комплексом и бета-амилоидом является биологически значимым. Additionally, the binding of the proposed zinc complex to beta-amyloid was assessed as one of the mechanisms of action of this complex in neurodegenerative lesions associated with beta-amyloid. The formation of complexes between the analyte in solution (the claimed zinc complex or HAEE) and the immobilized 42-membered human beta-amyloid (ligand) was studied using BPPR. Based on the results of such experiments, the kinetic parameters of interactions and the value of the dissociation constant (KD) of the interaction between the zinc and immobilized ligand were calculated. If the value of KD <10" 4 M, then the interaction between the zinc complex and beta-amyloid is biologically significant.
Взаимодействий между НАЕЕ и лигандом обнаружено не было. Напротив, при введении цинкового комплекса пептида НАЕЕ было обнаружено его взаимодействие с иммобилизованным А042 при его различных концентрациях 150, 300, 500, 1000, 1500 мкМ. На основании полученных данных были рассчитаны кинетические характеристики взаимодействия цинкового комплекса пептида НАЕЕ с иммобилизованным бета- амилоидом Ар42: коп = (1,37±0,06) х Ю3 M’ 1; koff = (5,89±0,06) х Ю’3 s’1; KD = (4,3±0,3) х 10’6 М. Кинетические характеристики оставались в этих же значениях пределах погрешности при исследовании цинкового комплекса с разным набором анионов - нитрат, ацетат, хлорид, сульфат, тартрат, цитрат, салицилат. No interactions were detected between HAEE and the ligand. On the contrary, when the zinc complex of the HAEE peptide was introduced, its interaction with immobilized A042 was detected at its various concentrations of 150, 300, 500, 1000, 1500 μM. Based on the data obtained, the kinetic characteristics of the interaction of the zinc complex of the HAEE peptide with the immobilized beta-amyloid Ap42 were calculated: kop = (1.37 ± 0.06) x 10 3 M'1; k off = (5.89±0.06) x 10' 3 s'1; K D = (4.3±0.3) x 10' 6 M. Kinetic characteristics remained within the same error limits when studying the zinc complex with a different set of anions - nitrate, acetate, chloride, sulfate, tartrate, citrate, salicylate.
Таким образом, на основании вышеприведенных результатов доказано образование стабильных межмолекулярных комплексов между 42-членным человеческим бета- амилоидом (А 42) и цинковым комплексом пептида НАЕЕ. В отличие от цинкового комплекса пептида НАЕЕ, нативный пептид НАЕЕ в идентичных экспериментальных условиях не взаимодействует с Ар42. Thus, based on the above results, the formation of stable intermolecular complexes between the 42-membered human amyloid beta (A 42) and the zinc complex of the HAEE peptide has been proven. Unlike the zinc complex of the HAEE peptide, the native HAEE peptide does not interact with Ap42 under identical experimental conditions.
Полученные в данном Примере настоящего изобретения результаты указывают на отсутствие способности НАЕЕ связываться с Ар42. Напротив, цинковый комплекс пептида НАЕЕ связывается с Ар42. Несмотря на то, что и НАЕЕ и заявляемый цинковый комплекс при введении в кровеносную систему трансгенных мышей APP/PS1 улучшают когнитивные функции и снижают количество амилоидных бляшек у экспериментальных животных (Примеры 3.1 и 3.2 настоящего изобретения), полученные результаты
свидетельствует о различных молекулярных механизмах терапевтического воздействия НАЕЕ и заявляемого цинкового комплекса, что, в свою очередь, исключает биоэквивалентность НАЕЕ и заявляемого цинкового комплекса при их использовании для лечения нейродегенеративных заболеваний.
The results obtained in this Example of the present invention indicate the absence of the ability of HAEE to bind to Ap42. In contrast, the zinc complex of the HAEE peptide binds to Ap42. Despite the fact that both HAEE and the claimed zinc complex, when introduced into the circulatory system of APP/PS1 transgenic mice, improve cognitive function and reduce the number of amyloid plaques in experimental animals (Examples 3.1 and 3.2 of the present invention), the results obtained indicates different molecular mechanisms of the therapeutic effects of HAEE and the claimed zinc complex, which, in turn, excludes the bioequivalence of HAEE and the claimed zinc complex when used for the treatment of neurodegenerative diseases.
Таблица 1. Объемы реагентов для приготовления цинковых комплексов НАЕЕ с различными анионами.
Table 1. Volumes of reagents for the preparation of zinc complexes of HAEE with various anions.
Таблица 2. Смещение сигналов протонов в 'Н-ЯМР-спектре заявляемого цинкового комплекса по сравнению с НАЕЕ.
Table 2. Shift of proton signals in the 'H-NMR spectrum of the proposed zinc complex compared to HAEE.
Таблица 3. Данные по стабильности цинкового комплекса пептида НАЕЕ в тесте ускоренного хранения (40 °C, 75% влажности).
Table 3. Data on the stability of the zinc complex of the HAEE peptide in the accelerated storage test (40 °C, 75% humidity).
Таблица 4. Состав фармацевтических композиций с цинковым комплексом пептида НАЕЕ. В/м - внутримышечное введение, в/в - внутривенное введение.
Table 4. Composition of pharmaceutical compositions with the zinc complex of the HAEE peptide. IM - intramuscular administration, IV - intravenous administration.
Таблица 5. Влияние цинкового комплекса пептида НАЕЕ на когнитивные функции у мышей в тесте «закапывание шариков» и на количество амилоидных бляшек.Table 5. Effect of the zinc complex of the HAEE peptide on cognitive functions in mice in the bead-burying test and on the number of amyloid plaques.
Применяемый уровень значимости составлял 99,9% (Р <0,001).
The significance level used was 99.9% (P < 0.001).
Claims
1. Цинковый комплекс формулы [Zn(HAEE)]mXn, где Zn представляет собой двухзарядный катион цинка (II), m = 1 для однозарядных и двухзарядных анионов, m = 3 для трехзарядных анионов, НАЕЕ представляет собой синтетический пептид, ацетилированный по N-концу и амидированный по С- концу, с аминокислотной последовательностью His-Ala-Glu-Glu, X - фармацевтически приемлемый анион, п = 1 для двухзарядных анионов, п = 2 для однозарядных и трехзарядных анионов. 1. Zinc complex of the formula [Zn(HAEE)] m X n , where Zn is a doubly charged zinc (II) cation, m = 1 for singly and doubly charged anions, m = 3 for triply charged anions, HAEE is a synthetic peptide acetylated at N-terminus and amidated at the C-terminus, with the amino acid sequence His-Ala-Glu-Glu, X is a pharmaceutically acceptable anion, n = 1 for doubly charged anions, n = 2 for singly and triply charged anions.
2. Цинковый комплекс по п. 1 , в котором фармацевтически приемлемый анион выбирается из группы ацетата (С2Н3О2), сульфата (SO4), хлорида (CI), нитрата (NO3), бензоата (С7Н5О2), салицилата (С7Н5О3), тартрата (С4Н4О6), цитрата (С6Н5О7), сукцината (С4Н4О4). 2. Zinc complex according to claim 1, in which the pharmaceutically acceptable anion is selected from the group of acetate (C2H3O2), sulfate (SO 4 ), chloride (CI), nitrate (NO 3 ), benzoate (C 7 H 5 O 2 ), salicylate (C7H5O3), tartrate (C 4 H 4 O 6 ), citrate (C 6 H 5 O 7 ), succinate (C 4 H 4 O 4 ).
3. Цинковый комплекс по п. 1 который представляет собой [Zn(HAEE)](C2H3O2)2>3. Zinc complex according to claim 1 which is [Zn(HAEE)](C2H 3 O2)2>
[Zn(HAEE)](SO4), [Zn(HAEE)](CI)2, [Zn(HAEE)](NO3)2, [Zn(HAEE)](C7H5O2)2,[Zn(HAEE)](SO 4 ), [Zn(HAEE)](CI) 2 , [Zn(HAEE)](NO 3 ) 2 , [Zn(HAEE)](C 7 H 5 O 2 )2,
[Zn(HAEE)](C7H5O3)2, [Zn(HAEE)](C4H4O6), [Zn(HAEE)]2(C6H5O7)3,[Zn(HAEE)](C 7 H 5 O 3 )2, [Zn(HAEE)](C 4 H 4 O 6 ), [Zn(HAEE)]2(C 6 H 5 O 7 )3,
[Zn(HAEE)](C4H4O4). [Zn(HAEE)](C 4 H 4 O 4 ).
4. Цинковый комплекс по п. 1 , который представляет собой в твердом виде аморфную фазу. 4. Zinc complex according to claim 1, which is an amorphous phase in solid form.
5. Цинковый комплекс по п. 1 , который характеризуется дифрактограммой, представленной на Фиг. 1 ,2. 5. Zinc complex according to claim 1, which is characterized by the diffraction pattern shown in Fig. 12.
6. Цинковый комплекс по п. 1 , который характеризуется кривой дифференциальной сканирующей калориметрии, представленной на Фиг. 4. 6. Zinc complex according to claim 1, which is characterized by the differential scanning calorimetry curve presented in Fig. 4.
/.Фармацевтическая композиция для лечения нейродегенеративных заболеваний, содержащая в качестве активного вещества цинковый комплекс формулы [Zn(HAEE)]mXn, где Zn представляет собой двухзарядный катион цинка (II), m = 1 для однозарядных и двухзарядных анионов, m = 3 для трехзарядных анионов, НАЕЕ представляет собой синтетический пептид, ацетилированный по N-концу и амидированный по С-концу, с аминокислотной последовательностью His-Ala-Glu-Glu, X - фармацевтически приемлемый анион, п = 1 для двухзарядных анионов, п = 2 для однозарядных и трехзарядных анионов, в эффективном количестве и фармацевтически приемлемые добавки. /.Pharmaceutical composition for the treatment of neurodegenerative diseases, containing as an active substance a zinc complex of the formula [Zn(HAEE)] m X n , where Zn is a doubly charged zinc (II) cation, m = 1 for singly and doubly charged anions, m = 3 for triply charged anions, HAEE is a synthetic peptide, acetylated at the N-terminus and amidated at the C-terminus, with the amino acid sequence His-Ala-Glu-Glu, X is a pharmaceutically acceptable anion, n = 1 for doubly charged anions, n = 2 for singly and triply charged anions, in effective amounts and pharmaceutically acceptable additives.
8. Фармацевтическая композиция по п. 7, которая представлена твердой или жидкой формой.
8. Pharmaceutical composition according to claim 7, which is presented in solid or liquid form.
9. Фармацевтическая композиция по п. 7, в которой цинковый комплекс находится в виде аморфной формы. 9. Pharmaceutical composition according to claim 7, in which the zinc complex is in the form of an amorphous form.
10. Фармацевтическая композиция по п. 9, в которой аморфная форма цинкового комплекса характеризуется дифрактограммой на Фиг. 1 ,2. 10. The pharmaceutical composition according to claim 9, in which the amorphous form of the zinc complex is characterized by a diffraction pattern in FIG. 12.
11.Фармацевтическая композиция по п. 7, в которой эффективное количество цинкового комплекса составляет от 0,1 до 100 мг. 11. The pharmaceutical composition according to claim 7, in which the effective amount of the zinc complex is from 0.1 to 100 mg.
12. Фармацевтическая композиция по п. 7, в которой эффективное количество цинкового комплекса составляет от 5 до 50 мг. 12. The pharmaceutical composition according to claim 7, in which the effective amount of the zinc complex is from 5 to 50 mg.
13. Фармацевтическая композиция по п. 7 для лечения болезни Альцгеймера.13. Pharmaceutical composition according to claim 7 for the treatment of Alzheimer's disease.
14. Фармацевтическая композиция по п. 7, предназначенная для восстановления когнитивных функций, нарушенных вследствие нейродегенеративных заболеваний. 14. Pharmaceutical composition according to claim 7, intended for the restoration of cognitive functions impaired due to neurodegenerative diseases.
15. Фармацевтическая композиция по п. 14, применяющаяся при воспалительных причинах нейродегенеративных заболеваний. 15. Pharmaceutical composition according to claim 14, used for inflammatory causes of neurodegenerative diseases.
16. Фармацевтическая композиция по п. 7, в которой вспомогательные фармацевтически приемлемые добавки представляют собой маннитол, повидон К16. Pharmaceutical composition according to claim 7, in which the auxiliary pharmaceutically acceptable additives are mannitol, povidone K
17. трометамол, динатрия эдетат, натрия хлорид, сахароза, гистидин, полоксамер 407. 17. trometamol, disodium edetate, sodium chloride, sucrose, histidine, poloxamer 407.
17. Фармацевтическая композиция по п. 7, которая представляет собой лиофилизат. 17. Pharmaceutical composition according to claim 7, which is a lyophilisate.
18. Фармацевтическая композиция по п. 7, предназначенная для введения внутривенным, внутриартериальным, внутрибрюшинным, подкожным, накожным, трансдермальным, внутримышечным, интратекальным, субарахноидальным, пероральным, интраназальным, сублингвальным, буккальным, ректальным способом. 18. Pharmaceutical composition according to claim 7, intended for administration by intravenous, intraarterial, intraperitoneal, subcutaneous, cutaneous, transdermal, intramuscular, intrathecal, subarachnoid, oral, intranasal, sublingual, buccal, rectal route.
19. Способ получения цинкового комплекса формулы [Zn(HAEE)]mXn, где Zn представляет собой двухзарядный катион цинка (II), m = 1 для однозарядных и двухзарядных анионов, m = 3 для трехзарядных анионов, НАЕЕ представляет собой синтетический тетрапептид, ацетилированный по N-концу и амидированный по С-концу, с аминокислотной последовательностью His-Ala-Glu- Glu, X - фармацевтически приемлемый анион, п = 1 для двухзарядных анионов, п = 2 для однозарядных и трехзарядных анионов, заключающийся в том, что пептид НАЕЕ смешивают с солью цинка в эквимолярном соотношении в водном растворе или буферном растворе при комнатной температуре, замораживают и высушивают.
19. Method for obtaining a zinc complex of the formula [Zn(HAEE)] m X n , where Zn is a doubly charged zinc (II) cation, m = 1 for singly and doubly charged anions, m = 3 for triply charged anions, HAEE is a synthetic tetrapeptide, acetylated at the N-terminus and amidated at the C-terminus, with the amino acid sequence His-Ala-Glu-Glu, X is a pharmaceutically acceptable anion, n = 1 for doubly charged anions, n = 2 for singly and triply charged anions, consisting in the fact that HAEE peptide is mixed with zinc salt in an equimolar ratio in an aqueous solution or buffer solution at room temperature, frozen and dried.
20. Способ получения по п. 19, в котором соль цинка представляет собой ацетат, сульфат, хлорид, нитрат. 20. The production method according to claim 19, in which the zinc salt is acetate, sulfate, chloride, nitrate.
21. Способ получения по п. 19, в котором при необходимости замещают анион другим фармацевтически приемлемым анионом. 21. The method of production according to claim 19, in which, if necessary, the anion is replaced with another pharmaceutically acceptable anion.
22. Способ получения по п. 21 , в котором фармацевтически приемлемый анион представляет собой одно-, дву- или три- зарядные органические соединения, содержащие -СООН группу. 22. The method of production according to claim 21, in which the pharmaceutically acceptable anion is a mono-, doubly or tri-charged organic compound containing a -COOH group.
23. Применение цинкового комплекса [Zn(HAEE)]mXn, где Zn представляет собой двухзарядный катион цинка (II), m = 1 для однозарядных и двухзарядных анионов, m = 3 для трехзарядных анионов, НАЕЕ представляет собой синтетический пептид, ацетилированный по N-концу и амидированный по С- концу, с аминокислотной последовательностью His-Ala-Glu-Glu, X - фармацевтически приемлемый анион, п = 1 для двухзарядных анионов, п = 2 для однозарядных и трехзарядных анионов, для лечения нейродегенеративных заболеваний. 23. Application of the zinc complex [Zn(HAEE)] m X n , where Zn is a doubly charged zinc(II) cation, m = 1 for singly and doubly charged anions, m = 3 for triply charged anions, HAEE is a synthetic peptide acetylated at N-terminus and amidated at the C-terminus, with the amino acid sequence His-Ala-Glu-Glu, X is a pharmaceutically acceptable anion, n = 1 for doubly charged anions, n = 2 for singly and triply charged anions, for the treatment of neurodegenerative diseases.
24. Применение соединения по п. 23, для лечения болезни Альцгеймера. 24. Use of a compound according to claim 23 for the treatment of Alzheimer's disease.
25. Применение соединения по п. 23, для восстановления когнитивных функций, нарушенных вследствие нейродегенеративных заболеваний.. 25. Use of the compound according to claim 23 for the restoration of cognitive functions impaired due to neurodegenerative diseases.
26. Применение соединения по п. 23, для восстановления когнитивных функций при воспалительных причинах нейродегенеративных заболеваний. 26. Use of the compound according to claim 23 for the restoration of cognitive functions in inflammatory causes of neurodegenerative diseases.
27. Применение соединения по п. 23 при его введении внутривенным, внутриартериальным, внутрибрюшинным, подкожным, накожным, трансдермальным, внутримышечным, интратекальным, субарахноидальным, пероральным, интраназальным, сублингвальным, буккальным, ректальным способом. 27. Use of the compound according to claim 23 when administered intravenously, intraarterially, intraperitoneally, subcutaneously, cutaneously, transdermal, intramuscular, intrathecal, subarachnoid, oral, intranasal, sublingual, buccal, rectal.
28. Применение соединения по п. 23, которое терапевтически бионеэквивалентно применению НАЕЕ в нативной форме..
28. The use of a compound according to claim 23, which is therapeutically bioequivalent to the use of HAEE in its native form.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| RU2022119474 | 2022-07-15 | ||
| RU2022119474A RU2784319C1 (en) | 2022-07-15 | Haee peptide zinc complex for the treatment of neurodegenerative diseases |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2024014983A1 true WO2024014983A1 (en) | 2024-01-18 |
Family
ID=89537191
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/RU2023/000210 WO2024014983A1 (en) | 2022-07-15 | 2023-07-12 | Zinc complex of haee peptide for treating neurodegenerative diseases |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2024014983A1 (en) |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012056157A1 (en) * | 2010-10-27 | 2012-05-03 | Kimonella Ventures Ltd | Peptide compound useful for inhibiting amyloid plaque formation |
| RU2709539C1 (en) * | 2019-08-15 | 2019-12-18 | Акционерное общество "Опытно-Экспериментальный завод "ВладМиВа" | Pharmaceutical composition based on haee peptide for treating neurodegenerative diseases |
-
2023
- 2023-07-12 WO PCT/RU2023/000210 patent/WO2024014983A1/en unknown
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012056157A1 (en) * | 2010-10-27 | 2012-05-03 | Kimonella Ventures Ltd | Peptide compound useful for inhibiting amyloid plaque formation |
| RU2709539C1 (en) * | 2019-08-15 | 2019-12-18 | Акционерное общество "Опытно-Экспериментальный завод "ВладМиВа" | Pharmaceutical composition based on haee peptide for treating neurodegenerative diseases |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9790262B2 (en) | Compositions comprising glucagon analogs and methods of making and using the same | |
| EP1623719B1 (en) | Treatment of alzheimer's disease and cerebral amyloid angiopathy | |
| US7897568B2 (en) | Compositions for treatment of cancer | |
| KR20050103483A (en) | AMYLOID β(1-42) OLIGOMERS, DERIVATIVES THEREOF, ANTIBODIES FOR THE SAME, METHOD FOR PRODUCTION AND USE THEREOF | |
| MX2010013648A (en) | Compounds for treating beta-amyloidoses. | |
| US8293704B2 (en) | Crystalline form of linaclotide | |
| JP5893614B2 (en) | Compounds and methods for the treatment of Alzheimer's disease and familial dementia | |
| AU2005221187B2 (en) | Method for inhibiting immune complex formation in a subjetc | |
| JP4079775B2 (en) | Soluble cyclic analog of β-amyloid peptide | |
| US9675679B2 (en) | Vaccines and methods for controlling adiposity | |
| US20100331262A1 (en) | PEPTIDE VACCINE USING MIMIC MOLECULES OF AMYLOID Beta PEPTIDE | |
| RU2784732C1 (en) | Haee peptide copper complex for the treatment of neurodegenerative diseases | |
| RU2784319C1 (en) | Haee peptide zinc complex for the treatment of neurodegenerative diseases | |
| RU2784746C1 (en) | Haee peptide magnesium complex for the treatment of neurodegenerative diseases | |
| RU2785354C1 (en) | Peptide calcium complex for the treatment of neurodegenerative diseases | |
| WO2024014983A1 (en) | Zinc complex of haee peptide for treating neurodegenerative diseases | |
| WO2024014982A1 (en) | Copper complex of haee peptide for treating neurodegenerative diseases | |
| WO2024014985A1 (en) | Calcium complex of haee peptide for treating neurodegenerative diseases | |
| WO2024014986A1 (en) | Magnesium complex of haee peptide for treating neurodegenerative diseases | |
| RU2784326C1 (en) | Sodium salt of haee peptide for the treatment of neurodegenerative diseases | |
| RU2784425C1 (en) | Potassium salt of haee peptide for the treatment of neurodegenerative diseases | |
| RU2784249C1 (en) | Ammonium salt of haee peptide for the treatment of neurodegenerative diseases | |
| WO2024014981A1 (en) | Sodium salt of haee peptide for treating neurodegenerative diseases | |
| US20080139456A1 (en) | Macrocyclic Sh2 Domain Binding Inhibitors | |
| WO2024014980A1 (en) | Potassium salt of haee peptide for treating neurodegenerative diseases |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23840046 Country of ref document: EP Kind code of ref document: A1 |