RU2784746C1 - Haee peptide magnesium complex for the treatment of neurodegenerative diseases - Google Patents
Haee peptide magnesium complex for the treatment of neurodegenerative diseases Download PDFInfo
- Publication number
- RU2784746C1 RU2784746C1 RU2022119485A RU2022119485A RU2784746C1 RU 2784746 C1 RU2784746 C1 RU 2784746C1 RU 2022119485 A RU2022119485 A RU 2022119485A RU 2022119485 A RU2022119485 A RU 2022119485A RU 2784746 C1 RU2784746 C1 RU 2784746C1
- Authority
- RU
- Russia
- Prior art keywords
- haee
- magnesium complex
- magnesium
- complex
- peptide
- Prior art date
Links
- 239000011777 magnesium Substances 0.000 title claims abstract description 216
- 229910052749 magnesium Inorganic materials 0.000 title claims abstract description 158
- FYYHWMGAXLPEAU-UHFFFAOYSA-N magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 title claims abstract description 157
- 206010053643 Neurodegenerative disease Diseases 0.000 title claims abstract description 34
- 150000001450 anions Chemical class 0.000 claims abstract description 54
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 29
- 239000000126 substance Substances 0.000 claims abstract description 25
- PTFCDOFLOPIGGS-UHFFFAOYSA-N zinc dication Chemical compound [Zn+2] PTFCDOFLOPIGGS-UHFFFAOYSA-N 0.000 claims abstract description 11
- 206010001897 Alzheimer's disease Diseases 0.000 claims description 22
- 239000011780 sodium chloride Substances 0.000 claims description 21
- FAPWRFPIFSIZLT-UHFFFAOYSA-M sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 claims description 19
- 239000007864 aqueous solution Substances 0.000 claims description 18
- 239000007788 liquid Substances 0.000 claims description 17
- 230000003920 cognitive function Effects 0.000 claims description 12
- 239000007787 solid Substances 0.000 claims description 12
- 159000000003 magnesium salts Chemical class 0.000 claims description 10
- 238000001990 intravenous administration Methods 0.000 claims description 9
- JLVVSXFLKOJNIY-UHFFFAOYSA-N magnesium ion Chemical compound [Mg+2] JLVVSXFLKOJNIY-UHFFFAOYSA-N 0.000 claims description 9
- FBPFZTCFMRRESA-KAZBKCHUSA-N D-Mannitol Natural products OC[C@@H](O)[C@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KAZBKCHUSA-N 0.000 claims description 8
- FBPFZTCFMRRESA-KVTDHHQDSA-N Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 claims description 8
- 150000001413 amino acids Chemical group 0.000 claims description 8
- 238000001938 differential scanning calorimetry curve Methods 0.000 claims description 8
- 230000002757 inflammatory Effects 0.000 claims description 8
- 239000000594 mannitol Substances 0.000 claims description 8
- 235000010355 mannitol Nutrition 0.000 claims description 8
- 238000002360 preparation method Methods 0.000 claims description 8
- 229920003079 Povidone K 17 Polymers 0.000 claims description 7
- 229960002668 sodium chloride Drugs 0.000 claims description 7
- 229960002885 Histidine Drugs 0.000 claims description 6
- QTBSBXVTEAMEQO-UHFFFAOYSA-M acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 claims description 6
- 239000000654 additive Substances 0.000 claims description 6
- 150000001875 compounds Chemical class 0.000 claims description 6
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical compound OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 claims description 5
- 229960001860 salicylate Drugs 0.000 claims description 5
- LENZDBCJOHFCAS-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 claims description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N D-sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 claims description 4
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 claims description 4
- 229940044476 Poloxamer 407 Drugs 0.000 claims description 4
- CZMRCDWAGMRECN-GDQSFJPYSA-N Sucrose Natural products O([C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](CO)O1)[C@@]1(CO)[C@H](O)[C@@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-GDQSFJPYSA-N 0.000 claims description 4
- 229960004793 Sucrose Drugs 0.000 claims description 4
- VEXZGXHMUGYJMC-UHFFFAOYSA-M chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 claims description 4
- ZGTMUACCHSMWAC-UHFFFAOYSA-L disodium;2-[2-[carboxylatomethyl(carboxymethyl)amino]ethyl-(carboxymethyl)amino]acetate Chemical compound [Na+].[Na+].OC(=O)CN(CC([O-])=O)CCN(CC(O)=O)CC([O-])=O ZGTMUACCHSMWAC-UHFFFAOYSA-L 0.000 claims description 4
- 230000001771 impaired Effects 0.000 claims description 4
- 229920001992 poloxamer 407 Polymers 0.000 claims description 4
- 239000005720 sucrose Substances 0.000 claims description 4
- 229960000281 trometamol Drugs 0.000 claims description 4
- KRKNYBCHXYNGOX-UHFFFAOYSA-K 2qpq Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 claims description 3
- WPYMKLBDIGXBTP-UHFFFAOYSA-M benzoate Chemical compound [O-]C(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-M 0.000 claims description 3
- 238000001361 intraarterial administration Methods 0.000 claims description 3
- 238000007918 intramuscular administration Methods 0.000 claims description 3
- 238000007912 intraperitoneal administration Methods 0.000 claims description 3
- 238000007913 intrathecal administration Methods 0.000 claims description 3
- 238000004519 manufacturing process Methods 0.000 claims description 3
- NHNBFGGVMKEFGY-UHFFFAOYSA-N nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 claims description 3
- 238000007920 subcutaneous administration Methods 0.000 claims description 3
- 229940086735 succinate Drugs 0.000 claims description 3
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 claims description 3
- QAOWNCQODCNURD-UHFFFAOYSA-L sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 claims description 3
- FEWJPZIEWOKRBE-XIXRPRMCSA-N Mesotartaric acid Chemical compound OC(=O)[C@@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-XIXRPRMCSA-N 0.000 claims description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 2
- 229940095064 tartrate Drugs 0.000 claims description 2
- 230000002500 effect on skin Effects 0.000 claims 2
- 239000007853 buffer solution Substances 0.000 claims 1
- 150000002894 organic compounds Chemical class 0.000 claims 1
- 230000000694 effects Effects 0.000 abstract description 15
- 150000002680 magnesium Chemical class 0.000 abstract description 4
- 125000003275 alpha amino acid group Chemical group 0.000 abstract 1
- 229940091250 Magnesium supplements Drugs 0.000 description 141
- 238000010175 APPswe/PSEN1dE9 Methods 0.000 description 29
- 241000699660 Mus musculus Species 0.000 description 28
- 230000003993 interaction Effects 0.000 description 27
- 238000010178 5xFAD (B6SJL) Methods 0.000 description 24
- 238000010179 5xFAD (C57BL6) Methods 0.000 description 24
- 239000000243 solution Substances 0.000 description 24
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 21
- 210000002381 Plasma Anatomy 0.000 description 18
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 17
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 17
- 230000001225 therapeutic Effects 0.000 description 16
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 16
- 210000004556 Brain Anatomy 0.000 description 15
- 241001465754 Metazoa Species 0.000 description 15
- 239000011701 zinc Substances 0.000 description 14
- 108091006822 Human Serum Albumin Proteins 0.000 description 13
- 102000008100 Human Serum Albumin Human genes 0.000 description 13
- 238000004458 analytical method Methods 0.000 description 13
- 230000027455 binding Effects 0.000 description 12
- 230000015572 biosynthetic process Effects 0.000 description 12
- 238000005755 formation reaction Methods 0.000 description 11
- 238000002329 infrared spectrum Methods 0.000 description 11
- 238000000034 method Methods 0.000 description 10
- 239000000523 sample Substances 0.000 description 10
- 230000006399 behavior Effects 0.000 description 9
- 239000003814 drug Substances 0.000 description 9
- HCHKCACWOHOZIP-UHFFFAOYSA-N zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 9
- 229910052725 zinc Inorganic materials 0.000 description 9
- 210000001320 Hippocampus Anatomy 0.000 description 8
- 239000007924 injection Substances 0.000 description 8
- 239000000203 mixture Substances 0.000 description 8
- 241000699666 Mus <mouse, genus> Species 0.000 description 7
- 230000003542 behavioural Effects 0.000 description 7
- 238000003860 storage Methods 0.000 description 7
- 150000001793 charged compounds Chemical class 0.000 description 6
- 229940079593 drugs Drugs 0.000 description 6
- 238000004128 high performance liquid chromatography Methods 0.000 description 6
- 150000002500 ions Chemical class 0.000 description 6
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 6
- 238000002844 melting Methods 0.000 description 6
- 238000000425 proton nuclear magnetic resonance spectrum Methods 0.000 description 6
- 210000004369 Blood Anatomy 0.000 description 5
- 210000001218 Blood-Brain Barrier Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- BDAGIHXWWSANSR-UHFFFAOYSA-N formic acid Chemical compound OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 5
- 238000004108 freeze drying Methods 0.000 description 5
- 230000001744 histochemical Effects 0.000 description 5
- 239000003446 ligand Substances 0.000 description 5
- 150000003839 salts Chemical class 0.000 description 5
- 239000007790 solid phase Substances 0.000 description 5
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- 230000034994 death Effects 0.000 description 4
- 238000000113 differential scanning calorimetry Methods 0.000 description 4
- 238000000132 electrospray ionisation Methods 0.000 description 4
- 229910001425 magnesium ion Inorganic materials 0.000 description 4
- 230000011514 reflex Effects 0.000 description 4
- WSVLPVUVIUVCRA-RJMJUYIDSA-N (2R,3R,4S,5R,6S)-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxane-3,4,5-triol;hydrate Chemical compound O.O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O WSVLPVUVIUVCRA-RJMJUYIDSA-N 0.000 description 3
- 102100001249 ALB Human genes 0.000 description 3
- 101710027066 ALB Proteins 0.000 description 3
- 210000001736 Capillaries Anatomy 0.000 description 3
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 3
- 210000001947 Dentate Gyrus Anatomy 0.000 description 3
- 229960001021 Lactose Monohydrate Drugs 0.000 description 3
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L MgCl2 Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 3
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 3
- -1 Zn(II) ions Chemical class 0.000 description 3
- 229940050528 albumin Drugs 0.000 description 3
- 230000002490 cerebral Effects 0.000 description 3
- 230000001149 cognitive Effects 0.000 description 3
- 239000010949 copper Substances 0.000 description 3
- 238000010192 crystallographic characterization Methods 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 238000002149 energy-dispersive X-ray emission spectroscopy Methods 0.000 description 3
- 229940050410 gluconate Drugs 0.000 description 3
- 239000012535 impurity Substances 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 3
- 235000019359 magnesium stearate Nutrition 0.000 description 3
- 238000004949 mass spectrometry Methods 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 229940016286 microcrystalline cellulose Drugs 0.000 description 3
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 3
- 239000008108 microcrystalline cellulose Substances 0.000 description 3
- 238000000302 molecular modelling Methods 0.000 description 3
- 239000012188 paraffin wax Substances 0.000 description 3
- 230000001575 pathological Effects 0.000 description 3
- 239000012071 phase Substances 0.000 description 3
- KWYUFKZDYYNOTN-UHFFFAOYSA-M potassium hydroxide Chemical compound [OH-].[K+] KWYUFKZDYYNOTN-UHFFFAOYSA-M 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 3
- 231100000486 side effect Toxicity 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 230000036912 Bioavailability Effects 0.000 description 2
- 229940098773 Bovine Serum Albumin Drugs 0.000 description 2
- 108091003117 Bovine Serum Albumin Proteins 0.000 description 2
- IQFVPQOLBLOTPF-HKXUKFGYSA-L Congo red Chemical compound [Na+].[Na+].C1=CC=CC2=C(N)C(/N=N/C3=CC=C(C=C3)C3=CC=C(C=C3)/N=N/C3=C(C4=CC=CC=C4C(=C3)S([O-])(=O)=O)N)=CC(S([O-])(=O)=O)=C21 IQFVPQOLBLOTPF-HKXUKFGYSA-L 0.000 description 2
- 206010012289 Dementia Diseases 0.000 description 2
- 229960002989 Glutamic Acid Drugs 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N HCl Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 229940001447 Lactate Drugs 0.000 description 2
- 102100008812 PSEN1 Human genes 0.000 description 2
- 206010061536 Parkinson's disease Diseases 0.000 description 2
- 229940049954 Penicillin Drugs 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- WEVYAHXRMPXWCK-UHFFFAOYSA-N acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 2
- 102000015296 acetylcholine-gated cation-selective channel activity proteins Human genes 0.000 description 2
- 108040006409 acetylcholine-gated cation-selective channel activity proteins Proteins 0.000 description 2
- 230000002378 acidificating Effects 0.000 description 2
- 239000012062 aqueous buffer Substances 0.000 description 2
- 125000004429 atoms Chemical group 0.000 description 2
- 229960000626 benzylpenicillin Drugs 0.000 description 2
- 230000035514 bioavailability Effects 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 150000001768 cations Chemical class 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 230000000875 corresponding Effects 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000001035 drying Methods 0.000 description 2
- 238000000921 elemental analysis Methods 0.000 description 2
- 230000002708 enhancing Effects 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 235000019253 formic acid Nutrition 0.000 description 2
- 239000012520 frozen sample Substances 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- 238000010438 heat treatment Methods 0.000 description 2
- 238000004896 high resolution mass spectrometry Methods 0.000 description 2
- 238000000589 high-performance liquid chromatography-mass spectrometry Methods 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 238000011068 load Methods 0.000 description 2
- 239000004579 marble Substances 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000001404 mediated Effects 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- OKKJLVBELUTLKV-UHFFFAOYSA-N methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 230000000626 neurodegenerative Effects 0.000 description 2
- 230000001264 neutralization Effects 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 230000003287 optical Effects 0.000 description 2
- 230000008506 pathogenesis Effects 0.000 description 2
- 230000000275 pharmacokinetic Effects 0.000 description 2
- 230000036231 pharmacokinetics Effects 0.000 description 2
- 239000002831 pharmacologic agent Substances 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 238000004321 preservation Methods 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 235000018102 proteins Nutrition 0.000 description 2
- 102000004169 proteins and genes Human genes 0.000 description 2
- 108090000623 proteins and genes Proteins 0.000 description 2
- 230000035489 relative bioavailability Effects 0.000 description 2
- 239000012266 salt solution Substances 0.000 description 2
- 238000001228 spectrum Methods 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 238000003756 stirring Methods 0.000 description 2
- 238000005160 1H NMR spectroscopy Methods 0.000 description 1
- AOHMFUYIHARAGR-UHFFFAOYSA-N 2-hydroxypropane-1,2,3-tricarboxylic acid;magnesium Chemical compound [Mg].[Mg].[Mg].OC(=O)CC(O)(C(O)=O)CC(O)=O.OC(=O)CC(O)(C(O)=O)CC(O)=O AOHMFUYIHARAGR-UHFFFAOYSA-N 0.000 description 1
- 238000010177 3xTg Methods 0.000 description 1
- 108060000460 APP Proteins 0.000 description 1
- 102100017796 APP Human genes 0.000 description 1
- 229940022663 Acetate Drugs 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 206010002022 Amyloidosis Diseases 0.000 description 1
- 206010002023 Amyloidosis Diseases 0.000 description 1
- 229940050390 Benzoate Drugs 0.000 description 1
- 210000002459 Blastocyst Anatomy 0.000 description 1
- 229940001468 Citrate Drugs 0.000 description 1
- 206010057668 Cognitive disease Diseases 0.000 description 1
- 229910002476 CuII Inorganic materials 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 230000036947 Dissociation constant Effects 0.000 description 1
- 210000001161 Embryo, Mammalian Anatomy 0.000 description 1
- 206010048554 Endothelial dysfunction Diseases 0.000 description 1
- 206010067410 Endotoxaemia Diseases 0.000 description 1
- 238000004252 FT/ICR mass spectrometry Methods 0.000 description 1
- 101710007376 H1-1 Proteins 0.000 description 1
- 230000036499 Half live Effects 0.000 description 1
- 101710017533 His1:CG33831 Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 229960003035 MAGNESIUM GLUCONATE Drugs 0.000 description 1
- 229940072082 Magnesium Salicylate Drugs 0.000 description 1
- UEGPKNKPLBYCNK-UHFFFAOYSA-L Magnesium acetate Chemical compound [Mg+2].CC([O-])=O.CC([O-])=O UEGPKNKPLBYCNK-UHFFFAOYSA-L 0.000 description 1
- CTUVIUYTHWPELF-IYEMJOQQSA-L Magnesium gluconate Chemical compound [Mg+2].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O CTUVIUYTHWPELF-IYEMJOQQSA-L 0.000 description 1
- OVGXLJDWSLQDRT-UHFFFAOYSA-L Magnesium lactate Chemical compound [Mg+2].CC(O)C([O-])=O.CC(O)C([O-])=O OVGXLJDWSLQDRT-UHFFFAOYSA-L 0.000 description 1
- MQHWFIOJQSCFNM-UHFFFAOYSA-L Magnesium salicylate Chemical compound [Mg+2].OC1=CC=CC=C1C([O-])=O.OC1=CC=CC=C1C([O-])=O MQHWFIOJQSCFNM-UHFFFAOYSA-L 0.000 description 1
- 230000036740 Metabolism Effects 0.000 description 1
- 241000896769 Multiple sclerosis associated retrovirus Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 210000004897 N-terminal region Anatomy 0.000 description 1
- 210000004940 Nucleus Anatomy 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 102000012412 Presenilin-1 Human genes 0.000 description 1
- 108010036933 Presenilin-1 Proteins 0.000 description 1
- 229940076788 Pyruvate Drugs 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 208000007400 Relapsing-Remitting Multiple Sclerosis Diseases 0.000 description 1
- 210000002966 Serum Anatomy 0.000 description 1
- 210000004001 Thalamic Nuclei Anatomy 0.000 description 1
- DTQVDTLACAAQTR-UHFFFAOYSA-M Trifluoroacetate Chemical compound [O-]C(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-M 0.000 description 1
- 238000002441 X-ray diffraction Methods 0.000 description 1
- JIAARYAFYJHUJI-UHFFFAOYSA-L Zinc chloride Chemical compound [Cl-].[Cl-].[Zn+2] JIAARYAFYJHUJI-UHFFFAOYSA-L 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 238000007792 addition Methods 0.000 description 1
- 231100000494 adverse effect Toxicity 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 235000001014 amino acid Nutrition 0.000 description 1
- DHMQDGOQFOQNFH-UHFFFAOYSA-M aminoacetate Chemical compound NCC([O-])=O DHMQDGOQFOQNFH-UHFFFAOYSA-M 0.000 description 1
- 239000012491 analyte Substances 0.000 description 1
- 239000010405 anode material Substances 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N aspartic acid group Chemical group N[C@@H](CC(=O)O)C(=O)O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 1
- 229940077388 benzenesulfonate Drugs 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000000903 blocking Effects 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- 238000009933 burial Methods 0.000 description 1
- 229910000099 calcium monohydride Inorganic materials 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- UXTMROKLAAOEQO-UHFFFAOYSA-N chloroform;ethanol Chemical compound CCO.ClC(Cl)Cl UXTMROKLAAOEQO-UHFFFAOYSA-N 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 230000003930 cognitive ability Effects 0.000 description 1
- 238000010835 comparative analysis Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 230000001419 dependent Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 1
- 210000002257 embryonic structures Anatomy 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000036545 exercise Effects 0.000 description 1
- WSFSSNUMVMOOMR-UHFFFAOYSA-N formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- VZCYOOQTPOCHFL-UHFFFAOYSA-N fumaric acid Chemical compound OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 230000002068 genetic Effects 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- JFCQEDHGNNZCLN-UHFFFAOYSA-L glutarate(2-) Chemical compound [O-]C(=O)CCCC([O-])=O JFCQEDHGNNZCLN-UHFFFAOYSA-L 0.000 description 1
- 239000003630 growth substance Substances 0.000 description 1
- 230000000971 hippocampal Effects 0.000 description 1
- 230000036571 hydration Effects 0.000 description 1
- 238000006703 hydration reaction Methods 0.000 description 1
- 230000002209 hydrophobic Effects 0.000 description 1
- 125000002883 imidazolyl group Chemical group 0.000 description 1
- 230000002519 immonomodulatory Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000000185 intracerebroventricular Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000005040 ion trap Methods 0.000 description 1
- 230000003902 lesions Effects 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 239000011654 magnesium acetate Substances 0.000 description 1
- 235000011285 magnesium acetate Nutrition 0.000 description 1
- 229940069446 magnesium acetate Drugs 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 229960005336 magnesium citrate Drugs 0.000 description 1
- 235000002538 magnesium citrate Nutrition 0.000 description 1
- 239000004337 magnesium citrate Substances 0.000 description 1
- 239000001755 magnesium gluconate Substances 0.000 description 1
- 235000015778 magnesium gluconate Nutrition 0.000 description 1
- 239000000626 magnesium lactate Substances 0.000 description 1
- 235000015229 magnesium lactate Nutrition 0.000 description 1
- 229960004658 magnesium lactate Drugs 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-L maleate(2-) Chemical compound [O-]C(=O)\C=C/C([O-])=O VZCYOOQTPOCHFL-UPHRSURJSA-L 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 230000035786 metabolism Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 201000009457 movement disease Diseases 0.000 description 1
- 230000004770 neurodegeneration Effects 0.000 description 1
- 230000003959 neuroinflammation Effects 0.000 description 1
- 230000002314 neuroinflammatory Effects 0.000 description 1
- 210000002569 neurons Anatomy 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- CTQNGGLPUBDAKN-UHFFFAOYSA-N o-xylene Chemical compound CC1=CC=CC=C1C CTQNGGLPUBDAKN-UHFFFAOYSA-N 0.000 description 1
- 230000003204 osmotic Effects 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- MYMOFIZGZYHOMD-UHFFFAOYSA-N oxygen Chemical compound O=O MYMOFIZGZYHOMD-UHFFFAOYSA-N 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 230000002093 peripheral Effects 0.000 description 1
- 238000001050 pharmacotherapy Methods 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000001681 protective Effects 0.000 description 1
- LCTONWCANYUPML-UHFFFAOYSA-M pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000002829 reduced Effects 0.000 description 1
- 238000005057 refrigeration Methods 0.000 description 1
- 230000003252 repetitive Effects 0.000 description 1
- 230000000717 retained Effects 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 125000003616 serine group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 239000003998 snake venom Substances 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 239000002594 sorbent Substances 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000004544 sputter deposition Methods 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 230000004083 survival Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000002194 synthesizing Effects 0.000 description 1
- 238000002411 thermogravimetry Methods 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 210000001519 tissues Anatomy 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-M toluene-4-sulfonate Chemical compound CC1=CC=C(S([O-])(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-M 0.000 description 1
- 231100000701 toxic element Toxicity 0.000 description 1
- 239000011573 trace mineral Substances 0.000 description 1
- 235000013619 trace mineral Nutrition 0.000 description 1
- 230000000472 traumatic Effects 0.000 description 1
- 201000004810 vascular dementia Diseases 0.000 description 1
- 235000020799 vitamin D status Nutrition 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 239000008096 xylene Substances 0.000 description 1
- 229940006486 zinc cation Drugs 0.000 description 1
- 239000011592 zinc chloride Substances 0.000 description 1
- 235000005074 zinc chloride Nutrition 0.000 description 1
- 230000004572 zinc-binding Effects 0.000 description 1
- 108010088577 zinc-binding protein Proteins 0.000 description 1
- AEMOLEFTQBMNLQ-BKBMJHBISA-N α-D-galacturonic acid Chemical compound O[C@H]1O[C@H](C(O)=O)[C@H](O)[C@H](O)[C@H]1O AEMOLEFTQBMNLQ-BKBMJHBISA-N 0.000 description 1
Images
Abstract
Description
Изобретение относится к магниевому комплексу пептида HAEE, который описывается формулой [Mg(НАЕЕ)]mXn, где Mg представляет собой двухзарядный катион магния (II), m = 1 для однозарядных и двухзарядных анионов, m = 3 для трехзарядных анионов, HAEE представляет собой синтетический пептид, ацетилированный по N-концу и амидированный по C-концу, с аминокислотной последовательностью His-Ala-Glu-Glu, Х – фармацевтически приемлемый анион, n = 1 для двухзарядных анионов, n = 2 для однозарядных и трехзарядных анионов. Настоящее изобретение также относится к способу получения магниевого комплекса пептида HAEE, к фармацевтическим композициям на его основе и применению магниевого комплекса для лечения нейродегенеративных заболеваний.The invention relates to the magnesium complex of the HAEE peptide, which is described by the formula [Mg(HAEE)] m X n , where Mg is a doubly charged magnesium (II) cation, m = 1 for singly and doubly charged anions, m = 3 for triply charged anions, HAEE is is a synthetic peptide acetylated at the N-terminus and amidated at the C-terminus, with the amino acid sequence His-Ala-Glu-Glu, X is a pharmaceutically acceptable anion, n = 1 for doubly charged anions, n = 2 for singly and triply charged anions. The present invention also relates to a method for producing a magnesium complex of the HAEE peptide, to pharmaceutical compositions based on it, and to the use of the magnesium complex for the treatment of neurodegenerative diseases.
Предшествующий уровень техникиPrior Art
Нейродегенеративные заболевания имеют ряд общих факторов развития и целый ряд других обобщающих механизмов (Litvinenko I.V., Krasakov I.V., Bisaga G.N. et al. Modern conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy. Zhurnal Nevrologii i Psikhiatrii imeni S.S. Korsakova. 2017; 117(6-2):3-10. (In Russ.). doi: 10.17116/jnevro2017117623-10), что может связывать болезнь Альцгеймера (БА), сосудистую деменцию, нейродегенерацию при рассеянном склерозе (РС), болезнь Паркинсона, а также болезнь Альцгеймера в условиях активации системного воспаления (Williams-Gray C.H., Wijeyekoon R., Yarnall A.J. et al. ICICLE-PD study group. Serum immune markers and disease progression in an incident Parkinson’s disease cohort (ICICLE-PD). Movement Disorders. 2016;31(7):995-1003. https://doi.org/10.1002/mds.26563). Воспаление относится к типовым патологическим процессам организма человека. Типовой патологический процесс проявляется определенным набором характерных признаков. В настоящее время считается, что нейродегенеративный процесс является вторичным по отношению к воспалительному (Mostafa A., Jalilvand S., Shoja Z. Et al. Multiple sclerosis-associated retrovirus, Epstein-barr virus, and vitamin D status in patients with relapsing remitting multiple sclerosis. Journal of Medical Virology. 2017. doi: 10.1002/jmv.24774; Litvinenko I.V., Krasakov I.V., Bisaga G.N. et al. Modern conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy. Zhurnal Nevrologii i Psikhiatrii imeni S.S. Korsakova. 2017;117(6-2):3-10. (In Russ.). doi: 10.17116/jnevro2017117623-10).Neurodegenerative diseases have a number of common development factors and a number of other generalizing mechanisms (Litvinenko I.V., Krasakov I.V., Bisaga G.N. et al. Modern conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy. Zhurnal Nevrologii i Psikhiatrii imeni S.S. Korsakova. 2017; 117(6 -2):3-10. (In Russ.) doi: 10.17116/jnevro2017117623-10), which may link Alzheimer's disease (AD), vascular dementia, neurodegeneration in multiple sclerosis (MS), Parkinson's disease, and Alzheimer's disease in conditions of activation of systemic inflammation (Williams-Gray C.H., Wijeyekoon R., Yarnall A.J. et al. ICICLE-PD study group. Serum immune markers and disease progression in an incident Parkinson's disease cohort (ICICLE-PD). Movement Disorders. 2016;31 (7):995-1003 https://doi.org/10.1002/mds.26563). Inflammation is one of the typical pathological processes of the human body. A typical pathological process is manifested by a certain set of characteristic features. It is currently believed that the neurodegenerative process is secondary to the inflammatory one (Mostafa A., Jalilvand S., Shoja Z. Et al. Multiple sclerosis-associated retrovirus, Epstein-barr virus, and vitamin D status in patients with relapsing remitting multiple sclerosis Journal of Medical Virology 2017 doi: 10.1002/jmv.24774 Litvinenko I.V., Krasakov I.V., Bisaga G.N. et al Modern conception of the pathogenesis of neurodegenerative diseases and therapeutic strategy Zhurnal Nevrologii i Psikhiatrii imeni S.S. Korsakova 2017; 117(6-2):3-10 (In Russ.) doi: 10.17116/jnevro2017117623-10).
Болезнь Альцгеймера является одним из наиболее распространённых нейродегенеративных заболеваний среди людей пожилого возраста и характеризуется нейритными бляшками, основным компонентом которых является пептид бета-амилоид (Аβ). N-концевая область 1-16 бета-амилоида является металл-связывающим доменом, где цинк (Zn) и медь (Cu) присоединяются к пептиду Аβ (Guilloreau L., Damian L., Coppel Y., et al. (2006). Structural and thermodynamical properties of CuII amyloid-β16/28 complexes associated with Alzheimer’s disease. JBIC Journal of Biological Inorganic Chemistry, 11(8), 1024-1038, doi: 10.1007/s00775-006-0154-1). Снижение уровня ионов цинка в крови за счет связывания ионов цинка специфическими хелатирующими агентами и/или блокирование взаимодействий пептида Аβ с ионами цинка может предотвратить патологии, связанные с этими взаимодействиями (Ayton S., Lei P., Bush A. Biometals and Their Therapeutic Implications in Alzheimer’s Disease. Neurotherapeutics. 2015. 12(1): p. 109-120). Высокие концентрации цинка вызывают преципитацию пептида Аβ и влияют на образование в специфических отделах мозга (гиппокамп, кортекс, таламические ядра) внеклеточных агрегатов Аβ (амилоидных бляшек), которые ассоциированы с развитием болезни Альцгеймера ((Frederickson C.J., Bush A.I. (2001). Synaptically released zinc: physiological functions and pathological effects. Biometals, 14(3), 353-366, doi: 10.1023/A:1012934207456). Поэтому применение цинка и других катионов в фармацевтических препаратах, которые могут взаимодействовать с таргетными мишенями в организме и лечить нейродегенеративные заболевания, в частности болезнь Альцгеймера, является нетривиальной решением.Alzheimer's disease is one of the most common neurodegenerative diseases among the elderly and is characterized by neuritic plaques, the main component of which is the peptide beta-amyloid (Aβ). The amyloid beta 1-16 N-terminal region is a metal-binding domain where zinc (Zn) and copper (Cu) are attached to the Aβ peptide (Guilloreau L., Damian L., Coppel Y., et al. (2006). Structural and thermodynamical properties of CuII amyloid-β16/28 complexes associated with Alzheimer's disease JBIC Journal of Biological Inorganic Chemistry, 11(8), 1024-1038, doi: 10.1007/s00775-006-0154-1). Reducing the level of zinc ions in the blood due to the binding of zinc ions to specific chelating agents and / or blocking the interactions of the Aβ peptide with zinc ions can prevent the pathologies associated with these interactions (Ayton S., Lei P., Bush A. Biometals and Their Therapeutic Implications in Alzheimer's Disease Neurotherapeutics 2015 12(1): pp. 109-120). High concentrations of zinc cause precipitation of the Aβ peptide and affect the formation in specific parts of the brain (hippocampus, cortex, thalamic nuclei) of extracellular aggregates of Aβ (amyloid plaques), which are associated with the development of Alzheimer's disease ((Frederickson C.J., Bush A.I. (2001). Synaptically released zinc: physiological functions and pathological effects Biometals, 14(3), 353-366, doi: 10.1023/A:1012934207456 Therefore, the use of zinc and other cations in pharmaceuticals that can interact with targeted targets in the body and treat neurodegenerative diseases , in particular Alzheimer's disease, is a non-trivial solution.
На сегодняшний день нет действующих эффективных препаратов, которые бы излечивали нейродегенеративные заболевания. Из научной и патентной литературы известны ряд пептидов, которые могли бы применяться при лечении таких заболеваний.To date, there are no active effective drugs that would cure neurodegenerative diseases. A number of peptides are known from the scientific and patent literature that could be used in the treatment of such diseases.
Из WO 2012/056157 и патента РФ № 2679080 известно соединение, представляющее собой Ac-HAEE-NH2 (далее – HAEE). В аббревиатуре НАЕЕ буквы означают: Н –гистидин, А – аланин, Е – глутаминовая кислота. НАЕЕ способно ингибировать взаимодействие пептидов Аβ с ионами Zn (II), вызывая уменьшение или предотвращение агрегации пептида Аβ в присутствии ионов Zn (II) при физиологических концентрациях ионов Zn (II) 100-400 мкМ. Более высокие концентрации ионов Zn (II), порядка 1 ммоль (мМ), подавляют взаимодействия между НАЕЕ и 1-16 областью Aβ. Было показано, что инкубация агрегатов Аβ с HAEE в течение минимум 1 часа при 20, 40, 80, 100 и 150 мкМ HAEE приводит к дезагрегации таких агрегатов.From WO 2012/056157 and RF patent No. 2679080, a compound is known that is Ac-HAEE-NH 2 (hereinafter referred to as HAEE). In the abbreviation HAEE, the letters mean: H - histidine, A - alanine, E - glutamic acid. HAEE is able to inhibit the interaction of Aβ peptides with Zn (II) ions, causing a decrease or prevention of Aβ peptide aggregation in the presence of Zn (II) ions at physiological concentrations of Zn (II) ions of 100-400 μM. Higher concentrations of Zn(II) ions, on the order of 1 mmol (mM), suppress interactions between the HAEE and the 1-16 region of Aβ. Incubation of Aβ aggregates with HAEE for at least 1 hour at 20, 40, 80, 100 and 150 μM HAEE has been shown to disaggregate such aggregates.
Из патента РФ № 2679059 известно, что несмотря на ингибирование образования амилоидных бляшек, влияние известных препаратов, в частности НАЕЕ, на улучшение когнитивных функций при болезни Альцгеймера в среднем является очень ограниченным и существует необходимость получения альтернативных эффективных средств для лечения болезни Альцгеймера, в том числе за счет снижения или предотвращения связывания ионов Zn(II) с пептидом Аβ. В качестве альтернативного средства для лечения болезни Альцгеймера было предложено использовать пептид с аминокислотной последовательностью (в стандартных однобуквенных кодах) H[isoD][pS]GYEVHH (где isoD обозначает изомеризованный остаток аспарагиновой кислоты, а pS относится к фосфорилированному остатку серина) с открытыми или защищенными концами основной полипептидной цепи. From RF patent No. 2679059 it is known that despite the inhibition of the formation of amyloid plaques, the effect of known drugs, in particular HAEE, on improving cognitive functions in Alzheimer's disease is on average very limited and there is a need to obtain alternative effective drugs for the treatment of Alzheimer's disease, including by reducing or preventing the binding of Zn(II) ions to the Aβ peptide. As an alternative treatment for Alzheimer's disease, it has been proposed to use a peptide with the amino acid sequence (in standard single-letter codes) H[isoD][pS]GYEVHH (where isoD denotes an isomerized aspartic acid residue and pS refers to a phosphorylated serine residue) with open or protected ends of the main polypeptide chain.
Из патента РФ № 2709539 известно, что короткие заряженные пептиды типа HAEE имеют очень короткое время жизни в плазме крови (от нескольких секунд до нескольких минут) и с трудом проходят через гематоэнцефалический барьер (ГЭБ), что существенно ослабляет эффективность их терапевтического воздействия. С целью преодоления этих недостатков авторы патента РФ № 2709539 разработали фармацевтическую композицию для доставки HAEE через ГЭБ для лечения нейродегенеративных заболеваний, включая деменцию Альцгеймеровского типа (болезнь Альцгеймера), которая позволяет улучшить фармакокинетические характеристики и увеличить биодоступность HAEE. It is known from RF patent No. 2709539 that short charged peptides of the HAEE type have a very short lifetime in blood plasma (from several seconds to several minutes) and hardly pass through the blood-brain barrier (BBB), which significantly reduces the effectiveness of their therapeutic effect. In order to overcome these shortcomings, the authors of RF patent No. 2709539 have developed a pharmaceutical composition for the delivery of HAEE through the BBB for the treatment of neurodegenerative diseases, including dementia of the Alzheimer's type (Alzheimer's disease), which improves the pharmacokinetic characteristics and increases the bioavailability of HAEE.
Данная композиция содержит эффективное количество субстанции в виде комплекса HAЕЕ с цинком и человеческим сывороточным альбумином (HAEE-Zn-HSA) в форме раствора для введения с фармацевтически приемлемым носителем, выбранным из круга нейтральных носителей и разбавителей, например, в физиологическом растворе. Полученная фармацевтическая композиция позволяет увеличить в пять раз биодоступность субстанции в мозге, увеличить время полувыведения из организма в два раза; улучшить когнитивные функции экспериментальных животных на 20%.This composition contains an effective amount of the substance in the form of a complex of HAEE with zinc and human serum albumin (HAEE-Zn-HSA) in the form of a solution for administration with a pharmaceutically acceptable carrier selected from the range of neutral carriers and diluents, for example, in saline. The resulting pharmaceutical composition makes it possible to increase the bioavailability of the substance in the brain by five times, to increase the half-life from the body by two times; improve the cognitive functions of experimental animals by 20%.
Изобретение по патенту РФ № 2709539 было выбрано в качестве ближайшего аналога, поскольку только оно представляет собой единственный известный для НАЕЕ комплекс. Из патента РФ № 2709539 известно, что с человеческим альбумином (HSA) пептид HAEE в присутствии ионов цинка образует специфический тройной комплекс (HAEE-Zn-HSA). При этом в отсутствии ионов цинка взаимодействий между HAEE и HSA не наблюдалось. Данный комплекс характеризуется тем, что с помощью иона цинка удалось получить межмолекулярное связывание между молекулами НАЕЕ и НSA. Катион цинка является координирующим катионом между этими двумя молекулами. В твердом виде данный комплекс получен не был.The invention according to the patent of the Russian Federation No. 2709539 was chosen as the closest analogue, since only it is the only complex known for HAEE. It is known from RF patent No. 2709539 that the HAEE peptide forms a specific ternary complex (HAEE-Zn-HSA) with human albumin (HSA) in the presence of zinc ions. At the same time, no interactions between HAEE and HSA were observed in the absence of zinc ions. This complex is characterized by the fact that with the help of a zinc ion it was possible to obtain intermolecular bonding between the HAE and HSA molecules. The zinc cation is the coordinating cation between these two molecules. This complex was not obtained in solid form.
Из патента РФ № 2709539 известно, что фармацевтическая композиция HAEE-Zn-HSA является стабильной в подходящей водной буферной системе, в диапазоне значений pH от 4 до 8, в присутствии или в отсутствии различных солей.From RF patent No. 2709539 it is known that the pharmaceutical composition HAEE-Zn-HSA is stable in a suitable aqueous buffer system, in the pH range from 4 to 8, in the presence or absence of various salts.
Известно, что заряд альбумина в нейтральной среде равен -1, в щелочной среде равен -2, а в слабокислой среде равен 0 (изоэлектрическое состояние) и альбумин выпадает в осадок (Биохимия с упражнениями и задачами. Под ред. А.И. Глухова, Е.С. Северина. ГЭОТАР-Медиа, Москва. 2019. С.19), поэтому данный комплекс не должен существовать в слабокислой среде при pH 4-5,5.It is known that the charge of albumin in a neutral medium is -1, in an alkaline medium it is -2, and in a slightly acidic medium it is 0 (isoelectric state) and albumin precipitates (Biochemistry with exercises and tasks. Edited by A.I. Glukhov, E.S. Severina, GEOTAR-Media, Moscow, 2019, p.19), so this complex should not exist in a slightly acidic environment at pH 4-5.5.
Из патента РФ № 2709539 известно, что для приготовления фармацевтической композиции HAEE-Zn-HSA, пригодной для проведения доклинических исследований, 5 мг HAEE, 600 мг человеческого альбумина и 0,5 мг хлорида цинка (ZnCl2) растворяли в 20 миллилитрах физиологического раствора. В качестве источника НАЕЕ использовался лиофилизированный препарат синтетического пептида HAEE (чистота более 98%). При известной молекулярной массе HAEE равной 525,52 г/моль соотношение компонентов в комплексе HAEE-Zn-HSA составляет примерно HAEE : Zn : HSA ~ 1 : 2,6 : 1 по молям.From RF patent No. 2709539 it is known that for the preparation of a pharmaceutical composition HAEE-Zn-HSA suitable for preclinical studies, 5 mg of HAEE, 600 mg of human albumin and 0.5 mg of zinc chloride (ZnCl 2 ) were dissolved in 20 milliliters of saline. A lyophilized preparation of the synthetic HAEE peptide (more than 98% pure) was used as a source of HAEE. With a known molecular weight of HAEE equal to 525.52 g/mol, the ratio of components in the HAEE-Zn-HSA complex is approximately HAEE : Zn : HSA ~ 1 : 2.6 : 1 by moles.
Недостатком данного изобретения является высокое содержание человеческого альбумина, которое превышает в 120 раз по массе содержание активного вещества НАЕЕ, а также высокое содержание цинка, которое в 2,6 раза превышает по массе содержание активного вещества НАЕЕ и может привести к образованию комплекса с нестехиометрическим соотношением входящих в него компонентов. Цинк является значительно более токсичным элементом, по сравнению с другими микроэлементами, например с магнием, который принимает участие в энергетическом и электролитном обмене, выступает в качестве регулятора клеточного роста, необходим на всех этапах синтеза белковых молекул.The disadvantage of this invention is the high content of human albumin, which exceeds the content of the active substance HAEE by 120 times, as well as the high content of zinc, which is 2.6 times higher by weight than the content of the active substance HAEE and can lead to the formation of a complex with a non-stoichiometric ratio of incoming components in it. Zinc is a much more toxic element compared to other trace elements, such as magnesium, which takes part in energy and electrolyte metabolism, acts as a cell growth regulator, and is necessary at all stages of the synthesis of protein molecules.
Высокие концентрации человеческого альбумина могут оказывать различные негативные эффекты на организм как экспериментальных животных, так и человека (Gales B.J., Erstad B.L. (1993). Adverse reactions to human serum albumin. Annals of Pharmacotherapy, 27(1), 87-94, doi: 10.1177/106002809302700119; Kremer H., Baron-Menguy C., Tesse A. et al. (2011). Human serum albumin improves endothelial dysfunction and survival during experimental endotoxemia: concentration-dependent properties. Critical care medicine, 39(6), 1414-1422, doi: 10.1097/CCM.0b013e318211ff6e). Некоторые образцы HSA, в отличие от бычьего сывороточного альбумина (BSA), при культивировании мышиных эмбрионов не доводили их до стадии бластоцисты (Léveillé M.C., Carnegie J., Tanphaichitr N. (1992). Effects of human sera and human serum albumin on mouse embryo culture. Journal of assisted reproduction and genetics, 9(1), 45-52, doi: 10.1007/BF01204114). HSA может вызывать иммунный ответ у мышей после его введения (Favoretto B.C., Ricardi R., Silva, S.R. et al. (2011). Immunomodulatory effects of crotoxin isolated from Crotalus durissus terrificus venom in mice immunised with human serum albumin. Toxicon, 57(4), 600-607, doi: 10.1016/j.toxicon.2010.12.023). High concentrations of human albumin can have various negative effects on the body of both experimental animals and humans (Gales B.J., Erstad B.L. (1993). Adverse reactions to human serum albumin. Annals of Pharmacotherapy, 27(1), 87-94, doi: 10.1177/106002809302700119 Kremer H, Baron-Menguy C, Tesse A et al (2011) Human serum albumin improves endothelial dysfunction and survival during experimental endotoxemia: concentration-dependent properties Critical care medicine, 39(6), 1414-1422, doi: 10.1097/CCM.0b013e318211ff6e). Some HSA samples, in contrast to bovine serum albumin (BSA), when cultured mouse embryos did not bring them to the blastocyst stage (Léveillé M.C., Carnegie J., Tanphaichitr N. (1992). Effects of human sera and human serum albumin on mouse embryo culture Journal of assisted reproduction and genetics, 9(1), 45-52, doi: 10.1007/BF01204114). HSA can induce an immune response in mice after administration (Favoretto B.C., Ricardi R., Silva, S.R. et al. (2011). Immunomodulatory effects of crotoxin isolated from Crotalus durissus terrificus venom in mice immunized with human serum albumin. Toxicon, 57( 4), 600-607, doi: 10.1016/j.toxicon.2010.12.023).
Известно, что HSA может быть использован для улучшения когнитивных функций при лечении болезни Альцгеймера, однако только при интрацеребровентрикулярном (внутричерепном) введении. Введение HSA в плазму крови может снижать его эффективность (Ezra, A., Rabinovich-Nikitin, I., Rabinovich-Toidman, P., & Solomon, B. (2016). Multifunctional effect of human serum albumin reduces Alzheimer’s disease related pathologies in the 3xTg mouse model. Journal of Alzheimer's Disease, 50(1), 175-188, doi: 10.3233/JAD-150694).It is known that HSA can be used to improve cognitive functions in the treatment of Alzheimer's disease, but only when administered intracerebroventricularly (intracranially). The introduction of HSA into blood plasma can reduce its effectiveness (Ezra, A., Rabinovich-Nikitin, I., Rabinovich-Toidman, P., & Solomon, B. (2016). Multifunctional effect of human serum albumin reduces Alzheimer's disease related pathologies in the 3xTg mouse model, Journal of Alzheimer's Disease, 50(1), 175-188, doi: 10.3233/JAD-150694).
Поэтому уменьшение количества человеческого альбумина или возможность полностью отказаться от него в лекарственном препарате, замена сложного и травмоопасного интрацеребровентрикулярного введения на внутривенное, при одновременном усилении терапевтического эффекта является важной медицинской задачей при лечении нейродегенеративных заболеваний.Therefore, reducing the amount of human albumin or the ability to completely abandon it in the drug, replacing the complex and traumatic intracerebroventricular administration with intravenous administration, while simultaneously enhancing the therapeutic effect, is an important medical problem in the treatment of neurodegenerative diseases.
Ранее НАЕЕ и комплекс HAEE-Zn-HSA не характеризовались в твердой фазе и их свойства в твердой фазе неизвестны.Previously, HAEE and the HAEE-Zn-HSA complex have not been characterized in the solid phase and their properties in the solid phase are unknown.
Таким образом, задачи, на решение которых направлено изобретение, заключаются в получении эффективного средства для лечения нейродегенеративных заболеваний в виде неизвестного ранее магниевого комплекса пептида НАЕЕ, в том числе в твердой форме, разработке фармацевтических композиций на его основе и его применении для лечения нейродегенеративных заболеваний.Thus, the tasks to be solved by the invention are to obtain an effective agent for the treatment of neurodegenerative diseases in the form of a previously unknown magnesium complex of the HAEE peptide, including in solid form, the development of pharmaceutical compositions based on it and its use for the treatment of neurodegenerative diseases.
В соответствии с настоящим изобретением раскрывается магниевый комплекс пептида HAEE, который описывается формулой [Mg(НАЕЕ)]mXn, где Mg представляет собой двухзарядный катион магния (II), m = 1 для однозарядных и двухзарядных анионов, m = 2 для трехзарядных анионов, HAEE представляет собой синтетический пептид, ацетилированный по N-концу и амидированный по C-концу, с аминокислотной последовательностью His-Ala-Glu-Glu, Х – фармацевтически приемлемый анион, n = 1 для двухзарядных анионов, n = 2 для однозарядных и трехзарядных анионов.In accordance with the present invention, a magnesium complex of the HAEE peptide is disclosed, which is described by the formula [Mg(HAEE)] m X n , where Mg is a doubly charged magnesium (II) cation, m = 1 for singly and doubly charged anions, m = 2 for triply charged anions , HAEE is a synthetic peptide acetylated at the N-terminus and amidated at the C-terminus, with the amino acid sequence His-Ala-Glu-Glu, X is a pharmaceutically acceptable anion, n = 1 for doubly charged anions, n = 2 for singly and triply charged anions anions.
В описываемом комплексе мольное содержание катиона магния (II) и пептида HAEE является эквимолярным (1:1). Таким образом, если X является однозарядным анионом, то заявляемый магниевый комплекс пептида HAEE описывается формулой [Mg(HAEE)]X2. Если X является двухзарядным анионом, то заявляемый магниевый комплекс пептида HAEE описывается формулой [Mg(HAEE)]X. Если X является трёхзарядным анионом, то заявляемый магниевый комплекс пептида HAEE описывается формулой [Mg(HAEE)]3X2.In the described complex, the molar content of the magnesium (II) cation and the HAEE peptide is equimolar (1:1). Thus, if X is a singly charged anion, then the claimed magnesium complex of the HAEE peptide is described by the formula [Mg(HAEE)]X 2 . If X is a doubly charged anion, then the claimed magnesium complex of the HAEE peptide is described by the formula [Mg(HAEE)]X. If X is a three-charged anion, then the claimed magnesium complex of the HAEE peptide is described by the formula [Mg(HAEE)] 3 X 2 .
Взаимодействие пептида HAEE с ионом магния наблюдалось и при других молярных соотношениях HAEE : Mg, а именно, в диапазоне от 1:0,1 до 1:10, что связано с наличием множества донорно-акцепторных центров (азот, кислород) в молекуле НАЕЕ и взаимодействие между НАЕЕ и Mg может быть нестехиометрическим. Использование более высокого содержания магния (>1:10) приводили к получению в твердой форме смеси из магниевого комплекса пептида HAEE и соответствующей соли магния, при использование малого количества магния (<1:0,1) его взаимодействие с пептидом HAEE не фиксировали физико-химическими методами.HAEE peptide interaction with magnesium ion was also observed at other molar ratios of HAEE : Mg, namely, in the range from 1:0.1 to 1:10, which is associated with the presence of many donor-acceptor centers (nitrogen, oxygen) in the HAEE molecule and the interaction between HAEE and Mg can be non-stoichiometric. The use of a higher magnesium content (>1:10) resulted in a mixture in solid form of the magnesium complex of the HAEE peptide and the corresponding magnesium salt, with the use of a small amount of magnesium (<1:0.1), its interaction with the HAEE peptide was not fixed physico- chemical methods.
В настоящем изобретении было обнаружено, что для усиления терапевтического действия пептида НАЕЕ для лечения нейроденегеративных заболеваний, в частности опосредованно вызываемых воспалительными причинами, нет необходимости использования цинка и человеческого альбумина. Для улучшения когнитивных функций, нарушенных вследствие нейродегенеративных заболеваний, достаточным является использование только пептида НАЕЕ и магния в одном комплексе без необходимости использования высоких количеств человеческого альбумина. Также, если использование HAEE-Zn-HSA улучшает фармакокинетические параметры пептида НАЕЕ, то в настоящем изобретении использование магниевого комплекса пептида НАЕЕ для лечения нейродегенеративных заболеваний изменяет механизм действия пептида НАЕЕ, связанный с конформационной структурой пептида HAEE, что приводит к неожиданно высокому терапевтическому эффекту.In the present invention, it has been found that it is not necessary to use zinc and human albumin to enhance the therapeutic effect of the HAEE peptide for the treatment of neurodegenerative diseases, in particular those mediated by inflammatory causes. To improve cognitive functions impaired due to neurodegenerative diseases, it is sufficient to use only the HAEE peptide and magnesium in one complex without the need to use high amounts of human albumin. Also, if the use of HAEE-Zn-HSA improves the pharmacokinetic parameters of the HAEE peptide, then in the present invention, the use of the magnesium complex of the HAEE peptide for the treatment of neurodegenerative diseases changes the mechanism of action of the HAEE peptide associated with the conformational structure of the HAEE peptide, which leads to an unexpectedly high therapeutic effect.
Это подтверждается экспериментальным введением нативного пептида НАЕЕ и полученного по данному изобретению магниевого комплекса пептида HAEE в организм экспериментальных животных. Было обнаружено, что 3D-структура нативного пептида НАЕЕ, который в виде водного раствора был помещён на 2 минуты в плазму крови мышей дикого типа, отличается от 3D-структуры нативного HAEE в исходном водном растворе, что подтверждается методом ВЭЖХ по изменению времени выходa с хроматографической колонки пробы HAEE, экстрагированной из плазмы крови, относительно времени выхода пробы HAEE, экстрагированной из исходного водного раствора. В то же время 3D-структура магниевого комплекса пептида HAEE оставалась неизменной в аналогичных экспериментальных условиях (то есть после экстрагирования из исходного водного раствора магниевого комплекса пептида HAEE и после экстрагирования данного комплекса из плазмы крови мышей дикого типа после 2-х минутной экспозиции) и соответствовала 3D-структуре нативного пептида HAEE, экстрагированного из исходного водного раствора. По данным масс-спектрометрии химическая структура пептида HAEE во всех экспериментальных пробах сохранялась неизменной как для нативного пептида, так и для пептида в составе магниевого комплекса. Изменение времени выхода нативного пептида HAEE или магниевого комплекса пептида HAEE с хроматографической колонки связано в основном с различиями в гидрофобных взаимодействиях пептида HAEE с материалом колонки, а эти взаимодействия в свою очередь определяются превалирующей 3D-структурой пептида HAEE в конкретной пробе. Таким образом, из полученных экспериментальных данных следует, что 3D-структура пептида HAEE, которая соответствует «развёрнутой» конформации пептида и является превалирующей для нативного пептида HAEE в исходном водном растворе, соответствует 3D-структуре магниевого комплекса пептида HAEE в водном растворе и остаётся неизменной в случае экспозиции магниевого комплекса пептида HAEE в плазме крови, в то время как нативный пептид HAEE в плазме крови утрачивает «развёрнутую» конформацию.This is confirmed by the experimental introduction of the native HAEE peptide and the magnesium complex of the HAEE peptide obtained according to this invention into the body of experimental animals. It was found that the 3D structure of the native HAEE peptide, which was placed in the blood plasma of wild-type mice in the form of an aqueous solution for 2 minutes, differs from the 3D structure of the native HAEE in the initial aqueous solution, which was confirmed by the HPLC method by changing the release time from chromatographic columns of the HAEE sample extracted from blood plasma relative to the release time of the HAEE sample extracted from the initial aqueous solution. At the same time, the 3D structure of the magnesium complex of the HAEE peptide remained unchanged under similar experimental conditions (i.e., after extraction from the initial aqueous solution of the magnesium complex of the HAEE peptide and after extraction of this complex from the blood plasma of wild-type mice after a 2-minute exposure) and corresponded to 3D structure of the native HAEE peptide extracted from the initial aqueous solution. According to mass spectrometry, the chemical structure of the HAEE peptide in all experimental samples remained unchanged for both the native peptide and the peptide in the magnesium complex. The change in the release time of the native HAEE peptide or the magnesium complex of the HAEE peptide from the chromatographic column is mainly due to differences in the hydrophobic interactions of the HAEE peptide with the column material, and these interactions, in turn, are determined by the prevailing 3D structure of the HAEE peptide in a particular sample. Thus, it follows from the obtained experimental data that the 3D structure of the HAEE peptide, which corresponds to the “unfolded” conformation of the peptide and is predominant for the native HAEE peptide in the initial aqueous solution, corresponds to the 3D structure of the magnesium complex of the HAEE peptide in the aqueous solution and remains unchanged in in the case of exposure of the magnesium complex of the HAEE peptide in blood plasma, while the native HAEE peptide in blood plasma loses its “unfolded” conformation.
В данном случае термин 3D-структура используется как синоним пространственной структуры или взаимного расположения атомов в молекуле HAEE в трехмерном пространстве. Метод ВЭЖХ основан на преимущественно межмолекулярных взаимодействиях на границе раздела фаз. Изменение времени выхода НАЕЕ с хроматографической колонки отражает изменение межмолекулярных взаимодействий HAEE с сорбентом, что является следствием различий пространственной структуры молекул НАЕЕ в нативном состоянии и в виде магниевого комплекса.In this case, the term 3D structure is used as a synonym for the spatial structure or arrangement of atoms in the HAEE molecule in three dimensions. The HPLC method is based primarily on intermolecular interactions at the interface. The change in the release time of HAEE from the chromatographic column reflects the change in the intermolecular interactions of HAEE with the sorbent, which is a consequence of differences in the spatial structure of HAEE molecules in the native state and in the form of a magnesium complex.
Известно, что нарушение 3D-структуры олигопептидов может приводить к снижению их функций и уменьшению терапевтического действия (Sikora, K., Jaśkiewicz, M., Neubauer, D., Migoń, D., & Kamysz, W. (2020). The role of counter-ions in peptides—an overview. Pharmaceuticals, 13(12), 442.). Ранее было показано, что для оптимального взаимодействия с партнёрами белковой природы пептид HAEE должен находиться в «развёрнутой» конформации (Barykin E. P., Garifulina A. I., Tolstova A. P., Anashkina A. A., Adzhubei A. A., Mezentsev Y. V., Shelukhina I. V., Kozin S. A., Tsetlin V. I., Makarov A. A. Tetrapeptide Ac-HAEE-NH(2) Protects α4β2 nAChR from Inhibition by Aβ // International journal of molecular sciences. ‒ 2020. ‒ T. 21, № 17. ‒ C. 6272; Zolotarev YA, Mitkevich VA, Shram SI, Adzhubei AA, Tolstova AP, Talibov OB, Dadayan AK, Myasoyedov NF, Makarov AA, Kozin SA. Pharmacokinetics and Molecular Modeling Indicate nAChRα4-Derived Peptide HAEE Goes through the Blood-Brain Barrier. Biomolecules. 2021 Jun 18;11(6):909). В нативном пептиде HAEE имидазольная группа аминокислотного остатка гистидина может образовывать стабильные полярные связи с карбоксильными группами боковых цепей аминокислотных остатков глутаминовой кислоты, что не способствует поддержанию биологически значимой «развёрнутой» конформации данного пептида и, как следствие, снижает полезные терапевтические эффекты HAEE.It is known that a violation of the 3D structure of oligopeptides can lead to a decrease in their functions and a decrease in the therapeutic effect (Sikora, K., Jaśkiewicz, M., Neubauer, D., Migoń, D., & Kamysz, W. (2020). The role of counter-ions in peptides—an overview, Pharmaceuticals, 13(12), 442). Previously, it was shown that for optimal interaction with protein partners, the HAEE peptide should be in an “unfolded” conformation (Barykin E. P., Garifulina A. I., Tolstova A. P., Anashkina A. A., Adzhubei A. A., Mezentsev Y. V., Shelukhina I. V., Kozin S. A., Tsetlin V. I., Makarov A. A. Tetrapeptide Ac-HAEE-NH(2) Protects α4β2 nAChR from Inhibition by Aβ // International journal of molecular sciences, 2020, vol. Adzhubei AA, Tolstova AP, Talibov OB, Dadayan AK, Myasoyedov NF, Makarov AA, Kozin SA Pharmacokinetics and Molecular Modeling Indicate nAChRα4-Derived Peptide HAEE Goes through the Blood-Brain Barrier Biomolecules 2021
Таким образом, одним из преимуществ данного изобретения является повышение терапевтической эффективности магниевого комплекса пептида НАЕЕ вследствие сохранения 3D-структуры данного комплекса в «развернутой» конформации. Thus, one of the advantages of this invention is to increase the therapeutic efficacy of the magnesium complex of the HAEE peptide due to the preservation of the 3D structure of this complex in an "unfolded" conformation.
Также было обнаружено, что введение в плазму крови мышей комплекса НАЕЕ-Zn-HSA, полученного по описанному в патенте РФ № 2709539 способу, приводит к их стрессу, изменению внешнего вида и даже гибели, что может быть связано с высокой массовой концентрацией HSA в этом комплексе. Напротив, введение в плазму крови здоровых мышей магниевого комплекса пептида HAEE не приводило к каким-либо нарушениям в поведении и в физическом состоянии животных по сравнению с животными контрольной группы, которым вводился физиологический раствор, что указывает на отсутствие побочных эффектов магниевого комплекса пептида HAEE и является дополнительным преимуществом настоящего изобретения.It was also found that the introduction of the HAE-Zn-HSA complex into the blood plasma of mice, obtained according to the method described in RF patent No. complex. On the contrary, the introduction of the magnesium complex of the HAEE peptide into the blood plasma of healthy mice did not lead to any disturbances in the behavior and physical condition of the animals compared to the animals of the control group, which were injected with saline, which indicates the absence of side effects of the magnesium complex of the HAEE peptide and is an additional advantage of the present invention.
Таким образом, отличием настоящего изобретения от ближайшего аналога, патента РФ № 2709539, состоит в том, что заявляемый магниевый комплекс не содержит HSA и цинка, который имеет сниженную молярную концентрацию ионов по сравнению с комплексом HAEE-Zn-HSA с 2,6, как описано в примере патента РФ № 2709539, до 1 (эквимолярное количество), как описано в настоящем изобретении.Thus, the difference between the present invention and its closest analogue, RF patent No. 2709539, is that the claimed magnesium complex does not contain HSA and zinc, which has a reduced molar concentration of ions compared to the HAEE-Zn-HSA complex with 2.6, as described in the example of RF patent No. 2709539, up to 1 (equimolar amount), as described in the present invention.
Изобретение также имеет отношение к применению магниевого комплекса для лечения нейродегенеративных заболеваний, а также патологий, сопровождающихся нейровоспалительными процессами. Заявляемый магниевый комплекс может эффективно влиять на нейродегенеративные заболевания, в частности, вызванные воспалительными причинами, восстанавливая нарушенные когнитивные функции.The invention also relates to the use of the magnesium complex for the treatment of neurodegenerative diseases, as well as pathologies accompanied by neuroinflammatory processes. The claimed magnesium complex can effectively affect neurodegenerative diseases, in particular those caused by inflammatory causes, restoring impaired cognitive functions.
Магниевый комплекс может быть использован как в твердой, так и в жидкой форме, сохраняя свою стабильность в течение по меньшей мере 2 лет.The magnesium complex can be used in both solid and liquid form, maintaining its stability for at least 2 years.
Техническим результатом изобретения является:The technical result of the invention is:
- возможность использования заявляемого магниевого комплекса при лечении нейродегенеративных заболеваний, в частности вызванных опосредованно воспалительными причинами, которое приводит к эффективному восстановлению когнитивных функций;- the possibility of using the proposed magnesium complex in the treatment of neurodegenerative diseases, in particular those caused indirectly by inflammatory causes, which leads to an effective restoration of cognitive functions;
- повышенная стабильность заявляемого магниевого комплекса по сравнению с НАЕЕ;- increased stability of the proposed magnesium complex in comparison with HAEE;
- устойчивость «развернутой» конформации 3D-структуры заявляемого магниевого комплекса в плазме крови по сравнению с НАЕЕ;- the stability of the "unfolded" conformation of the 3D structure of the inventive magnesium complex in blood plasma compared with HAEE;
- отсутствие побочных эффектов у заявляемого магниевого комплекса по сравнению с НАЕЕ-Zn-HSA.- the absence of side effects in the proposed magnesium complex in comparison with HAE-Zn-HSA.
Заявляемый в настоящем изобретении магниевый комплекс в соответствии с используемым способом получения может быть получен в аморфной форме, что подтверждается рентгенофазовым анализом (Фиг. 1).The magnesium complex claimed in the present invention, in accordance with the production method used, can be obtained in amorphous form, which is confirmed by X-ray phase analysis (Fig. 1).
Сравнение данных рентгенофазового анализа комплекса НАЕЕ-Zn-HSA нецелесообразно, поскольку при соотношении масс HSA:HAEE ~ 120 на дифрактограмме будет представлен только HSA, а вещество НАЕЕ будет представлено в виде минорной примеси, не проявляющейся на дифрактограмме.Comparison of X-ray phase analysis data for the HAEE-Zn-HSA complex is inappropriate, since at a mass ratio of HSA:HAEE ~ 120, only HSA will be present in the diffraction pattern, and the HAEE substance will be represented as a minor impurity that does not appear in the diffraction pattern.
Магниевый комплекс характеризуется кривой дифференциальной сканирующей калориметрии (ДСК) с термогравиометрией (ТГ) (ДСК-ТГА). Молекула НАЕЕ на ДСК-кривой характеризуется: широким пиком с началом при 62 °С и максимумом при 89 °С; двойным пиком плавления при температуре 203 и 227,5 °С с началом при 188 °С (Фиг. 2). Погрешность при многократном измерении оценивается в ± 3 °С. Заявляемый магниевый комплекс на ДСК-кривой характеризуется двумя максимумами: первый широкий эндотермический максимум начинается от 62 °С и имеет максимум при 120 °С; второй эндотермический максимум имеет температуру плавления при 267 °С (Фиг. 3).The magnesium complex is characterized by a differential scanning calorimetry (DSC) with thermograviometry (TG) (DSC-TGA) curve. The HAEE molecule on the DSC curve is characterized by: a broad peak with an onset at 62°C and a maximum at 89°C; a double melting peak at 203 and 227.5°C with an onset at 188°C (Fig. 2). The error in multiple measurements is estimated at ± 3 °C. The claimed magnesium complex on the DSC curve is characterized by two maxima: the first wide endothermic maximum starts from 62 °C and has a maximum at 120 °C; the second endothermic maximum has a melting point at 267°C (Fig. 3).
ДСК-кривые показывают, что термическое поведение магниевого комплекса (Фиг. 3) отличается от поведения НАЕЕ (Фиг. 2), температура плавления комплекса выше по сравнению с температурой плавления НАЕЕ, что обеспечивает более высокую стабильность комплекса, что подтверждается результатами теста ускоренного хранения.The DSC curves show that the thermal behavior of the magnesium complex (Fig. 3) differs from that of the HAEE (Fig. 2), the melting point of the complex is higher compared to the melting point of the HAEE, which provides a higher stability of the complex, which is confirmed by the results of the accelerated storage test.
Сравнение данных ДСК-анализа комплекса НАЕЕ-Zn-HSA нецелесообразно, поскольку при соотношении масс HSA:HAEE > 120 на ДСК-кривой будет представлен только HSA, а вещество НАЕЕ представлено в виде минорной примеси, не проявляющейся на ДСК-кривой.Comparison of the DSC analysis data for the HAEE-Zn-HSA complex is inappropriate, since at a mass ratio HSA:HAEE > 120, only HSA will be present on the DSC curve, and the HAEE substance is represented as a minor impurity that does not appear on the DSC curve.
ИК-спектр с Фурье преобразованием заявляемого магниевого комплекса представлен на Фиг. 4. ИК-спектр комплекса повторяет все основные линии ИК-спектра НАЕЕ. Отличие ИК-спектра комплекса от исходного HAAE заключается в смещении максимума при 1395 в область 1410 см-1 (CH3 деф.). Таким образом после образования комплекса в ИК-спектре произошли небольшие изменения колебаний связи в молекуле НАЕЕ, указывающие на слабые взаимодействие с ионом магния.The Fourier transform IR spectrum of the inventive magnesium complex is shown in Fig. 4. The IR spectrum of the complex repeats all the main lines of the HAEE IR spectrum. The difference between the IR spectrum of the complex and the initial HAAE is the shift of the maximum at 1395 to the region of 1410 cm -1 (CH 3 def.). Thus, after the formation of the complex in the IR spectrum, there were slight changes in the vibrations of the bond in the HAEE molecule, indicating a weak interaction with the magnesium ion.
Сравнение ИК-спектра комплекса НАЕЕ-Zn-HSA нецелесообразно, поскольку при соотношении масс HSA:HAEE > 120 на ИК-спектре будет представлен только HSA, а вещество НАЕЕ представлено в виде минорной примеси, не проявляющейся на ИК-спектре.Comparison of the IR spectrum of the HAEE-Zn-HSA complex is inappropriate, since at a mass ratio of HSA:HAEE > 120, only HSA will be present in the IR spectrum, and the HAEE substance is represented as a minor impurity that does not appear in the IR spectrum.
Заявляемый магниевый комплекс может быть получен в виде лиофилизата методом стандартной сублимационной (лиофильной) сушки.The inventive magnesium complex can be obtained in the form of a lyophilisate by standard freeze-drying (freeze-drying).
Получение магниевого комплекса заключается в смешивании водных растворов HAEE и водорастворимой соли магния в эквимолярных соотношениях при комнатной температуре, перемешивании в течение 10-60 мин, замораживании раствора и лиофильном высушивании. Obtaining a magnesium complex consists in mixing aqueous solutions of HAEE and a water-soluble magnesium salt in equimolar ratios at room temperature, stirring for 10-60 min, freezing the solution and freeze-drying.
Водорастворимые магниевые соли (до нескольких % масс.) представляют собой нитрат, ацетат, хлорид, сульфат, салицилат, лактат, глюконат, цитрат, глицинат и другие фармацевтически приемлемые соли с растворимостью около 1% масс. и более. Анионы могут быть одно-, дву- или трехзарядными. Наличие анионов разной природы в составе комплекса в жидкой или в твердой фазе не влияет на терапевтическую эффективность магниевого комплекса. Предполагается, что только внутренняя сфера магниевого комплекса проявляет терапевтическую эффективность независимо от природы аниона.Water-soluble magnesium salts (up to several wt.%) are nitrate, acetate, chloride, sulfate, salicylate, lactate, gluconate, citrate, glycinate and other pharmaceutically acceptable salts with a solubility of about 1% wt. and more. Anions can be single, double or triple charged. The presence of anions of different nature in the composition of the complex in the liquid or solid phase does not affect the therapeutic efficacy of the magnesium complex. It is assumed that only the inner sphere of the magnesium complex exhibits therapeutic efficacy, regardless of the nature of the anion.
Также анионы для магниевого комплекса выбираются из группы, трифторацетата, пирувата, галактуроната, бромида, глутарата, сукцината, малеата, фумарата, бензолсульфоната, тозилата и других фармацевтически приемлемых анионов.Also, the anions for the magnesium complex are selected from the group of trifluoroacetate, pyruvate, galacturonate, bromide, glutarate, succinate, maleate, fumarate, benzenesulfonate, tosylate, and other pharmaceutically acceptable anions.
Использование каждого из вышеперечисленных анионов для получения магниевого комплекса в твердой фазе методом сублимационной сушки показало, что в таком комплексе может частично оставаться гидратированная или связанная вода, однако, данный комплекс не набирает дополнительную воду при хранении и стабилен в течение длительного времени.The use of each of the above anions to obtain a magnesium complex in the solid phase by freeze-drying showed that hydrated or bound water can partially remain in such a complex, however, this complex does not gain additional water during storage and is stable for a long time.
Еще одним объектом изобретения является фармацевтические композиции с эффективным количеством магниевого комплекса и наличием вспомогательных веществ. В качестве лекарственного средства магниевый комплекс может быть использован без вспомогательных веществ в виде лиофилизированной субстанции.Another object of the invention is pharmaceutical compositions with an effective amount of magnesium complex and the presence of excipients. As a drug, the magnesium complex can be used without auxiliary substances in the form of a lyophilized substance.
Эффективное количество магниевого комплекса зависит от типа нейродегенеративного заболевания, веса тела, способа введения, поэтому может варьироваться в широких пределах от 0,1 до 100 мг, более желательно от 5 до 50 мг. The effective amount of magnesium complex depends on the type of neurodegenerative disease, body weight, route of administration, and therefore may vary widely from 0.1 to 100 mg, more preferably from 5 to 50 mg.
Фармацевтическая композиция магниевого комплекса может быть в твердом виде или в виде водного раствора. Твердые композиции магниевого комплекса содержат его эффективное количество и необязательно вспомогательные вещества. Твердая фармацевтическая композиция может быть получена лиофилизацией магниевого комплекса и набором вспомогательных компонентов или добавлением вспомогательных веществ к лиофилизированному магниевому комплексу.The magnesium complex pharmaceutical composition may be in solid form or in the form of an aqueous solution. Solid compositions of magnesium complex contain its effective amount and optional excipients. The solid pharmaceutical composition can be obtained by lyophilization of the magnesium complex and a set of auxiliary components or by adding excipients to the lyophilized magnesium complex.
Лиофилизированной магниевый комплекс может быть в аморфной форме, которая соответствует дифрактограмме на Фиг. 1.The lyophilized magnesium complex may be in an amorphous form, which corresponds to the diffraction pattern in FIG. one.
Вспомогательные вещества выбираются из фармацевтически приемлемых добавок. Такими веществами могут быть маннитол, повидон К 17, трометамол, динатрия эдетат, натрия хлорид, сахароза, гистидин, полоксамер 407, и другие фармацевтически приемлемые добавки.Excipients are selected from pharmaceutically acceptable additives. Such substances may include mannitol,
Фармацевтическая композиция магниевого комплекса в виде водного раствора содержат эффективное количество магниевого комплекса, воду, а также набор фармацевтически приемлемых добавок и солей. Такими веществами могут быть маннитол, повидон К 17, трометамол, динатрия эдетат, натрия хлорид, сахароза, гистидин, полоксамер 407, и другие фармацевтически приемлемые добавки.The pharmaceutical composition of the magnesium complex in the form of an aqueous solution contains an effective amount of the magnesium complex, water, and a set of pharmaceutically acceptable additives and salts. Such substances may include mannitol,
Еще одним объектом изобретения является применение магниевого комплекса для лечения нейродегенеративных заболеваний, которое заключается во введении магниевого комплекса в составе описанных фармацевтических композиций пациенту в эффективном количестве. Эффективное количество магниевого комплекса зависит от типа нейродегенеративного заболевания, веса тела, способа введения, поэтому может варьироваться в широких пределах от 0,1 до 100 мг, предпочтительно от 5 до 50 мг.Another object of the invention is the use of the magnesium complex for the treatment of neurodegenerative diseases, which consists in administering the magnesium complex in the described pharmaceutical compositions to the patient in an effective amount. The effective amount of magnesium complex depends on the type of neurodegenerative disease, body weight, route of administration, and therefore may vary widely from 0.1 to 100 mg, preferably from 5 to 50 mg.
Введение магниевого комплекса пациенту может осуществляться с помощью всех возможных видов наружного, энтерального, ингаляционного и парентерального способов применения (включая внутривенное, внутриартериальное, внутрибрюшинное, подкожное, накожное, трансдермальное, внутримышечное, интратекальное, субарахноидальное, пероральное, интраназальное, сублингвальное, буккальное, ректальное введение). При введении магниевого комплекса в твердой форме предпочтительным способом введения является сублингвальный. При введении магниевого комплекса в форме раствора предпочтительными способами введения являются внутривенный и интраназальный.The introduction of the magnesium complex to the patient can be carried out using all possible types of external, enteral, inhalation and parenteral routes of administration (including intravenous, intraarterial, intraperitoneal, subcutaneous, cutaneous, transdermal, intramuscular, intrathecal, subarachnoid, oral, intranasal, sublingual, buccal, rectal administration ). When the magnesium complex is administered in solid form, the preferred route of administration is sublingual. When administering the magnesium complex in the form of a solution, the preferred routes of administration are intravenous and intranasal.
Возможность терапевтического лечения нейродегенеративных заболеваний была показана на примере болезни Альцгеймера, смоделированной на трансгенных мышах линии APPswe/PSEN1dE9 (APP/PS1) (Jankowsky, J. L., Slunt, H. H., Ratovitski, T., Jenkins, N. A., Copeland, N. G., & Borchelt, D. R. (2001). Co-expression of multiple transgenes in mouse CNS: a comparison of strategies. Biomolecular engineering, 17(6), 157-165, doi: 10.1016/S1389-0344(01)00067-3), которые проявляют характерные когнитивные признаки патологии. Данная модель может считаться моделью опосредованного воспалительного действия при нарушении когнитивных функций.The possibility of therapeutic treatment of neurodegenerative diseases has been demonstrated in Alzheimer's disease modeled on APPswe/PSEN1dE9 (APP/PS1) transgenic mice (Jankowsky, J. L., Slunt, H. H., Ratovitski, T., Jenkins, N. A., Copeland, N. G., & Borchelt, D. R. (2001) Co-expression of multiple transgenes in mouse CNS: a comparison of strategies Biomolecular engineering, 17(6), 157-165, doi: 10.1016/S1389-0344(01)00067-3), which exhibit characteristic cognitive signs of pathology. This model can be considered as a model of mediated inflammatory action in cognitive impairment.
В настоящем изобретении магниевый комплекс [Mg(НАЕЕ)]Cl2, вводили шестикратно внутривенно в дозе 0,05 мг/кг, после чего проводили валидный тест на когнитивные способности «Закапывание шариков» (англ. Marble Burying Test) [Santana-Santana M., Bayascas J.R., Giménez-Llort L. (2021). Sex-Dependent Signatures, Time Frames and Longitudinal Fine-Tuning of the Marble Burying Test in Normal and AD-Pathological Aging Mice. Biomedicines, 9(8), 994, doi: 10.3390/biomedicines9080994), определяя количество более чем на 2/3 закопанных шариков в процентах от общего количества шариков. Чем больше количество закопанных шариков (КЗШ), тем выше когнитивные способности у мышей.In the present invention, the magnesium complex [Mg(HAEE)]Cl 2 was administered six times intravenously at a dose of 0.05 mg/kg, followed by a valid Marble Burying Test [Santana-Santana M ., Bayascas JR, Gimenez-Llort L. (2021). Sex-Dependent Signatures, Time Frames and Longitudinal Fine-Tuning of the Marble Burying Test in Normal and AD-Pathological Aging Mice. Biomedicines, 9(8), 994, doi: 10.3390/biomedicines9080994), determining the number of more than 2/3 of the buried balls as a percentage of the total number of balls. The greater the number of buried balls (KZS), the higher the cognitive abilities in mice.
По результатам тестирования у контрольной группы мышей дикого типа, которым вводили физиологический раствор, значение КЗШ равнялось 50,6 ±13,3 %. Это значение принималось в качестве референсного. У контрольной группы трансгенных мышей линии APP/PS1, которым вводили физиологический раствор, значение КЗШ = 12,6 ±4,2 %, что указывает на сильное ухудшение поведенческих рефлексов трансгенных мышей линии APP/PS1 по сравнению с животными дикого типа и отражает инвалидизирующее влияние оверэкспрессии человеческого бета-амилоида, ассоциированное с нейровоспалением и образования амилоидных бляшек, на процессы нервной деятельности. Трансгенные мыши линии APP/PS1, инъецированные препаратами HAEE или магниевого комплекса, показали значения КЗШ = 20,6±7,3(%) или КЗШ = 42,7 ±9,8(%), соответственно. Эти данные свидетельствуют о том, что использование магниевого комплекса существенно улучшает поведенческие рефлексы трансгенных мышей APP/PS1, а эффект от этого использования значительно превышает таковой, наблюдаемый для HAEE.According to the results of testing in the control group of wild-type mice, which were injected with saline, the KZS value was 50.6 ± 13.3%. This value was taken as a reference. In the control group of transgenic mice of the APP/PS1 line, which were injected with saline, the value of KZS = 12.6 ± 4.2%, which indicates a strong deterioration in the behavioral reflexes of transgenic mice of the APP/PS1 line compared to wild-type animals and reflects the disabling effect overexpression of human beta-amyloid, associated with neuroinflammation and the formation of amyloid plaques, on the processes of nervous activity. Transgenic mice of the APP/PS1 line injected with HAEE or magnesium complex preparations showed values of KZS = 20.6 ± 7.3 (%) or KZS = 42.7 ± 9.8 (%), respectively. These data indicate that the use of the magnesium complex significantly improves the behavioral reflexes of APP/PS1 transgenic mice, and the effect of this use is significantly higher than that observed for HAEE.
Таким образом, заявляемый магниевый комплекс может эффективно применяться при лечении нейродегенеративных заболеваний, в частности вызванными воспалительными осложнениями, восстанавливая когнитивные функции до нормального состояния.Thus, the claimed magnesium complex can be effectively used in the treatment of neurodegenerative diseases, in particular those caused by inflammatory complications, restoring cognitive functions to a normal state.
Гистохимический анализ области гиппокампа головного мозга экспериментальных мышей показал, что число бляшек (ЧБ) на один срез мозга у контрольной группы диких мышей равно нулю, у контрольной группы трансгенных мышей APP/PS1 значение ЧБ оказалось равным 31,7 ± 4,9, в группе получавших НАЕЕ значение ЧБ составило 24,7 ± 3,4, в группе получавших магниевый комплекс значение ЧБ составило 8,1 ± 2,8. Histochemical analysis of the hippocampal region of the brain of experimental mice showed that the number of plaques (PN) per one brain slice in the control group of wild mice was equal to zero, in the control group of APP/PS1 transgenic mice, the value of PN was 31.7 ± 4.9, in the group in the group receiving HAEE, the BP value was 24.7 ± 3.4; in the group receiving the magnesium complex, the BP value was 8.1 ± 2.8.
Таким образом, результаты гистохимического анализа показали, что внутривенные инъекции магниевого комплекса приводили к почти 4-кратному уменьшению амилоидной нагрузки в гиппокампе трансгенных мышей APP/PS1, и по этому показателю эффективность магниевого комплекса примерно в три раза выше таковой, выявленной для HAEE. Для ближайшего аналога HAEE-Zn-BSA данный тест не проводился из-за гибели мышей в группе и нарушения их функционального состояния на ранних этапах исследования.Thus, the results of histochemical analysis showed that intravenous injections of the magnesium complex led to an almost 4-fold decrease in the amyloid load in the hippocampus of APP/PS1 transgenic mice, and in this indicator, the efficiency of the magnesium complex was about three times higher than that found for HAEE. For the closest analogue of HAEE-Zn-BSA, this test was not performed due to the death of mice in the group and the violation of their functional state at the early stages of the study.
В качестве одного из механизмов действия магниевого комплекса на возможность лечения нейродегенеративных заболеваний может являться его связывание с бета-амилоидом. Были рассчитаны кинетические характеристики взаимодействия магниевого комплекса и иммобилизованного человеческого бета-амилоида, которые оказались равны kon = (1,29±0,06) × 103 M-1s-1; koff = (5,42±0,06) × 10-3 s-1; KD = (4,2±0,3) × 10-6 М. Поскольку значение KD ≤ 10-4 М, то такое взаимодействие является биологически значимым. В отличие от магниевого комплекса, пептид НАЕЕ не связывался с бета-амилоидом в аналогичных экспериментальных условиях. As one of the mechanisms of action of the magnesium complex on the possibility of treating neurodegenerative diseases, its binding to beta-amyloid may be. Were calculated the kinetic characteristics of the interaction of the magnesium complex and immobilized human beta-amyloid, which were equal to k on = (1.29±0.06) × 10 3 M -1 s -1 ; k off \u003d (5.42 ± 0.06) × 10 -3 s -1 ; K D = (4.2±0.3) × 10 -6 M. Since the value of K D ≤ 10 -4 M, then this interaction is biologically significant. In contrast to the magnesium complex, the HAEE peptide did not bind beta-amyloid under similar experimental conditions.
Это различие между нативным НАЕЕ и магниевым комплексом может влиять на фармакологические свойства, что подтвердили различающиеся тесты восстановления когнитивных функций – эффективность НАЕЕ была значительно ниже эффективности заявляемого магниевого комплекса. Этот эффект можно связать с вышеупомянутыми данными ВЭЖХ-МС, которые показали изменения в 3D структуре нативного НАЕЕ после его введения в плазму крови, тогда как магниевый комплекс до и после его введения в плазму крови имеет одно и то же время удерживания на хроматограмме ВЭЖХ и, соответственно, устойчивую 3D структуру. Это означает, что ион магния в магниевом комплексе играет защитную роль для сохранения «развёрнутой» конформации пептида HAEE в данном комплексе, что, возможно, также предотвращает взаимодействия магниевого комплекса с элементами плазмы крови, поскольку известно, что введение нативного HAEE в периферическую кровеносную систему мышей, крыс и кроликов приводит к образованию стабильных комплексов HAEE с транспортными и рецепторными белками (Zolotarev Y.A., Mitkevich V.A., Shram S.I. et al. Pharmacokinetics and Molecular Modeling Indicate nAChRα4-Derived Peptide HAEE Goes through the Blood–Brain Barrier. Biomolecules. 2021. 11(6): p. 909, doi: 10.3390/biom11060909).This difference between the native HAEE and the magnesium complex can influence the pharmacological properties, which was confirmed by different cognitive recovery tests - the effectiveness of the HAEE was significantly lower than the effectiveness of the proposed magnesium complex. This effect can be associated with the above HPLC-MS data, which showed changes in the 3D structure of native HAEE after its introduction into blood plasma, while the magnesium complex before and after its introduction into blood plasma has the same retention time on the HPLC chromatogram and, respectively, a stable 3D structure. This means that the magnesium ion in the magnesium complex plays a protective role in maintaining the “unfolded” conformation of the HAEE peptide in this complex, which may also prevent interactions of the magnesium complex with blood plasma elements, since it is known that the introduction of native HAEE into the peripheral circulatory system of mice , rats and rabbits leads to the formation of stable HAEE complexes with transport and receptor proteins (Zolotarev Y.A., Mitkevich V.A., Shram S.I. et al. Pharmacokinetics and Molecular Modeling Indicate nAChRα4-Derived Peptide HAEE Goes through the Blood–Brain Barrier. Biomolecules. 2021. 11 (6): p. 909, doi: 10.3390/biom11060909).
В совокупности можно сделать вывод о том, что магниевый комплекс имеет намного большую терапевтическую эффективность по сравнению с НАЕЕ и эти вещества между собой бионеэквивалентны, поскольку магниевый комплекс существует в растворе плазмы крови в «развернутой» конформации и имеет отличный от НАЕЕ механизм действия.Together, it can be concluded that the magnesium complex has a much greater therapeutic efficacy compared to HAEE and these substances are not bioequivalent to each other, since the magnesium complex exists in the blood plasma solution in an “unfolded” conformation and has a mechanism of action different from HAEE.
Описание фигур.Description of the figures.
Фиг. 1. Дифрактограмма магниевого комплекса [Mg(НАЕЕ)]Cl2.Fig. 1. X-ray diffraction pattern of the magnesium complex [Mg(HAEE)]Cl 2 .
Фиг. 2. ДСК-ТГА кривая НАЕЕ. 1 – ДСК-кривая; 2 – ТГ-кривая.Fig. 2. DSC-TGA curve HAEE. 1 – DSC curve; 2 - TG curve.
Фиг. 3. ДСК-ТГА кривая магниевого комплекса [Mg(НАЕЕ)]Cl2 ; 1 – ДСК-кривая; 2 – ТГ-кривая.Fig. 3. DSC-TGA curve of the magnesium complex [Mg(HAEE)]Cl 2 ; 1 – DSC curve; 2 - TG curve.
Фиг. 4. ИК-спектр c Фурье преобразованием НАЕЕ (1) и магниевого комплекса [Mg(НАЕЕ)]Cl2 (2).Fig. Fig. 4. Fourier transform IR spectrum of (1) HAEEE and (2) magnesium complex [Mg(HAEE)]Cl 2 .
Фиг. 5. Расположение атомов в молекуле НАЕЕ для 1Н-ЯМР-анализа.Fig. 5. Arrangement of atoms in the HAE molecule for 1 H-NMR analysis.
Фиг. 6. Фиг. 1Н-ЯМР спектр НАЕЕ.Fig. 6. FIG. 1 H-NMR spectrum of HAE.
Фиг. 7. 1Н-ЯМР спектр [Mg(НАЕЕ)]Cl2.Fig. 7. 1 H-NMR spectrum of [Mg(HAEE)]Cl 2 .
Описание приборов.Description of devices.
Порошковый рентгенофазовый анализ (РФА) выполнялся на дифрактометре Rigaku Ultima IV (Япония), напряжение на трубке – 40 кВ, ток трубки – 30 мА, материал анода трубки – Cu. Гониометр: Θ/Θ вертикального типа, образец неподвижен. Радиус гониометра – 185 мм /285 мм. Максимумы на дифрактограмме накапливались в течение 1 ч. Угол 2Θ составил от 3 до 70 градусов.Powder X-ray phase analysis (XRD) was performed on a Rigaku Ultima IV diffractometer (Japan), the tube voltage was 40 kV, the tube current was 30 mA, and the tube anode material was Cu. Goniometer: Θ/Θ vertical type, the sample is stationary. The radius of the goniometer is 185 mm / 285 mm. The maxima in the diffraction pattern accumulated over 1 h. The angle 2Θ ranged from 3 to 70 degrees.
Исследование температуры плавления, термического поведения и потери массы выполняли методом дифференциальной сканирующей калориметрии и термогравиметрии (ДСК-ТГА) на приборе NETZSCH STA 449 С (Германия) в инертной атмосфере при скорости нагрева 10 град/мин.The melting point, thermal behavior, and weight loss were studied by differential scanning calorimetry and thermogravimetry (DSC-TGA) on a NETZSCH STA 449 C instrument (Germany) in an inert atmosphere at a heating rate of 10 deg/min.
Элементный анализ выполнен методом энергодисперсионной рентгеновской спектроскопии с приставкой EDXA на микроскопе TESCAN MIRA3 (Чехия). Площадь измеряемого участка 0,04 мм2, количество измерений – 3.Elemental analysis was performed by energy dispersive X-ray spectroscopy with an EDXA attachment on a TESCAN MIRA3 microscope (Czech Republic). The area of the measured area is 0.04 mm 2 , the number of measurements is 3.
Спектры инфракрасного излучения (ИК-спектры) получали на ИК-Фурье спектрометре Spectrum Two (Perkin Elmer, США) c приставкой диффузного отражения в диапазоне 4000-600 см-1 с разрешением 2 см-1, количество сканов – 10.Infrared radiation spectra (IR spectra) were obtained on a Spectrum Two IR-Fourier spectrometer (Perkin Elmer, USA) with a diffuse reflectance attachment in the range of 4000-600 cm -1 with a resolution of 2 cm -1 , the number of scans was 10.
1Н-спектры ЯМР получали на ЯМР-спектрометре Bruker Avance IIIHD 500, рабочая частота 500,13 Mhz для ядер 1H. 1 H NMR spectra were obtained on a
Характеризация магниевого комплекса [Mg(НАЕЕ)]Cl2 в водном растворе проводилась методом масс-спектрометрии высокого разрешения с использованием масс-спектрометра LTQ FT Ultra (Thermo Scientific, Германия), который сочетает в себе технологии ионного циклотронного резонанса с преобразованием Фурье и ионной ловушки. Ионизацию электрораспылением (ESI) проводили с использованием источника Ion Max (Thermo Scientific, Германия) с металлическим капилляром для распыления. Использовались следующие параметры источника IonMax: скорость потока составляла 3 мкл/мин; температура нагретого капилляра составляла 200°C; распыляемый газ был отключен; напряжение на капилляре электрораспыления составляло +3,8 кВ в положительной моде и -2,5кВ в отрицательно моде. Идентификация молекулярных ионов проводилась с помощью специализированного программного обеспечения Qual Browser (Thermo Corp., Germany). Возможность характеризации катионных комплексов пептидов с помощью метода масс-спектрометрии была ранее описана (Zirah S., Rebuffat S., Kozin, S.A. et al (2003). Zinc binding properties of the amyloid fragment Aβ(1–16) studied by electrospray-ionization mass spectrometry. International Journal of Mass Spectrometry, 228(2-3), 999-101.The characterization of the magnesium complex [Mg(HAEE)]Cl 2 in an aqueous solution was carried out by high-resolution mass spectrometry using an LTQ FT Ultra mass spectrometer (Thermo Scientific, Germany), which combines the technologies of ion cyclotron resonance with Fourier transform and ion trap . Electrospray ionization (ESI) was performed using an Ion Max source (Thermo Scientific, Germany) with a metal sputtering capillary. The following parameters of the IonMax source were used: the flow rate was 3 μl/min; the temperature of the heated capillary was 200°C; spray gas has been turned off; the electrospray capillary voltage was +3.8 kV in the positive mode and -2.5 kV in the negative mode. Molecular ions were identified using specialized software Qual Browser (Thermo Corp., Germany). The possibility of characterization of cationic peptide complexes using mass spectrometry was previously described (Zirah S., Rebuffat S., Kozin, SA et al (2003). Zinc binding properties of the amyloid fragment Aβ(1–16) studied by electrospray-ionization mass spectrometry, International Journal of Mass Spectrometry, 228(2-3), 999-101.
Образование комплекса фиксировали биосенсором на эффекте поверхностного плазмонного резонанса (БППР) в водных буферных системах при физиологических значениях pH. БППР эксперименты были проведены на инструменте «BIAcore 3000» (GE Healthcare, США) с использованием оптического чипа CM4 в соответствии с протоколами компании-производителя. Синтетический аналог 42-членного человеческого бета-амилоида (Aβ42), на C-конце которого добавлен тетраглицилцистеиновый пептидный фрагмент (-Gly-Gly-Gly-Gly-Cys), был использован в качестве лиганда. Лиганд (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAGGGGC) иммобилизовали на поверхности оптического чипа через дисульфидную связь тиоловой группы С-концевого остатка цистеина. В качестве аналитов использовали магниевый комплекс или HAEE. The formation of the complex was recorded with a biosensor based on the effect of surface plasmon resonance (SPPR) in aqueous buffer systems at physiological pH values. The BPPR experiments were carried out on a
Высушивание замороженных образцов выполнялось в пенициллиновых пузырьках на сублиматоре Heto FD 2.5 при давлении 0,1-0,2 мбар.Drying of frozen samples was carried out in penicillin vials on a Heto FD 2.5 sublimator at a pressure of 0.1-0.2 mbar.
Тест ускоренного хранения проводили в камере Memmert HCP50 при 40 °С и 75% влажности. Образцы отбирали раз в месяц в течение 6 месяцев и определяли содержание действующего вещества методом ВЭЖХ.The accelerated storage test was carried out in a Memmert HCP50 chamber at 40°C and 75% humidity. Samples were taken once a month for 6 months and the content of the active substance was determined by HPLC.
Варианты осуществления изобретенияEmbodiments of the invention
Изобретение иллюстрируется нижеприведенными примерами, но не ограничивается ими.The invention is illustrated by the following examples, but is not limited to them.
Пример 1. Получение магниевого комплекса пептида HAEE. Example 1Receipt magnesium complex HAEE peptide.
Для получения комплекса в качестве источника магния использовались ацетат магния, хлорид магния, и др. соли в разных соотношениях. В таблице 1 приведены различные соотношения солей магния для получения комплекса.To obtain the complex, magnesium acetate, magnesium chloride, and other salts were used as a source of magnesium in various proportions. Table 1 shows the various ratios of magnesium salts to obtain the complex.
Для получения комплекса готовили раствор НАЕЕ с концентрацией 10-5 М. В него добавляли раствор соли магния с концентрацией 10-3 М (Таблица 1). Перемешивание осуществляли в течение 5-60 мин. Эквимолярные магниевые комплексы образовывались при молярном соотношении НАЕЕ и соли магния равные 1:1. Раствор медленно замораживали в холодильной установке при -20 или -80 °С и затем осуществляли лиофильную сушку в стандартном режиме. Далее детально изучали свойства полученного лиофилизированного магниевого комплекса.To obtain the complex, a solution of HAEE was prepared with a concentration of 10 -5 M. A magnesium salt solution with a concentration of 10 -3 M was added to it (Table 1). Stirring was carried out for 5-60 minutes. Equimolar magnesium complexes were formed at a molar ratio of HAEE and magnesium salts equal to 1:1. The solution was slowly frozen in a refrigeration unit at -20 or -80°C and then lyophilized in the standard mode. Further, the properties of the resulting lyophilized magnesium complex were studied in detail.
При молярном соотношении компонентов менее 0,1 комплекс в растворе не обнаруживался методом ЯМР (сигналы основного вещества не смещались). При увеличении концентрации соли магния более 1:10 образовывались смесь из магниевого комплекса и соответствующей соли магния.At a molar ratio of components less than 0.1, the complex in solution was not detected by NMR (the signals of the main substance did not shift). With an increase in the concentration of the magnesium salt more than 1:10, a mixture of the magnesium complex and the corresponding magnesium salt was formed.
Для получения магниевого комплекса в твердой форме полученные растворы замораживали в морозильной камере (-20 °С) в пенициллиновых пузырьках в течение 2 ч. Замороженные образцы помещали в сублиматор с предварительно охлажденными полками и высушивали в течение 16-30 ч. Все высушенные образцы имели белый цвет. Выход продукта 99%. Высокий выход продукта обусловлен отсутствием потерь при высушивании образцов.To obtain a magnesium complex in solid form, the resulting solutions were frozen in a freezer (-20°C) in penicillin vials for 2 h. The frozen samples were placed in a sublimator with pre-chilled shelves and dried for 16–30 h. color. Product yield 99%. The high yield of the product is due to the absence of losses during drying of the samples.
Полученные твердые образцы комплекса характеризуются аморфной формой на дифрактограмме (Фиг. 1). На ДСК кривой в отличие от НАЕЕ (Фиг. 2) комплекс характеризуется двумя максимумами: первый широкий эндотермический максимум начинается от 62 °С и имеет максимум при 120 °С; второй эндотермический максимум имеет температуру плавления при 267 °С (Фиг. 3). Методом ДСК-ТГА было показано, что магниевый комплекс в твердой форме может содержать гидратированную или остаточную воду, содержание которой для разных образцов не превышало 5% (потеря массы при нагревании до 100 °С).The obtained solid samples of the complex are characterized by an amorphous form on the diffraction pattern (Fig. 1). On the DSC curve, in contrast to the HAEE (Fig. 2), the complex is characterized by two maxima: the first wide endothermic maximum starts at 62°C and has a maximum at 120°C; the second endothermic maximum has a melting point at 267°C (Fig. 3). It was shown by DSC-TGA that the magnesium complex in solid form may contain hydrated or residual water, the content of which for different samples did not exceed 5% (mass loss upon heating to 100°C).
Элементный анализ (EDXA) магниевого комплекса показал содержание магния в образцах (при молекулярном соотношении НАЕЕ : Mg = 1:1), от 4±0,5 до 7±1 % масс. в зависимости от природы аниона.Elemental analysis (EDXA) of the magnesium complex showed the content of magnesium in the samples (at a molecular ratio of HAE : Mg = 1:1), from 4 ± 0.5 to 7 ± 1 wt%. depending on the nature of the anion.
ИК-спектр с Фурье преобразованием комплекса по сравнению с НАЕЕ характеризуется смещением максимума при 1395 в область 1410 см-1 (CH3 деф.), что отличает заявляемый магниевый комплекс от НАЕЕ (Фиг. 4).The IR spectrum with the Fourier transform of the complex in comparison with HAEE is characterized by a shift of the maximum at 1395 to the region of 1410 cm -1 (CH 3 def.), which distinguishes the inventive magnesium complex from HAEE (Fig. 4).
Исходный образец НАЕЕ характеризовался ЯМР 1H[500.13Mhz; D2O; 298K; d, м.д.]: 1.27 (3H, d, j=7.13Hz, CH3(16)), 1.87 (5H, m, CH3(3), 1/2CH2(21),1/2CH2(33)), 1.99 (2H, sx, j=7.45Hz 1/2CH2(21),1/2CH2(33)), 2.28 (4H, m, 2CH2(22,34 )), 3.13, 3,03 (2H, m, CH2(8)), 4.19 (3H, m, 3CH (15,20,29)), 4.56 (1H, t, j=6.86Hz, CH(5)), 7.19 (1H, s, CH(10)), 8.50 (1H, s, CH(12)) (Фиг. 6). The original HAEE sample was characterized by NMRoneH[500.13Mhz; D2O; 298K; d, ppm]: 1.27 (3H, d, j=7.13Hz, CH3(16)), 1.87 (5H, m, CH3(3), 1/2CH2(21),1/2CH2(33)), 1.99 (2H, sx, j=7.45Hz 1/2CH2(21),1/2CH2(33)), 2.28 (4H, m, 2CH2(22.34 )), 3.13, 3.03 (2H, m, CH2(8)), 4.19 (3H, m, 3CH (15,20,29)), 4.56 (1H, t, j=6.86Hz, CH(5)), 7.19 (1H, s, CH(10)), 8.50 (1H, s, CH(12)) (Fig. 6).
После образования магниевого комплекса положение химических сдвигов протонов в молекуле НАЕЕ изменялась и представлено на Фиг. 7, что свидетельствует о взаимодействии магния с молекулой НАЕЕ в растворе и, следовательно, о сохранении комплекса, что важно для его фармакологических свойств. Смещение сигналов представлены в Таблица 2, значимыми были приняты сигналы отличающиеся на 0,02 м.д. After the formation of the magnesium complex, the position of the chemical shifts of protons in the HAEE molecule changed and is shown in Fig. 7, which indicates the interaction of magnesium with the HAEE molecule in solution and, consequently, the preservation of the complex, which is important for its pharmacological properties. The signal offsets are presented in Table 2; signals differing by 0.02 ppm were accepted as significant.
. Однако сравнение показывает, что не уширенные сигналы от протонов в комплексе также смещены относительно сигналов молекулы НАЕЕ. Смещение сигналов представлены в Таблица 2, значимыми были приняты сигналы отличающиеся на 0,03 м.д. . However, the comparison shows that the unbroadened signals from protons in the complex are also shifted relative to the signals of the HAEE molecule. Signal offsets are presented in Table 2, signals differing by 0.03 ppm were accepted as significant.
Смещение протонных сигналов от определенных групп в молекуле показывает их вклад в электростатическое взаимодействие с ионом магния при образовании комплекса; чем больше взаимодействие, тем большее смещение наблюдается в 1Н-ЯМР-спектре у определенных СН-групп молекулы.The shift of proton signals from certain groups in the molecule shows their contribution to the electrostatic interaction with the magnesium ion during the formation of the complex; the greater the interaction, the greater the shift observed in the 1 H-NMR spectrum for certain CH groups of the molecule.
При наличии в твердой фазе ацетата, бензоата, салицилата, тартрата в 1Н-ЯМР-спектре магниевого комплекса помимо молекулы НАЕЕ фиксировались сигналы от этих анионов, например от ацетата (СН3 - 1,92 м.д.).In the presence of acetate, benzoate, salicylate, tartrate in the solid phase, in addition to the HAEE molecule, signals from these anions, for example, from acetate (CH 3 - 1.92 ppm), were detected in the 1 H-NMR spectrum of the magnesium complex.
Характеризация магниевого комплекса [Mg(НАЕЕ)]Cl2 в водном растворе проводилась методом масс-спектрометрии высокого разрешения с использованием технологии ионного циклотронного резонанса с преобразованием Фурье путем измерения точной массы характерных молекулярных ионов как при положительной, так и при отрицательной модах ионизации. Для проведения измерений образцы магниевого комплекса [Mg(НАЕЕ)]Cl2 в водном растворе c концентрацией 20 мкМ вносили в смесь воды и ацетонитрила в соотношении 1:1 с добавлением муравьиной кислоты (для достижении финальной концентрации 0,1%). Масс-спектрометрический анализ водного раствора магниевого комплекса [Mg(НАЕЕ)]Cl2, проведенный при положительной моде электроспрейного ионизационного источника, показал наличие молекулярного иона [HAEE+H]+1 с моноизотопной массой 526,2314 m/z и молекулярного иона [HAEE-H+Mg]+1 с моноизотопной массой 548,1950 m/z. При использовании отрицательной моды электроспрейного ионизационного источника для анализа магниевого комплекса [Mg(НАЕЕ)]Cl2 в водном растворе были идентифицированы молекулярный ион [HAEE-H]-1 с моноизотопной массой 524,2168 m/z и молекулярный ион [HAEE-3H+Mg]-1 с моноизотопной массой 546,1972 m/z. Таким образом, полученные данные подтверждают специфическое связывание катиона магния (II) с пептидом HAEE, которое характеризует внутреннюю координационную сферу магниевого комплекса [Mg(НАЕЕ)]2+ в водном растворе.Characterization of the magnesium complex [Mg(HAEE)]Cl 2 in aqueous solution was carried out by high-resolution mass spectrometry using Fourier transform ion cyclotron resonance technology by measuring the exact mass of characteristic molecular ions in both positive and negative ionization modes. For measurements, samples of the magnesium complex [Mg(HAEE)]Cl 2 in an aqueous solution with a concentration of 20 μM were added to a mixture of water and acetonitrile in a ratio of 1:1 with the addition of formic acid (to achieve a final concentration of 0.1%). Mass spectrometric analysis of an aqueous solution of the magnesium complex [Mg(HAEE)]Cl 2 , carried out in the positive mode of an electrospray ionization source, showed the presence of the molecular ion [HAEE+H] +1 with a monoisotopic mass of 526.2314 m/z and the molecular ion [HAEE -H+Mg] +1 with a monoisotopic mass of 548.1950 m/z. When using the negative mode of an electrospray ionization source for the analysis of the magnesium complex [Mg(HAEE)]Cl 2 in an aqueous solution, the molecular ion [HAEE-H] -1 with a monoisotopic mass of 524.2168 m/z and the molecular ion [HAEE-3H+ Mg] -1 with a monoisotopic mass of 546.1972 m/z. Thus, the data obtained confirm the specific binding of the magnesium (II) cation to the HAEE peptide, which characterizes the internal coordination sphere of the magnesium complex [Mg(HAEE)] 2+ in aqueous solution.
Сравнительный анализ магниевого комплекса методом ВЭЖХ-МС (2,5 нг/мл, 0,5% FA – муравьиная кислота, 50% МеОН (1:1)) показал, что в водных растворах in vitro при физиологических значениях pH его хроматографическая подвижность практически идентична HAЕЕ в тех же хроматографических условиях. Время выхода хроматографического пика с колонки составляло 2,75 (комплекс) и 2,85 мин (НАЕЕ), соответственно. С учетом известных из литературы данных молекулярного моделирования (Barykin E.P., Garifulina A.I., Tolstova A.P. et al. (2020). Tetrapeptide Ac-HAEE-NH2 Protects α4β2 nAChR from Inhibition by Aβ. International journal of molecular sciences, 21(17), 6272, doi: 10.3390/ijms21176272), вышеприведённые результаты указывают на то, что пространственные структуры основной пептидной цепи магниевого комплекса и пептида HAEE в условиях in vitro идентичны и характеризуется «развернутой» конформацией.Comparative analysis of the magnesium complex by HPLC-MS (2.5 ng/ml, 0.5% FA - formic acid, 50% MeOH (1:1)) showed that in aqueous solutions in vitro at physiological pH values, its chromatographic mobility is practically identical to HAEE under the same chromatographic conditions. The exit time of the chromatographic peak from the column was 2.75 (complex) and 2.85 min (HAEE), respectively. Taking into account the molecular modeling data known from the literature (Barykin EP, Garifulina AI, Tolstova AP et al. (2020). Tetrapeptide Ac-HAEE-NH 2 Protects α4β2 nAChR from Inhibition by Aβ. International journal of molecular sciences, 21(17), 6272, doi: 10.3390/ijms21176272), the above results indicate that the spatial structures of the main peptide chain of the magnesium complex and the HAEE peptide are identical under in vitro conditions and are characterized by an "unfolded" conformation.
После введения магниевого комплекса и HAEE внутривенно в организм здоровых мышей (n = 5) для определения в ней содержания комплекса было показано, что время выхода хроматографического пика НАЕЕ, экстрагированного из образцов крови мыши, не изменялось и также составляло 2,75 мин. Однако, для HAEE, введенного в организм в нативной форме, экстрагированного из образцов крови, было неожиданно обнаружено, что время выхода хроматографического пика стало 1,27 мин. Только около 8% вещества продолжало выходить из колонки на времени 2,85 мин.After the administration of the magnesium complex and HAEE intravenously into the body of healthy mice (n = 5) to determine the content of the complex in it, it was shown that the time of release of the chromatographic peak of HAEE, extracted from mouse blood samples, did not change and was also 2.75 min. However, for HAEE administered in native form, extracted from blood samples, it was unexpectedly found that the chromatographic peak time was 1.27 minutes. Only about 8% of material continued to exit the column at 2.85 minutes.
Полученные данные свидетельствует о том, что в образцах крови человека или мыши конформация пептида HAEE резко отличается от конформации, наблюдаемой при тех же условиях для магниевого комплекса. Лишь 8% НАЕЕ находится в «развернутой» конформации после его взаимодействия с элементами плазмы крови. Таким образом, в образцах крови магниевый комплекс сохраняет свою конформацию (предположительно, «развёрнутую») неизменной, в то время как HAEE приобретает иную конформацию, которая характеризуется гораздо более компактной структурой, предположительно, «спиральной». Это означает, что магниевый комплекс устойчив к изменению конформации в плазме крови. Согласно настоящему изобретению, для достижения терапевтического эффекта как от магниевого комплекса пептида HAEE, так и от HAEE требуется их введение в организм и присутствие в плазме крови, поэтому принципиальные различия в пространственной структуре этих молекул в плазме крови, исходя из общих представлений биохимии и физиологии, свидетельствуют о различном молекулярном механизме действия магниевого комплекса и HAEE, что исключает их биоэквивалентность.The data obtained indicate that the conformation of the HAEE peptide in human or mouse blood samples differs sharply from the conformation observed under the same conditions for the magnesium complex. Only 8% of HAEE is in the "unfolded" conformation after its interaction with blood plasma elements. Thus, in blood samples, the magnesium complex retains its conformation (presumably "unfolded") unchanged, while HAEE acquires a different conformation, which is characterized by a much more compact structure, presumably "helical". This means that the magnesium complex is resistant to changes in conformation in blood plasma. According to the present invention, in order to achieve a therapeutic effect, both the magnesium complex of the HAEE peptide and HAEE require their introduction into the body and presence in the blood plasma, therefore, the fundamental differences in the spatial structure of these molecules in the blood plasma, based on the general concepts of biochemistry and physiology, indicate a different molecular mechanism of action of the magnesium complex and HAEE, which excludes their bioequivalence.
Была определена стабильность магниевого комплекса в тесте ускоренного хранения в течение 6 месяцев, что соответствует 2 годам хранения в обычных условиях (Таблица 3). Магниевый комплекс, как очищенный от анионов, так и в смеси с указанными анионами за время хранения сохранил свой цвет, консистенцию, не набирал воды (масса образца не увеличивалась в пределах 1-2%) и не терял активное вещество. Образец НАЕЕ с течением времени набирал воду (до 7% масс.) и по данным ВЭЖХ деградировал до 67,4% активного вещества за 6 мес. Образец, полученный по патенту РФ № 2709539, представляющий собой комплекс НАЕЕ-Zn-HSA также набирал воду (до 16% масс.) и деградировал до содержания 71,9% от исходного количества. Таким образом, стабильность заявляемого магниевого комплекса оказалась значительно выше по сравнению с НАЕЕ и НАЕЕ-Zn-HSA.The stability of the magnesium complex was determined in the accelerated storage test for 6 months, which corresponds to 2 years of storage under normal conditions (Table 3). The magnesium complex, both purified from anions and mixed with the indicated anions, retained its color and consistency during storage, did not gain water (the mass of the sample did not increase within 1-2%) and did not lose the active substance. The HAEE sample accumulated water over time (up to 7% wt.) and, according to HPLC data, degraded to 67.4% active substance in 6 months. The sample obtained according to the patent of the Russian Federation No. 2709539, which is a complex of HAEE-Zn-HSA, also collected water (up to 16% wt.) and degraded to a content of 71.9% of the original amount. Thus, the stability of the proposed magnesium complex was significantly higher compared to HAE and HAE-Zn-HSA.
Пример 2. Фармацевтические композиции на основе магниевого комплекса пептида HAEE. Example 2Pharmaceutical compositions based on magnesium complex of the HAEE peptide.
Фармацевтические композиции на основе магниевого комплекса пептида HAEE могут содержать активное вещество в эффективном количестве (Таблица 4). Состав дозы рассчитывается индивидуально и может варьироваться от 0,1 мг до 100 мг на человека в сутки, более предпочтительно от 1 до 50 мг. Составы фармацевтических композиций представлены в Таблице 3. Пересчет выполнен на дозировку активного вещества. Возможны и другие соотношения активного вещества в фармацевтической композиции в диапазоне от 0,1 до 100 мг. Масса таблеток варьируется от 100 до 400 мг, таблетки могут быть покрыты оболочкой. Pharmaceutical compositions based on the magnesium complex of the HAEE peptide may contain the active substance in an effective amount (Table 4). The composition of the dose is calculated individually and can vary from 0.1 mg to 100 mg per person per day, more preferably from 1 to 50 mg. The compositions of the pharmaceutical compositions are presented in Table 3. The conversion is made for the dosage of the active substance. Other ratios of the active substance in the pharmaceutical composition are also possible in the range from 0.1 to 100 mg. The weight of tablets varies from 100 to 400 mg, tablets can be coated.
Пример 3. Влияние магниевого комплекса пептида HAEE на поведенческие функции и степень тяжести церебрального амилоидоза у экспериментальных животных. Example 3 Effect of the HAEE Peptide Magnesium Complex on Behavioral Functions and Severity of Cerebral Amyloidosis in Experimental Animals.
Для моделирования нейродегенеративного заболевания была выбрана модель болезни Альцгеймера, являющейся основным по распространённости нейродегенеративным заболеванием у людей пожилого возраста.To model a neurodegenerative disease, a model of Alzheimer's disease, which is the most common neurodegenerative disease in the elderly, was chosen.
Для проведения экспериментов были использованы самцы трансгенных мышей линии APPswe/PSEN1dE9. Мыши данной линии также известны под названием APP/PS1: у контрольной группы мышей APP/PS1, начиная с 4-6-месячного возраста, проявляются характерные когнитивные признаки патологии, подобной болезни Альцгеймера, и имеется значительное количество конгофильных амилоидных бляшек в специфических отделах мозга, включая гиппокамп и кортекс (Borchelt D.R., Ratovitski T., Van Lare J., et al. (1997). Accelerated amyloid deposition in the brains of transgenic mice coexpressing mutant presenilin 1 and amyloid precursor proteins. Neuron, 19(4), 939-945, doi: 10.1016/S0896-6273(00)80974-5).Male transgenic mice of the APPswe/PSEN1dE9 line were used for the experiments. Also known as APP/PS1 mice, the APP/PS1 control mice, starting at 4-6 months of age, show characteristic cognitive signs of an Alzheimer's disease-like pathology and have a significant amount of congophilic amyloid plaques in specific areas of the brain, including hippocampus and cortex (Borchelt D.R., Ratovitski T., Van Lare J., et al. (1997). Accelerated amyloid deposition in the brains of transgenic mice coexpressing
Для тестирования были использованы 8-месячные животные, сгруппированные в следующие экспериментальные группы (n = 12 в каждой группе):For testing, 8-month-old animals were used, grouped into the following experimental groups (n = 12 in each group):
1. контроль 1. Мыши дикого типа, которым внутривенно вводили физиологический раствор;1.
2. контроль 2. Трансгенные мыши APP/PS1, которым внутривенно вводили физиологический раствор;2.
3. трансгенные мыши APP/PS1, которым внутривенно вводили HAEE;3. APP/PS1 transgenic mice injected with HAEE intravenously;
4. трансгенные мыши APP/PS1, которым внутривенно вводили HAEE-Zn-HSA;4. APP/PS1 transgenic mice injected with HAEE-Zn-HSA intravenously;
5. трансгенные мыши APP/PS1, которым внутривенно вводили [Mg(НАЕЕ)]Cl2.5. APP/PS1 transgenic mice injected with [Mg(HAEE)]Cl 2 intravenously.
Препараты HAEE, HAEE-Zn-HSA и заявляемый магниевый комплекс вводили в ретроорбитальное венозное сплетение в соответствии с известной процедурой (Yardeni T., Eckhaus M., Morris H.D. et al. (2011). Retro-orbital injections in mice. Lab animal, 40(5), 155-160, doi: 10.1038/laban0511-155). Инъекции в дозе 0,05 мг/кг проводили ежемесячно, в возрасте от 2 до 7 месяцев (включительно), всего было сделано 6 инъекций препаратами HAEE и магниевого комплекса, однако, препаратом HAEE-Zn-HSA было сделано только две инъекции, а далее эксперименты с этим препаратом были прекращены из-за появления признаков ухудшения внешнего вида экспериментальных животных после первой инъекции и гибели 5 трансгенных мышей непосредственно после второй инъекции. Скорее всего, это связано с влиянием высоких концентраций HSA, который отличается по структуре от эндогенного мышиного альбумина (MSA).Preparations HAEE, HAEE-Zn-HSA and the claimed magnesium complex injected into the retroorbital venous plexus according to a known procedure (Yardeni T., Eckhaus M., Morris H.D. et al. (2011). Retro-orbital injections in mice. Lab animal, 40(5), 155-160, doi: 10.1038 /laban0511-155). Injections at a dose of 0.05 mg/kg were performed monthly, at the age of 2 to 7 months (inclusive), a total of 6 injections were made with HAEE and magnesium complex preparations, however, only two injections were made with HAEE-Zn-HSA, and then experiments with this drug were terminated due to the appearance of signs of deterioration in the appearance of experimental animals after the first injection and the death of 5 transgenic mice immediately after the second injection. This is most likely due to the influence of high concentrations of HSA, which differs in structure from endogenous mouse albumin (MSA).
В возрасте 8 месяцев проводили тестирование поведенческих функций, затем животные подвергались эвтаназии с последующим забором мозга и гистохимическим анализом числа конгофильных бляшек в областях СА1, СА2, СА3 и зубчатой извилине гиппокампа согласно известной процедуре (Kozin S.A., Barykin E.P., Telegin G.B., et al. Intravenously Injected Amyloid-β Peptide With Isomerized Asp7 and Phosphorylated Ser8 Residues Inhibits Cerebral β-Amyloidosis in AβPP/PS1 Transgenic Mice Model of Alzheimer's Disease. Frontiers in neuroscience, 2018, 12, 518-518, doi: 10.3389/fnins.2018.00518).At the age of 8 months, behavioral functions were tested, then the animals were euthanized with subsequent brain sampling and histochemical analysis of the number of congophilic plaques in the areas of CA1, CA2, CA3 and the dentate gyrus of the hippocampus according to a known procedure (Kozin S.A., Barykin E.P., Telegin G.B., et al. Intravenously Injected Amyloid-β Peptide With Isomerized Asp7 and Phosphorylated Ser8 Residues Inhibits Cerebral β-Amyloidosis in AβPP/PS1 Transgenic Mice Model of Alzheimer's Disease Frontiers in neuroscience, 2018, 12, 518-518, doi: 10.3389/fnins.2018.00518).
3.1 Анализ улучшения поведенческих функций у 8-месячных самцов трансгенных мышей APP/PS1 под действием HAEE и магниевого комплекса пептида HAEE был проведён с помощью теста «Закапывание шариков». В качестве контроля использовались трансгенные мыши APP/PS1 и мыши дикого типа. Для проведения теста мышей помещали в клетки со свежим подстилом с размещенными на нем восемнадцатью шариками, расположенными в виде матрицы 3 х 6. Мышей оставляли в клетке на 30 минут, после чего определяли количество более чем на 2/3 закопанных шариков (КЗШ) в процентах от общего количества шариков. Поведение закапывания является признаком обсессивно-компульсивного поведения. Из-за повторяющегося и персеверативного характера закапывания такое поведение может представлять нейропсихиатрические симптомы, такие как персеверативное поведение и/или стереотипное поведение. Оба являются нейропсихиатрическими симптомами, обычно присутствующими у пациентов с болезнью Альцгеймера и другими видами деменции. 3.1 An analysis of the improvement in behavioral functions in 8-month-old male APP/PS1 transgenic mice under the action of HAEE and the magnesium complex of the HAEE peptide was carried out using the "Ball Burial" test. APP/PS1 transgenic mice and wild-type mice were used as controls. For the test, mice were placed in cages with fresh bedding with eighteen balls placed on it, arranged in a 3 x 6 matrix. of the total number of balls. Burrowing behavior is a sign of obsessive-compulsive behavior. Due to the repetitive and perseverative nature of instillation, such behavior may present with neuropsychiatric symptoms such as perseverative behavior and/or stereotyped behavior. Both are neuropsychiatric symptoms commonly present in patients with Alzheimer's disease and other types of dementia.
По результатам тестирования, уровень поведения контрольной группы мышей дикого типа характеризовался значением КЗШ = 50,6±13,3 %. Это значение рассматривается в качестве референсного. У контрольной группы трансгенных мышей APP/PS1 значение КЗШ = 12,6±4,2 %, что указывает на сильное ухудшение поведенческих рефлексов мышей APP/PS1 по сравнению с животными дикого типа и отражает инвалидизирующее влияние оверпродукции человеческого бета-амилоида на процессы нервной деятельности. Мыши, инъецированные HAEE и магниевым комплексом пептида HAEE, показали значения КЗШ = 20,6±7,3 % и КЗШ = 42,7±9,8 %, соответственно (Таблица 5).According to the results of testing, the level of behavior of the control group of wild-type mice was characterized by the value of KZSh = 50.6±13.3%. This value is considered as a reference. In the control group of transgenic APP/PS1 mice, the KZS value was 12.6±4.2%, which indicates a strong deterioration in the behavioral reflexes of APP/PS1 mice compared to wild-type animals and reflects the disabling effect of overproduction of human beta-amyloid on the processes of nervous activity. . Mice injected with HAEE and the magnesium complex of the HAEE peptide showed values of KZS = 20.6±7.3% and KZS = 42.7±9.8%, respectively (Table 5).
Эти данные свидетельствуют о том, что использование магниевого комплекса пептида HAEE существенно улучшает поведенческие рефлексы трансгенных мышей APP/PS1, а эффект от этого использования значительно превышает таковой, наблюдаемый для HAEE. Сравнительные эксперименты магниевого комплекса с другими анионами не выявили статистически значимых различий в биологическом эффекте. Введение ближайшего аналога HAEE-Zn-HSA приводило к нарушению физического состояния у мышей и к их гибели, что, по-видимому, связано с высокой дозировкой НSA.These data indicate that the use of the magnesium complex of the HAEE peptide significantly improves the behavioral reflexes of APP/PS1 transgenic mice, and the effect of this use is significantly higher than that observed for HAEE. Comparative experiments of the magnesium complex with other anions did not reveal statistically significant differences in the biological effect. The introduction of the closest analogue of HAEE-Zn-HSA led to a violation of the physical condition in mice and to their death, which, apparently, is associated with a high dosage of HSA.
3.2. Гистохимический анализ конгофильных амилоидных бляшек в областях СА1, СА2, СА3 и зубчатой извилине гиппокампа был проведен согласно ранее описанным процедурам (Kozin S.A., Barykin E.P., Telegin G.B., et al. Intravenously Injected Amyloid-β Peptide With Isomerized Asp7 and Phosphorylated Ser8 Residues Inhibits Cerebral β-Amyloidosis in AβPP/PS1 Transgenic Mice Model of Alzheimer's Disease. Frontiers in neuroscience, 2018, 12, 518-518, doi: 10.3389/fnins.2018.00518). Мозг мышей извлекали и фиксировали в 10% формалине. Процесс заливки образца в парафин проводили следующим образом: заливали 75% этанолом и оставляли на ночь, далее сменяли на 96% этанол и выдерживали 5 мин, 96% этанол – 10 мин, 100% этанол – 10 мин (две замены), этанол-хлороформ (1:1) – 30 мин, и оставляли в чистом хлороформе на ночь. Заливку парафином проводили при 60°С в течение 3 ч (три смены). Заливку тканей в парафиновые блоки осуществляли на приборе Leica EG1160. Серийные срезы головного мозга (8 мкм) вырезали с помощью микротома Leica RM2265 и помещали на предметные стекла. Для депарафинизации, гидратации и окрашивания срезов проводили следующие этапы: предметные стекла последовательно помещали в ксилол три смены (по 10 минут), 96% этанол – 5 мин, 90% этанол – 2 мин, 75% этанол – 2 мин, вода – 5 мин (три смены), раствор конго красного – 5 мин, далее добавлялся раствор гидроксида калия и вода. Для монтирования использовали среду ImMu-Mount (Thermo Scientific). Срезы, охватывающие область мозга от 0,48 до 1,92 мм относительно средней линии в латеральных стереотаксических координатах (Franklin K., Paxinos, G. (2008). The Mouse Brain in Stereotaxic Coordinates. New York, NY: Academic Press), использовали для количественного определения конгофильных амилоидных бляшек в гиппокампе. Анализировали каждый 15-й срез, что давало 10 срезов на животное. Амилоидные бляшки идентифицировали окрашиванием конго красным и подсчитывали вручную. Для каждой группы мышей рассчитывали средние значения и стандартное отклонение количества бляшек на 1 срез. Для проверки нормальности распределения использовали критерий Шапиро-Уилка. Для попарного сравнения исследуемых групп использовали критерий Манна-Уитни. Применяемый уровень значимости составлял 99,9% (P <0,001). 3.2. Histochemical analysis of congophilic amyloid plaques in regions CA1, CA2, CA3 and the dentate gyrus of the hippocampus was performed according to previously described procedures (Kozin SA, Barykin EP, Telegin GB, et al. Intravenously Injected Amyloid-β Peptide With Isomerized Asp7 and Phosphorylated Ser8 Residues Inhibits Cerebral β-Amyloidosis in AβPP/PS1 Transgenic Mice Model of Alzheimer's Disease Frontiers in neuroscience, 2018, 12, 518-518, doi: 10.3389/fnins.2018.00518). The brains of mice were removed and fixed in 10% formalin. The process of embedding the sample in paraffin was carried out as follows: immersed in 75% ethanol and left overnight, then changed to 96% ethanol and kept for 5 min, 96% ethanol - 10 min, 100% ethanol - 10 min (two replacements), ethanol-chloroform (1:1) - 30 min, and left in pure chloroform overnight. Paraffin embedding was carried out at 60°С for 3 h (three shifts). Tissues were embedded in paraffin blocks using a Leica EG1160 instrument. Serial sections of the brain (8 μm) were cut using a Leica RM2265 microtome and placed on glass slides. For deparaffinization, hydration and staining of sections, the following steps were performed: slides were sequentially placed in xylene for three shifts (10 minutes each), 96% ethanol - 5 min, 90% ethanol - 2 min, 75% ethanol - 2 min, water - 5 min (three shifts), Congo red solution - 5 min, then potassium hydroxide solution and water were added. The ImMu-Mount medium (Thermo Scientific) was used for mounting. Sections covering the brain area from 0.48 to 1.92 mm relative to the midline in lateral stereotaxic coordinates (Franklin K., Paxinos, G. (2008). The Mouse Brain in Stereotaxic Coordinates. New York, NY: Academic Press), used to quantify congophilic amyloid plaques in the hippocampus. Every 15th section was analyzed, resulting in 10 sections per animal. Amyloid plaques were identified by Congo red staining and manually counted. For each group of mice, the mean values and standard deviation of the number of plaques per 1 section were calculated. The Shapiro-Wilk test was used to check the normality of the distribution. For pairwise comparison of the studied groups, the Mann-Whitney test was used. The applied significance level was 99.9% (P<0.001).
У контрольной группы мышей дикого типа (группа 1) никаких амилоидных бляшек обнаружено не было (Таблица 4). Конгофильные амилоидные бляшки, визуализированные в областях СА1, СА2, СА3 и зубчатой извилине гиппокампа головного мозга трансгенных животных были сходны по локализации и распределению размеров в паренхиме головного мозга. Однако, количественная оценка амилоидных бляшек выявила существенные различия между группами. В контрольной группе 2 (трансгенные мыши APP/PS1) среднее число бляшек в областях на один срез мозга (ЧБ) составляло ЧБ = 31,7 ± 4,9. В группе 3, где трангсенным мышам APP/PS1 вводили HAEE, ЧБ = 24,7 ± 3,4. В группе 4, в которой трансгенным мышам APP/PS1 вводили заявляемый магниевый комплекс, ЧБ = 8,1±2,8. Таким образом, результаты гистохимического анализа показали, что внутривенные инъекции магниевого комплекса приводили к почти 4-кратному уменьшению амилоидной нагрузки в гиппокампе трансгенных мышей APP/PS1, и по этому показателю эффективность магниевого комплекса примерно в три раза выше таковой, выявленной для HAEE.In the control group of wild-type mice (group 1), no amyloid plaques were found (Table 4). Congophilic amyloid plaques visualized in the areas of CA1, CA2, CA3 and the dentate gyrus of the brain hippocampus of transgenic animals were similar in localization and size distribution in the brain parenchyma. However, amyloid plaque quantification revealed significant differences between groups. In control group 2 (APP/PS1 transgenic mice), the mean number of plaques in areas per brain slice (BW) was BW = 31.7 ± 4.9. In group 3, where APP/PS1 transgenic mice were treated with HAEE, RR = 24.7 ± 3.4. In
Пример 4. Специфическое связывание магниевого комплекса пептида HAEE с человеческим бета-амилоидом (Aβ42). Example 4 Specific binding of the magnesium complex of the HAEE peptide to human beta-amyloid (Aβ42).
Дополнительно была проведена оценка связывания заявляемого магниевого комплекса с бета-амилоидом как одного из механизмов действия данного комплекса при нейродегенеративных поражениях, связанных с бета-амилоидом. Образование комплексов между находящимся в растворе аналитом (заявляемый магниевый комплекс или HAEE) и иммобилизованным 42-членным человеческим бета-амилоидом (лигандом) было исследовано с помощью БППР. По результатам таких экспериментов рассчитывали кинетические параметры взаимодействий и значение константы диссоциации (KD) взаимодействия магниевого и иммобилизованного лиганда. Если значение KD ≤ 10-4 М, то взаимодействие между магниевым комплексом и бета-амилоидом является биологически значимым. Additionally, the binding of the proposed magnesium complex with beta-amyloid was evaluated as one of the mechanisms of action of this complex in neurodegenerative lesions associated with beta-amyloid. The formation of complexes between an analyte in solution (inventive magnesium complex or HAEE) and immobilized 42-mer human beta-amyloid (ligand) was investigated using BPPR. Based on the results of such experiments, the kinetic parameters of interactions and the value of the dissociation constant (K D ) of the interaction between magnesium and immobilized ligand were calculated. If the value of K D ≤ 10 -4 M, then the interaction between the magnesium complex and beta-amyloid is biologically significant.
Взаимодействий между HAEE и лигандом обнаружено не было. Напротив, при введении магниевого комплекса пептида HAEE было обнаружено его взаимодействие с иммобилизованным Aβ42 при его различных концентрациях 150, 300, 500, 1000, 1500 мкМ. На основании полученных данных были рассчитаны кинетические характеристики взаимодействия магниевого комплекса пептида HAEE с иммобилизованным бета-амилоидом Aβ42: kon = (1,29±0,06) × 103 M-1s-1; koff = (5,42±0,06) × 10-3 s-1; KD = (4,2±0,3) ×10-6 М. Кинетические характеристики оставались в этих же значениях пределах погрешности при использовании магниевого комплекса с разным набором анионов – нитрат, ацетат, хлорид, глюконат, лактат, салицилат и др.No interactions between HAEE and the ligand were found. On the contrary, upon introduction of the magnesium complex of the HAEE peptide, its interaction with immobilized Aβ42 was found at various concentrations of 150, 300, 500, 1000, and 1500 μM. Based on the data obtained, the kinetic characteristics of the interaction of the magnesium complex of the HAEE peptide with the immobilized beta-amyloid Aβ42 were calculated: k on = (1.29±0.06) × 10 3 M -1 s -1 ; k off \u003d (5.42 ± 0.06) × 10 -3 s -1 ; K D \u003d (4.2 ± 0.3) × 10 -6 M. The kinetic characteristics remained within the same error limits when using a magnesium complex with a different set of anions - nitrate, acetate, chloride, gluconate, lactate, salicylate, etc.
Таким образом, на основании вышеприведенных результатов доказано образование стабильных межмолекулярных комплексов между 42-членным человеческим бета-амилоидом (Aβ42) и магниевым комплексом пептида HAEE. В отличие от магниевого комплекса пептида HAEE, нативный пептид HAEE в идентичных экспериментальных условиях не взаимодействует с Aβ42. Thus, based on the above results, the formation of stable intermolecular complexes between the 42-mer human beta-amyloid (Aβ42) and the magnesium complex of the HAEE peptide was proven. Unlike the magnesium complex of the HAEE peptide, the native HAEE peptide does not interact with Aβ42 under identical experimental conditions.
Полученные в данном Примере настоящего изобретения результаты указывают на отсутствие способности HAEE связываться с Aβ42. Напротив, магниевый комплекс пептида HAEE связывается с Aβ42. Несмотря на то, что и HAEE и заявляемый магниевый комплекс при введении в кровеносную систему трансгенных мышей APP/PS1 улучшают когнитивные функции и снижают количество амилоидных бляшек у экспериментальных животных (Примеры 3.1 и 3.2 настоящего изобретения), полученные результаты свидетельствует о различных молекулярных механизмах терапевтического воздействия HAEE и заявляемого магниевого комплекса, что, в свою очередь, исключает биоэквивалентность HAEE и заявляемого магниевого комплекса при их использовании для лечения нейродегенеративных заболеваний.The results obtained in this Example of the present invention indicate the absence of the ability of HAEE to contact Aβ42. In contrast, the magnesium complex of the HAEE peptide binds to Aβ42. Despite the fact that both HAEE and the claimed magnesium complex, when introduced into the circulatory system of APP/PS1 transgenic mice, improve cognitive functions and reduce the number of amyloid plaques in experimental animals (Examples 3.1 and 3.2 of the present invention), the results obtained indicate different molecular mechanisms of therapeutic effects. HAEE and the claimed magnesium complex, which, in turn, excludes the bioequivalence of HAEE and the claimed magnesium complex when used for the treatment of neurodegenerative diseases.
Таблица 1. Объемы реагентов для приготовления магниевых комплексов HAEE с различными анионами. Table 1. Volumes of reagents for the preparation of HAEE magnesium complexes with various anions.
Таблица 2. Смещение сигналов протонов в 1Н-ЯМР-спектре заявляемого магниевого комплекса по сравнению c HAEE.Table 2. Shift of proton signals in 1 H-NMR spectrum of the proposed magnesium complex compared to HAEE.
Таблица 3. Данные по стабильности магниевого комплекса пептида HAEE в тесте ускоренного хранения (40 °С, 75% влажности).Table 3. Data on the stability of the magnesium complex of the HAEE peptide in the accelerated storage test (40°C, 75% humidity).
Таблица 4. Состав фармацевтических композиций с магниевым комплексом пептида HAEE. В/м – внутримышечное введение, в/в – внутривенное введение.Table 4. Composition of pharmaceutical compositions with the magnesium complex of the HAEE peptide. In / m - intramuscular injection, in / in - intravenous administration.
повидон К 17 – 0,1 мгmannitol - 0.1 mg
povidone K 17 - 0.1 mg
повидон К 17 – 1 мгmannitol -1 mg
povidone K 17 - 1 mg
повидон К 17 – 17 мгmannitol -10 mg
povidone K 17 - 17
повидон К 17 – 104 мгmannitol -100 mg
povidone K 17 - 104
вода до 100%a set of salts to maintain an osmotic pressure of 290-310 mOsm/l,
water up to 100%
0,1 М раствор натрия гидроксида - до pH 5,0 - 7,5
вода – до 100%0.9% - sodium chloride
0.1 M sodium hydroxide solution - up to pH 5.0 - 7.5
water - up to 100%
0,1 М раствор хлористоводородной кислоты -до pH 5,0-7,5
вода – до 100%0.9% - sodium chloride
0.1 M hydrochloric acid solution - up to pH 5.0-7.5
water - up to 100%
регулятор pH до 5,5-7
сахароза – до 5%,
гистидин, полоксамер 407 – до 1%
вода – до 100%0.9% - sodium chloride,
pH regulator up to 5.5-7
sucrose - up to 5%,
histidine, poloxamer 407 - up to 1%
water - up to 100%
регулятор pH до 5,5-7,5
вода – до 100%0.9% - sodium chloride,
pH regulator up to 5.5-7.5
water - up to 100%
трометамол – 12 мг;
динатрия эдетат - 1 мг
вода – до 100%mannitol - 0.5 mg;
trometamol - 12 mg;
disodium edetate - 1 mg
water - up to 100%
Таблица 5. Влияние магниевого комплекса пептида HAEE на когнитивные функции у мышей в тесте «закапывание шариков» и на количество амилоидных бляшек. Применяемый уровень значимости составлял 99,9% (P <0,001).Table 5. Effect of the magnesium complex of the HAEE peptide on cognitive function in mice in the "balloon" test and on the number of amyloid plaques. The applied significance level was 99.9% (P<0.001).
(побочные действия, гибель животных)-
(side effects, death of animals)
Claims (29)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/RU2023/000213 WO2024014986A1 (en) | 2022-07-15 | 2023-07-12 | Magnesium complex of haee peptide for treating neurodegenerative diseases |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| RU2784746C1 true RU2784746C1 (en) | 2022-11-29 |
Family
ID=
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012056157A1 (en) * | 2010-10-27 | 2012-05-03 | Kimonella Ventures Ltd | Peptide compound useful for inhibiting amyloid plaque formation |
| RU2679080C1 (en) * | 2018-04-17 | 2019-02-05 | Александр Олегович Морозов | Peptide and method of treatment of alzheimer's disease |
| RU2709539C1 (en) * | 2019-08-15 | 2019-12-18 | Акционерное общество "Опытно-Экспериментальный завод "ВладМиВа" | Pharmaceutical composition based on haee peptide for treating neurodegenerative diseases |
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012056157A1 (en) * | 2010-10-27 | 2012-05-03 | Kimonella Ventures Ltd | Peptide compound useful for inhibiting amyloid plaque formation |
| RU2679080C1 (en) * | 2018-04-17 | 2019-02-05 | Александр Олегович Морозов | Peptide and method of treatment of alzheimer's disease |
| RU2709539C1 (en) * | 2019-08-15 | 2019-12-18 | Акционерное общество "Опытно-Экспериментальный завод "ВладМиВа" | Pharmaceutical composition based on haee peptide for treating neurodegenerative diseases |
Non-Patent Citations (1)
| Title |
|---|
| TSVETKOV P. O. et al, Peripherally Applied Synthetic Tetrapeptides HAEE and RADD Slow Down the Development of Cerebral β-Amyloidosis in AβPP/PS1 Transgenic Mice, Journal of Alzheimer's Disease, 2015, v. 46, no. 4, p. 849-853. * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9790262B2 (en) | Compositions comprising glucagon analogs and methods of making and using the same | |
| US20150099699A1 (en) | Conjugates of insulin-like growth factor-1 and poly(ethylene glycol) | |
| US20060263849A1 (en) | Glucagon-like peptide-1 analogs | |
| JP5893614B2 (en) | Compounds and methods for the treatment of Alzheimer's disease and familial dementia | |
| US20140296164A1 (en) | Compositions and methods of use for cell targeted inhibitors of the Cystic Fibrosis transmembrane regulator associated ligand | |
| WO2011094671A2 (en) | N-terminally conjugated polypeptides for targeted therapy and diagnosis | |
| US10800812B2 (en) | Compstatin analogs with increased solubility and improved pharmacokinetic properties | |
| US9675679B2 (en) | Vaccines and methods for controlling adiposity | |
| JP4079775B2 (en) | Soluble cyclic analog of β-amyloid peptide | |
| RU2784746C1 (en) | Haee peptide magnesium complex for the treatment of neurodegenerative diseases | |
| RU2785354C1 (en) | Peptide calcium complex for the treatment of neurodegenerative diseases | |
| RU2784319C1 (en) | Haee peptide zinc complex for the treatment of neurodegenerative diseases | |
| RU2784732C1 (en) | Haee peptide copper complex for the treatment of neurodegenerative diseases | |
| JP5801206B2 (en) | Compounds and methods for the treatment of Alzheimer's disease | |
| JP2023552824A (en) | Peptide therapeutics for treating Alzheimer's disease and related conditions | |
| RU2784326C1 (en) | Sodium salt of haee peptide for the treatment of neurodegenerative diseases | |
| RU2784425C1 (en) | Potassium salt of haee peptide for the treatment of neurodegenerative diseases | |
| RU2784249C1 (en) | Ammonium salt of haee peptide for the treatment of neurodegenerative diseases | |
| WO2024014985A1 (en) | Calcium complex of haee peptide for treating neurodegenerative diseases | |
| WO2024014983A1 (en) | Zinc complex of haee peptide for treating neurodegenerative diseases | |
| WO2024014986A1 (en) | Magnesium complex of haee peptide for treating neurodegenerative diseases | |
| WO2024014982A1 (en) | Copper complex of haee peptide for treating neurodegenerative diseases | |
| EP1481007B1 (en) | Spheron components useful in determining compounds capable of treating symptoms of alzheimer's disease, treatments and animal models produced therefrom | |
| WO2024014981A1 (en) | Sodium salt of haee peptide for treating neurodegenerative diseases | |
| US11771772B2 (en) | Glycemic control using intrinsic factor bound to a vitamin B12 conjugate of a glucagon-like peptide-1 receptor agonist |