NL1016803C2 - Use of dishwashing compositions. - Google Patents
Use of dishwashing compositions. Download PDFInfo
- Publication number
- NL1016803C2 NL1016803C2 NL1016803A NL1016803A NL1016803C2 NL 1016803 C2 NL1016803 C2 NL 1016803C2 NL 1016803 A NL1016803 A NL 1016803A NL 1016803 A NL1016803 A NL 1016803A NL 1016803 C2 NL1016803 C2 NL 1016803C2
- Authority
- NL
- Netherlands
- Prior art keywords
- tablet
- acid
- weight
- area
- water
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D17/00—Detergent materials or soaps characterised by their shape or physical properties
- C11D17/0047—Detergents in the form of bars or tablets
- C11D17/0065—Solid detergents containing builders
- C11D17/0073—Tablets
- C11D17/0078—Multilayered tablets
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D17/00—Detergent materials or soaps characterised by their shape or physical properties
- C11D17/0047—Detergents in the form of bars or tablets
- C11D17/0065—Solid detergents containing builders
- C11D17/0073—Tablets
- C11D17/0091—Dishwashing tablets
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Wood Science & Technology (AREA)
- Organic Chemistry (AREA)
- Detergent Compositions (AREA)
- Table Devices Or Equipment (AREA)
Abstract
Description
55
Gebruik van vaatwassamenstellingen.Use of dishwashing compositions.
Beschrijving Technisch gebiedDescription Technical area
De onderhavige uitvinding heeft betrekking op het 10 gebied van machinaal vaatwassen. Meer in het bijzonder heeft de uitvinding betrekking op een werkwijze voor het gebruik van tabletten voor automatisch vaatwassen.The present invention relates to the field of machine dishwashing. More particularly, the invention relates to a method of using automatic dishwashing tablets.
Achtergrond van de uitvinding 15 Het afwassen van artikelen in een in de handel ver krijgbare · vaatwasmachine omvat gebruikmaking van drie soorten producten. Er wordt zout aan het zout-compartiment toegevoegd om het water zachter te maken, er wordt een vaat-wasformulering gebruikt om de artikelen schoon te maken en 20 er wordt een spoelhulpmiddel gebruikt om te verzekeren dat de artikelen zonder strepen of vlekken gespoeld worden.Background of the Invention Dishwashing items in a commercial dishwasher includes use of three types of products. Salt is added to the salt compartment to soften the water, a dishwashing formulation is used to clean the items and a rinse aid is used to ensure that the items are rinsed without streaks or stains.
De gebruikers vinden het lastig het zout en het spoelhulpmiddel in een vaatwasmachine te vervangen. De onderhavige uitvinding heeft betrekking op een werkwijze 25 voor het vaatwassen die het zout en het spoelhulpmiddel bij het machinaal vaatwassen overbodig maakt.Users find it difficult to replace the salt and rinse aid in a dishwasher. The present invention relates to a dishwashing method which makes the salt and rinse aid unnecessary in machine dishwashing.
Beschrijving van de uitvindingDescription of the invention
Dienovereenkomstig voorziet de onderhavige uitvinding 30 in het gebruik van een tablet voor machinaal vaatwassen bij een werkwijze voor het vaatwassen waarbij geen spoelhulpmiddel en geen zout in de machine wordt gebruikt, waarbij de tablet meer dan 45 gew.% vormingsmiddel omvat en een onderscheiden gedefinieerd gebied (A) heeft dat maximaal 30 35 gew.% van het totale gewicht van de tablet uitmaakt, waarbij het onderscheiden gedefinieerde gebied (A) een materiaal omvat dat het oplossen van het gebied (A) in water regelt.Accordingly, the present invention provides for the use of a machine dishwashing tablet in a dishwashing method in which no rinse aid and no salt are used in the machine, the tablet comprising more than 45% by weight of forming agent and a distinct defined range ( A) has a maximum of 35 wt% of the total weight of the tablet, the distinct defined area (A) comprising a material that controls the dissolution of the area (A) in water.
1016803 21016803 2
Bovendien wordt in de onderhavige aanvrage een werkwijze voor het afwassen van artikelen in een mechanische wasmachine gedefinieerd, welke werkwijze de stappen omvat van: 5 i) het behandelen van de artikelen met een wasvloeistof waaraan een tablet wordt toegevoegd die meer dan 45 gew.% vormingsmiddel omvat en een afzonderlijk gedefinieerd gebied heeft dat maximaal 30 gew.% van het totale gewicht van de tablet uitmaakt, waarbij het 10 onderscheiden gedefinieerde gebied een materiaal omvat dat het oplossen ervan in water vertraagt en waarbij geen bijkomend spoelhulpmiddel en/of zout in de machine aanwezig is.In addition, in the present application, a method for washing articles in a mechanical washing machine is defined, which method comprises the steps of: i) treating the articles with a washing liquid to which a tablet is added containing more than 45% by weight of forming agent and has a separately defined area that constitutes up to 30% by weight of the total weight of the tablet, the distinguished defined area comprising a material which retards its dissolution in water and no additional rinse aid and / or salt in the machine is present.
In de context van de onderhavige uitvinding heeft de 15 uitdrukking "bijkomend spoelhulpmiddel of zout" betrekking op een afzonderlijk spoelhulpmiddel of zoutproduct dat geen deel van de tablet uitmaakt.In the context of the present invention, the term "additional rinse aid or salt" refers to a separate rinse aid or salt product that is not part of the tablet.
Ook heeft de uitvinding betrekking op een kit van delen die een zoals hiervoor beschreven reinigingsmiddelta-20 biet alsmede instructies omvat waarin wordt gesteld dat geen spoelhulpmiddel of zout aan de vaatwasmachine behoeft te worden toegevoegd.The invention also relates to a kit of parts comprising a cleaning agent as described above, as well as instructions stating that no rinse aid or salt needs to be added to the dishwasher.
Gedetailleerde beschrijving van de uitvinding 25 Tabletten volgens de uitvinding hebben twee gebieden, de gebieden A en B.Detailed description of the invention Tablets according to the invention have two areas, the areas A and B.
Gebied AArea A
Zoals hiervoor is beschreven, omvat de tablet een 30 gedefinieerd gebied (A) dat maximaal 30 gew.% van het totale gewicht van de tablet uitmaakt alsmede een materiaal dat het oplossen ervan in water regelt. Bij voorkeur is een materiaal aanwezig dat het oplossen van gebied A. vertraagt. Voor doeleinden van de uitvinding zal de rest van de tablet 35 gebied (B) genoemd worden. De bestanddelen van het gedefinieerde gebied (A) zullen na de bestanddelen in de rest van de tablet (B) aan het water in de machine worden Λ 015 8 01 3 afgegeven. In een ander aspect van de onderhavige uitvinding lost het gedefinieerde gebied (A) bij voorkeur op bij een temperatuur hoger dan 50°C en bij voorkeur hoger dan 60°C.As described above, the tablet comprises a defined region (A) which accounts for up to 30% by weight of the total weight of the tablet as well as a material that controls its dissolution in water. Preferably, a material is present which retards the dissolution of region A. For purposes of the invention, the remainder of the tablet will be referred to as region (B). The constituents of the defined area (A) will be delivered to the water in the machine after the constituents in the remainder of the tablet (B) Λ 015 8 01 3. In another aspect of the present invention, the defined region (A) preferably dissolves at a temperature above 50 ° C and preferably above 60 ° C.
De rest van de tablet (B) zal direct bij contact met water 5 beginnen op te lossen. Bij voorkeur lost voor gebied (B) ten minste 60%, met meer voorkeur ten minste 80% en het liefst ten minste 95% van gebied (B) binnen 12 minuten in gedemi-neraliseerd water bij 50°C op. Het verdient zeer de voorkeur dat gebied A vast is.The rest of the tablet (B) will begin to dissolve immediately on contact with water. Preferably for region (B), at least 60%, more preferably at least 80%, and most preferably at least 95% of region (B) dissolves in demineralized water at 50 ° C within 12 minutes. It is highly preferred that region A be solid.
10 Het oplossen van gebied (A) kan vertraagd worden door de keuze van deeltjesvormige bestanddelen die zijn ingekap-seld met een bestanddeel dat in water langzaam oplost of gedeeltelijk oplosbaar is. Dergelijke inkapselingsmaterialen omvatten celluloseacetaatftalaat (CAP), hydroxypropylmethyl-15 cellulose (HPMC), carboxymethylcellulose (CMC) en mengsels daarvan. Een hydroxypropylmethylcellulosepolymeer heeft bij voorkeur een naar het getal gemiddeld molecuulgewicht van 50.000 tot 200.000 en een viscositeit van een waterige oplossing van 2 gew.% bij 25°C (ADTMD2363) van 50.000 tot 20 120.000 cps. Een hydroxypropylmethylcellulosepolymeer dat bijzondere voorkeur geniet, is Methocel O J75MS-N met een viscositeit van een waterige oplossing van 2 gew.% bij 25°C van ca. 75.000 cps. Andere de voorkeur genietende inkapselingsmaterialen omvatten gelatine met een 25 bekledingsterkte in het bereik van 30 tot 200 en bij voorkeur 75 tot 200.Dissolution of region (A) can be delayed by the selection of particulate components encapsulated with a component that is slowly soluble in water or partially soluble. Such encapsulation materials include cellulose acetate phthalate (CAP), hydroxypropylmethyl-15 cellulose (HPMC), carboxymethyl cellulose (CMC) and mixtures thereof. A hydroxypropylmethylcellulose polymer preferably has a number average molecular weight of 50,000 to 200,000 and a viscosity of an aqueous solution of 2% by weight at 25 ° C (ADTMD2363) of 50,000 to 120,000 cps. A particularly preferred hydroxypropylmethylcellulose polymer is Methocel O J75MS-N with a viscosity of an aqueous solution of 2% by weight at 25 ° C of about 75,000 cps. Other preferred encapsulation materials include gelatin with a coating strength in the range of 30 to 200 and preferably 75 to 200.
De dikte van het inkapselingsmateriaal zal de oplos-singssnelheid van het ingekapselde reinigingsmiddelbestand-deel bepalen en derhalve de afgiftesnelheid van het reini- -30 gingsmiddelbestanddeel aan het waswater bepalen.The thickness of the encapsulating material will determine the rate of dissolution of the encapsulated detergent component and thus determine the rate of release of the detergent component to the wash water.
Een ander voorbeeld van een wijze waarop het oplossen van het deelgebied A vertraagd kan worden, is het voormengen van de reinigingsmiddelbestanddelen in een matrix, die in water langzaam oplost of gedeeltelijk oplosbaar is.Another example of a way in which the dissolution of the subarea A can be delayed is the premixing of the cleaning agent constituents in a matrix which is slowly dissolved in water or is partially soluble.
35 Voorkeurspolymeren hiervoor omvatten polyethyleenglycol met een molecuulgewicht van 1000 tot 20.000 en met meer voorkeur 1016803 4 4000 tot 10.000 of zelfs 12.000.Preferred polymers for this include polyethylene glycol with a molecular weight of 1000 to 20,000 and more preferably 1016803-4000 to 10,000 or even 12,000.
Nog een ander voorbeeld van een wijze waarop het oplossen van gebied A geregeld kan worden, is het bekleden van gebied A met een bekledingslaag. De bekledingslaag omvat 5 bij voorkeur een materiaal dat in bij voorkeur minder dan 15 minuten, met meer voorkeur minder dan 10 minuten, met nog meer voorkeur minder dan 5 minuten en het liefst minder dan 60 seconden bij contact met het gebied A vast wordt. Bij voorkeur is de bekledingslaag wateroplosbaar. Bekledinglagen 10 die de voorkeur genieten, omvatten materialen die zijn gekozen uit de groep die wordt gevormd door vetzuren, alcoholen, diolen, esters en ethers, adipinezuur, carbonzuren, dicarbonzuren, polyvinylacetaat (PVA), polyvi-nylpyrrolidon (PVP), polyazijnzuur (PLA), polyethyleenglycol 15 (PEG) en mengsels daarvan. Carbonzuren en dicarbonzuren die de voorkeur verdienen, omvatten bij voorkeur een even aantal koolstofatomen. Bij voorkeur omvatten de carbonzuren of dicarbonzuren ten minste 4, liever ten minste 6, nog liever ten minste 8 koolstofatomen en het liefst 8 tot 13 20 koolstofatomen. De voorkeur genietende dicarbonzuren omvatten adipinezuur, suberinezuur, azelaïnezuur, subacinezuur, undecaandizuur, dodecaandizuur, tridecaandizuur en mengsels daarvan. De voorkeur genieten die vetzuren, die een koolstofketenlengte van C12 tot C22 en het liefst C18 tot C22 25 hebben. De bekledingslaag kan eveneens bij voorkeur een verbrekingsmiddel omvatten.Yet another example of how the dissolution of region A can be controlled is to coat region A with a coating layer. The coating layer preferably comprises a material which solidifies in preferably less than 15 minutes, more preferably less than 10 minutes, even more preferably less than 5 minutes and most preferably less than 60 seconds upon contact with the region A. The coating layer is preferably water-soluble. Preferred coating layers 10 include materials selected from the group consisting of fatty acids, alcohols, diols, esters and ethers, adipic acid, carboxylic acids, dicarboxylic acids, polyvinyl acetate (PVA), polyvinyl pyrrolidone (PVP), polyacetic acid (PLA ), polyethylene glycol 15 (PEG) and mixtures thereof. Preferred carboxylic and dicarboxylic acids preferably include an even number of carbon atoms. Preferably, the carboxylic or dicarboxylic acids comprise at least 4, more preferably at least 6, even more preferably at least 8 carbon atoms, and most preferably 8 to 13 carbon atoms. Preferred dicarboxylic acids include adipic acid, suberic acid, azelaic acid, subacinic acid, undecanedioic acid, dodecanedioic acid, tridecanedioic acid and mixtures thereof. Preference is given to those fatty acids which have a carbon chain length of C12 to C22 and most preferably C18 to C22. The coating layer may also preferably comprise a breaking agent.
Geschikte bekledingen voor gebied A worden beschreven in WO 00/06684, JP 61-28440, JP 60-141705, JP 61-28441, JP 61-28596, JP 61-28597 en JP 61-28598.Suitable coatings for area A are described in WO 00/06684, JP 61-28440, JP 60-141705, JP 61-28441, JP 61-28596, JP 61-28597 and JP 61-28598.
30 Indien aanwezig omvat de bekledingslaag in het alge meen een niveau van ten minste 0,05%, bij voorkeur ten minste 0,1%, met meer voorkeur ten minste 1% en met de meeste voorkeur ten minste 2% of zelfs ten minste % van de -reinigingsmiddeltablet.When present, the coating layer generally comprises a level of at least 0.05%, preferably at least 0.1%, more preferably at least 1%, and most preferably at least 2% or even at least% of the detergent tablet.
35 De bekleding kan worden gebruikt om gebied A aan gebied B te binden.The coating can be used to bond area A to area B.
In weer een ander voorbeeld is gebied A zodanig, dat 1016803 5 het ten minste een bestanddeel omvat dat reageert met een uitwendige stimulus, zoals de temperatuur en de pH, om het oplossen te laten beginnen. Een voorbeeld van een bestanddeel dat het oplossen doet beginnen als reactie op een 5 verandering van de temperatuur is een was. In het bijzonder wordt beoogd dat een geschikte was een smelttemperatuur hoger dan de kamertemperatuur, bij voorkeur hoger dan 40°C, liever hoger dan 50°C en het liefst hoger dan 55°C zal hebben.In yet another example, region A is such that it comprises at least one component that reacts with an external stimulus, such as temperature and pH, to start dissolution. An example of an ingredient that initiates dissolution in response to a temperature change is a wax. In particular, it is contemplated that a suitable wax will have a melting temperature above the room temperature, preferably above 40 ° C, more preferably above 50 ° C, and most preferably above 55 ° C.
10 Het heeft de voorkeur als gebied A in de tablet aanwezig is.It is preferable if region A is present in the tablet.
Een voor de onderhavige uitvinding bruikbaar gebied A kan verder een wateroplosbaar zuurvormend middel of zout omvatten, bij voorkeur organische zuren met inbegrip van 15 bijvoorbeeld carbonzuren, zoals citroenzuur en barnsteen-zuur, polycarbonzuren, zoals polyacrylzuur, alsmede azijnzuur, boorzuur, malonzuur, adipinezuur, fumaarzuur, melkzuur, glycolzuur, wijnsteenzuur, tartronzuur, maleïnezuur, derivaten en mengsels daarvan.A region A useful for the present invention may further comprise a water-soluble acid-forming agent or salt, preferably organic acids including, for example, carboxylic acids, such as citric acid and succinic acid, polycarboxylic acids, such as polyacrylic acid, as well as acetic acid, boric acid, malonic acid, adipic acid, fumaric, lactic, glycolic, tartaric, tartronic, maleic, derivatives and mixtures thereof.
20 Geschikte wateroplosbare monomere of oligomere car- boxylaat-vormende middelen kunnen uit een breed bereik van verbindingen worden gekozen, maar dergelijke verbindingen hebben bij voorkeur een logaritmische zuurconstante van de eerste carboxylgroep (pKi) kleiner dan 9, bij voorkeur 25 tussen 2 en 8,5 en met meer voorkeur tussen 2,5 en 7,5.Suitable water-soluble monomeric or oligomeric carboxylate-forming agents can be selected from a wide range of compounds, but such compounds preferably have a logarithmic acid constant of the first carboxyl group (pKi) less than 9, preferably between 2 and 8, 5 and more preferably between 2.5 and 7.5.
Het carboxylaat- of polycarboxylaat-vormende middel kan van een monomeer of oligomeer type zijn, hoewel monomere polycarboxylaten in het algemeen vanwege de kosten en werking de voorkeur genieten. Monomere en oligomere vormende 30 middelen kunnen uit acyclische, alicyclische, heterocyclische en aromatische carboxylaten worden gekozen.The carboxylate or polycarboxylate forming agent can be of a monomer or oligomer type, although monomeric polycarboxylates are generally preferred for cost and performance. Monomeric and oligomeric forming agents can be selected from acyclic, alicyclic, heterocyclic and aromatic carboxylates.
Geschikte carboxylaten die één carboxylgroep bevatten, omvatten wateroplosbare zouten van melkzuur, glycolzuur en etherderivaten daarvan. Polycarboxylaten die twee 35 carboxylgroepen bevatten, omvatten wateroplosbare zouten van barnsteenzuur, malonzuur, (ethyleendioxy)diazijnzuur, maleïnezuur, diglycolzuur, wijnsteenzuur, tartronzuur en 1016803 6 fumaarzuur alsmede ethercarboxylaten en sulfinylcarboxyla-ten. Polycarboxylaten die drie carboxylgroepen bevatten, omvatten in het bijzonder wateroplosbare citraten, aconi-traten en citraconaten alsmede succinaatderivaten zoals 5 carboxymethyloxysuccinaten, lactoxysuccinaten en aminosuc-cinaten, en ook oxypolycarboxylaten zoals 20-oxa-l,1,3-propaantricarboxylaten. De hiervoor beschreven carboxylaat-of polycarboxylaat-vormende verbindingen kunnen eveneens een tweeledige functie als regelmiddelen voor de pH hebben.Suitable carboxylates containing one carboxyl group include water-soluble salts of lactic acid, glycolic acid and ether derivatives thereof. Polycarboxylates containing two carboxyl groups include water-soluble salts of succinic acid, malonic acid, (ethylenedioxy) diacetic acid, maleic acid, diglycolic acid, tartaric acid, tartronic acid and fumaric acid, as well as ether carboxylates and sulfinyl carboxylates. Polycarboxylates containing three carboxyl groups include, in particular, water-soluble citrates, acetates and citraconates as well as succinate derivatives such as 5-carboxymethyl oxysuccinates, lactoxysuccinates and amino succinates, and also oxypolycarboxylates such as 20-oxa-1,3-propanantric. The above-described carboxylate or polycarboxylate-forming compounds may also have a dual function as pH control agents.
10 Polycarboxylaten die vier carboxylgroepen bevatten, omvatten oxydisuccinaten, 1,1,2,2-ethaantetracarboxylaten, 1,1,3,3-propaantetracarboxylaten en 1,1,2,3-propaantetra-carboxylaten. Sulfosubstituenten bevattende polycarboxylaten omvatten sulfosuccinaatderivaten alsmede sulfonhoudende 15 gepyrolyseerde citraten.Polycarboxylates containing four carboxyl groups include oxydisuccinates, 1,1,2,2-ethane tetracarboxylates, 1,1,3,3-propane tetracarboxylates and 1,1,2,3-propane tetracarboxylates. Sulfo substituents containing polycarboxylates include sulfosuccinate derivatives as well as sulfone-containing pyrolysed citrates.
Alic-yclische en heterocyclische polycarboxylaten omvatten cyclopentaan-cis,cis,cis-tetracarboxylaten cyclo-pentadienide-pentacarboxylaten, 2,3,4,5-tetrahydrofuran- cis,cis,cis-tetracarboxylaten, 2,5-tetrahydrofuran-cis- 20 dicarboxylaten, 2,2,5,5-tetrahydrofuran-tetracarboxylaten, 1,2,3,4,5,6-hexaan-hexacarboxylaten en carboxymethylderivaten van polyhydrische alcoholen zoals sorbitol, mannitol en xylitol. Aromatische polycarboxylaten omvatten mellitine-zuur, pyromellitinezuur en de ftaalzuurderivaten die zijn 25 beschreven in het Britse octrooi no. 1.425.343.Alicyclic and heterocyclic polycarboxylates include cyclopentane-cis, cis, cis-tetracarboxylates, cyclo-pentadienide pentacarboxylates, 2,3,4,5-tetrahydrofuran-cis, cis, cis-tetracarboxylates, 2,5-tetrahydrofuran-cis-dicaryl 2,2,5,5-tetrahydrofuran tetracarboxylates, 1,2,3,4,5,6-hexane-hexacarboxylates and carboxymethyl derivatives of polyhydric alcohols such as sorbitol, mannitol and xylitol. Aromatic polycarboxylates include mellitic acid, pyromellitic acid and the phthalic acid derivatives described in British Patent No. 1,425,343.
Van de bovengenoemde zijn polycarboxylaten die de voorkeur genieten hydroxycarboxylaten die maximaal drie carboxylgroepen per molecuul bevatten, meer in het bijzonder citraten en citroenzuur.Of the above, preferred polycarboxylates are hydroxycarboxylates containing up to three carboxyl groups per molecule, more particularly citrates and citric acid.
30 Ook de stamzuren van de monomere of oligomere poly- carboxylaat-chelaatvormende middelen of mengsels daarvan met hun zouten, b.v. citroenzuur of citraat/citroenzuur-mengsels worden als bestanddelen van vormingssystemen van fase A . volgens de onderhavige uitvinding beoogd.The stem acids of the monomeric or oligomeric polycarboxylate chelating agents or mixtures thereof with their salts, e.g. citric acid or citrate / citric acid mixtures are used as components of Stage A forming systems. according to the present invention.
35 In gebied A kan een aanslagwerend middel aanwezig zijn. Geschikte aanslagwerende middelen zijn EDHP (hydroxye-thyleen-1,1-difosfonaat) en Bayhibit (2-fosfonobutaan-l,2,4- 1016803 7 tricarbonzuur) en ook geschikt zijn polymeren zoals Alcosperse 240 zoals in US 5.956.855 en US 5.547.612 wordt beschreven. Als alternatief kunnen ook polymeren en copoly-meren van acrylzuur met een molecuulgewicht tussen 500 en 5 20.000 worden gebruikt. Aanslagwerende middelen zijn in zodanige niveaus aanwezig, dat 1-100 dpm bij een spoeling van 5 liter wordt afgegeven.35 An anti-tarnishing agent may be present in area A. Suitable anti-scaling agents are EDHP (hydroxyethyl-1,1-diphosphonate) and Bayhibit (2-phosphonobutane-1,2,4-1016803-7 tricarboxylic acid) and also suitable polymers such as Alcosperse 240 as in US 5,956,855 and US 5,547 .612 is described. Alternatively, polymers and copolymers of acrylic acid with a molecular weight between 500 and 20,000 can also be used. Anti-scale agents are present in levels such that 1-100 ppm is released with a 5 liter flush.
Bij voorkeur is in gebied A een oppervlakte-actief-middelsysteem aanwezig dat een oppervlakte-actief middel 10 omvat dat uit niet-ionische, anionische, kationische, amfolytische en zwitterionische oppervlakte-actieve middelen alsmede mengsels daarvan is gekozen.Preferably, in region A there is a surfactant system comprising a surfactant selected from nonionic, anionic, cationic, ampholytic and zwitterionic surfactants as well as mixtures thereof.
Het oppervlakte-actiefmiddelsysteem omvat met de meeste voorkeur een gering schuimend niet-ionisch oppervlak-15 te-actief middel dat is gekozen voor het bevochtigende vermogen en bij voorkeur is gekozen uit ethoxygroepen en/of propoxygroepen houdende niet-ionische oppervlakte-actieve middelen en met meer voorkeur is gekozen uit niet-ionische ethoxy/propoxy-vetalcoholen als oppervlakte-actieve midde-20 len.Most preferably, the surfactant system comprises a low foaming non-ionic surfactant selected for the wetting ability and is preferably selected from ethoxy groups and / or propoxy groups containing nonionic surfactants and with more preferred is selected from nonionic ethoxy / propoxy fatty alcohols as surfactants.
Het oppervlakte-actiefmiddelsysteem is gewoonlijk in gebied A aanwezig bij een minimaal niveau van 0,05 g en met meer voorkeur bij een minimaal niveau van 0,1 g. Het maximale voorkeursniveau ligt bij voorkeur bij 0,8 g of lager en 25 liever bij 0,6 g of lager. Het niveau dat de meeste voorkeur geniet, is 0,2 g tot 0,4 g. Het verdient zeer de voorkeur dat het niveau aan oppervlakte-actief middel, in het bijzonder niet-ionisch oppervlakte-actief middel, 25 gew.% tot 75 gew.% ten opzichte van het totale gewicht van het 30 niet-ionische oppervlakte-actieve middel in de tablet bedraagt.The surfactant system is usually present in region A at a minimum level of 0.05 g, and more preferably at a minimum level of 0.1 g. The maximum preferred level is preferably 0.8 g or less, more preferably 0.6 g or less. The most preferred level is 0.2 g to 0.4 g. It is most preferred that the level of surfactant, especially non-ionic surfactant, is 25 wt% to 75 wt% relative to the total weight of the non-ionic surfactant in the tablet.
Er kunnen hydrotrope middelen aanwezig zijn, waarbij deze gewoonlijk aanwezig zijn bij niveaus van 0,5 gew.% tot . 20 gew.% en bij voorkeur 1 gew.% tot 10 gew.%.Hydrotropic agents may be present, usually present at levels from 0.5 wt% to. 20 wt% and preferably 1 wt% to 10 wt%.
35 Bruikbare hydrotrope middelen omvatten natrium-, kalium- en ammonium-xyleensulfonaten, natrium-, kalium- en ammonium-tolueensulfonaat, natrium-, kalium- en ammonium- / 1 016803 8 cumeensulfonaat alsmede mengsels daarvan.Useful hydrotropic agents include sodium, potassium and ammonium xylene sulfonates, sodium, potassium and ammonium toluenesulfonate, sodium, potassium and ammonium cumene sulfonate as well as mixtures thereof.
In een zeer de voorkeur genietend aspect van de uitvinding zal gebied A een pH als 1%’s oplossing in gedestilleerd water bij 20°C lager dan 7, bij voorkeur 0,5 tot 5 6,5 en het liefst 0,5 tot 1,0 hebben.In a very preferred aspect of the invention, region A will have a pH as 1% solution in distilled water at 20 ° C less than 7, preferably 0.5 to 6.5, and most preferably 0.5 to 1 , Have 0.
Gebied BArea B
Vormend materiaalForming material
Een samenstelling volgens de uitvinding kan een 10 vormend middel bevatten. Het vormende middel kan een fosfaat- of niet-fosfaathoudend vormend middel zijn.A composition according to the invention can contain a forming agent. The forming agent can be a phosphate or non-phosphate containing agent.
Samenstellingen volgens de uitvinding die een wateroplosbaar fosfaat-vormend middel omvatten, bevatten gewoonlijk dit vormende middel bij een niveau van 50 tot 90 gew.% 15 en bij voorkeur 55 tot 80 gew.%.Compositions of the invention comprising a water-soluble phosphate-forming agent usually contain this forming agent at a level of 50 to 90% by weight, and preferably 55 to 80% by weight.
Bijzondere voorkeur genieten fosfaat-vormende middelen. Specifieke voorbeelden van wateroplosbare fosfaat-vormende middelen zijn alkalimetaaltripolyfosfaten, natrium-, kalium- en ammoniumpyrofosfaat, natrium-, kalium- en 20 arnmoniumorthofosfaat, natrium-polymeta/fosfaat waarbij de polymerisatiegraad in het bereik van 6 tot 21 ligt alsmede zouten van fytinezuur. Natrium- of kalium-tripolyfosfaat geniet de meeste voorkeur.Phosphate-forming agents are particularly preferred. Specific examples of water-soluble phosphate-forming agents are alkali metal tripolyphosphates, sodium, potassium and ammonium pyrophosphate, sodium, potassium and ammonium orthophosphate, sodium polymeta / phosphate with the degree of polymerization ranging from 6 to 21, and salts of phytic acid. Most preferred is sodium or potassium tripolyphosphate.
Samenstellingen volgens de uitvinding kunnen een 25 wateroplosbaar niet-fosfaat-vormend middel omvatten. Dit is gewoonlijk aanwezig in een niveau van 1 tot 90 gew.%, bij voorkeur 10 tot 80 gew.% en het liefst 20 tot 70 gew.% ten opzichte van het gewicht van de samenstelling. Geschikte voorbeelden van niet-fosforhoudende anorganische vormende 30 middelen omvatten wateroplosbare alkalimetaalcarbonaten, -waterstofcarbonaten, -sesquicarbonaten, -boraten, -silicaten met inbegrip van gelaagde silicaten zoals SKS-6, b.v. Clarent, -metasilicaten en kristallijne en amorfe alumino- -silicaten. Specifieke voorbeelden omvatten natriumcarbonaat 35 (met of zonder calciet-kiemen), kaliumcarbonaat, natrium- en kaliumwaterstofcarbonaat, silicaten met inbegrip van gelaagde silicaten en zeolieten.Compositions according to the invention can comprise a water-soluble non-phosphate-forming agent. This is usually present at a level of 1 to 90% by weight, preferably 10 to 80% by weight and most preferably 20 to 70% by weight relative to the weight of the composition. Suitable examples of non-phosphorus-containing inorganic forming agents include water-soluble alkali metal carbonates, hydrogen carbonates, sesquicarbonates, borates, silicates including layered silicates such as SKS-6, e.g. Clarent, metasilicates and crystalline and amorphous alumino silicates. Specific examples include sodium carbonate (with or without calcite seed), potassium carbonate, sodium and potassium hydrogen carbonate, silicates including layered silicates and zeolites.
1 016 8 0 3 91 016 8 0 3 9
Organische reinigingsmiddelvormende middelen kunnen eveneens als niet-fosfaathoudende vormende middelen volgens de onderhavige uitvinding worden gebruikt. Voorbeelden van organische vormende middelen omvatten alkalimetaalcitraten, 5 -succinaten, -malonaten, -vetzuursulfonaten, -vetzuurcar- boxylaten, -nitrilotriacetaten, -oxydisuccinaten, -alkyl- en -alkenyldisuccinaten, -oxydiacetaten, -carboxymethyl-oxysuccinaten, -ethyleendiaminetetra-acetaten, -tartraat-monosuccinaten, -tartraat-disuccinaten, -tartraat-monoace-10 taten, -tartraat-diacetaten, geoxideerd zetmeel, geoxideerde heteropolymere polysachariden, polyhydroxysulfonaten, polycarboxylaten zoals polyacrylaten, polymaleaten, polya-cetaten, polyhydroxyacrylaten, polyacrylaat/polymaleaat- en polyacrylaat/polymethacrylaat-copolymeren, acrylaat/male-15 aat/vinylalcohol-terpolymeren, aminopolycarboxylaten en polyacetaalcarboxylaten, alsmede polyaspartaten en mengsels daarvan. Dergelijke carboxylaten worden beschreven in de US-octrooien nos. 4.144.226, 4.146.495 en 4.686.062. Alkalime-taalcitraten, nitrilotriacetaten, oxydisuccinaten, 20 acryaat/maleaat-copolymeren en acrylaat/maleaat/vinylalco- hol-tertpolymeren zijn bijzondere voorkeur genietende niet-fosfaathoudende vormende middelen.Organic detergent-forming agents can also be used as non-phosphate-containing forming agents of the present invention. Examples of organic forming agents include alkali metal citrates, 5-succinates, malonates, fatty acid sulfonates, fatty acid carboxylates, nitrilotriacetates, oxydisuccinates, alkyl and alkenyl disuccinates, oxydiacetates, carboxymethyl-oxysuccinates, acetyl-oxysuccinates tartrate monosuccinates, tartrate disuccinates, tartrate monoacetates, tartrate diacetates, oxidized starch, oxidized heteropolymeric polysaccharides, polyhydroxysulfonates such as polyacrylate / polyacrylate / polyacrylate / polyacrylates, polyhydric acrylates, polyhydric acrylates polymethacrylate copolymers, acrylate / maleate / vinyl alcohol terpolymers, aminopolycarboxylates and polyacetal carboxylates, as well as polyaspartates and mixtures thereof. Such carboxylates are described in U.S. Pat. Nos. 4,144,226, 4,146,495 and 4,686,062. Alkali language citrates, nitrilotriacetates, oxydisuccinates, acrylate / maleate copolymers, and acrylate / maleate / vinyl alcohol tert polymers are particularly preferred nonphosphate-forming agents.
Silicjurnoxide-materiaal 25 Geschikte vormen van siliciumoxide omvatten amorf siliciumoxide, zoals geprecipiteerd siliciumoxide, pyrogeen siliciumoxide en siliciumoxide-gelen, zoals -hydrogelen, -xerogelen en -aërogelen, of de zuivere kristalvormen kwarts, tridymiet en kristobaliet, maar de amorfe vormen van 30 siliciumoxide genieten de voorkeur. Geschikte siliciumoxiden kunnen gemakkelijk in de handel verkregen worden. Ze worden bijvoorbeeld onder de geregistreerde handelsnaam Gasil 200 (b.v. Crosfield, GB) verkocht.Silicon oxide material Suitable forms of silicon oxide include amorphous silicon oxide, such as precipitated silica, pyrogenic silica and silica gels, such as -hydrogels, xerogels and aerogels, or the pure crystal forms of quartz, tridymite and cryobalite, but the amorphous forms of silicon oxide are preferred. Suitable silicon oxides are readily available commercially. For example, they are sold under the registered trade name Gasil 200 (e.g. Crosfield, GB).
Bij voorkeur is het siliciumoxide in het product in 35 een zodanige vorm aanwezig, dat het kan oplossen wanneer het aan de wasvloeistof wordt toegevoegd. Daarom geniet toevoeging van siliciumoxide als toevoeging van schuimwerende 1016803 10 siliciumoxidedeeltjes en siliconenolie geen voorkeur.Preferably, the silicon oxide in the product is present in such a form that it can dissolve when added to the washing liquid. Therefore, the addition of silicon oxide as the addition of anti-foam 1016803 silicon oxide particles and silicone oil is not preferred.
De deeltjesgrootte van het siliciumoxide-materiaal volgens de onderhavige uitvinding kan van belang zijn, in het bijzonder aangezien men gelooft dat enig siliciumoxide-5 materiaal dat bij de wasprocedure niet-opgelost blijft, zich in een later stadium op het glas kan afzetten.The particle size of the silica material of the present invention may be of interest, especially since it is believed that any silica material that remains undissolved in the washing procedure can deposit on the glass at a later stage.
Derhalve geniet het de voorkeur dat een silicium-oxide-materiaal wordt gebruikt met een deeltjesgrootte (zoals bepaald met een Malvern-laser, d.w.z. de "geaggre-10 geerde" deeltjesgrootte) van maximaal 40 pm en met de meeste voorkeur maximaal 20 μιτι, waarbij betere wasresultaten worden verkregen. Met het oog op toevoeging aan een reini-gingssamenstelling geniet het de voorkeur dat de deeltjesgrootte van het siliciumoxide-materiaal ten minste 1 μτη, met 15 meer voorkeur ten minste 2 pm en het liefst ten minste 5 μπι bedraagt.Therefore, it is preferred that a silicon oxide material be used with a particle size (as determined by a Malvern laser, ie, the "aggregated" particle size) of up to 40 µm and most preferably up to 20 µm, with better washing results are obtained. In view of addition to a cleaning composition, it is preferred that the particle size of the silica material is at least 1 µm, more preferably at least 2 µm, and most preferably at least 5 µm.
Bij voorkeur is de primaire deeltjesgrootte van het siliciumoxide in het algemeen kleiner dan ca. 30 nm en in het bijzonder kleiner dan ca. 25 nm. Bij voorkeur is de 20 elementaire deeltjesgrootte kleiner dan 20 nm of zelfs 10 nm. Er is geen kritieke ondergrens voor de elementaire deeltjesgrootte: de ondergrens wordt bepaald door andere factoren zoals de bereidingswijze, enz. In het algemeen hebben in de handel verkrijgbare siliciumoxiden een elemen-25 taire deeltjesgrootte van 1 nm of meer.Preferably, the primary particle size of the silicon oxide is generally less than about 30 nm and in particular less than about 25 nm. Preferably, the elementary particle size is less than 20 nm or even 10 nm. There is no critical lower limit for the elementary particle size: the lower limit is determined by other factors such as the method of preparation, etc. Generally, commercially available silicon oxides have an elementary particle size of 1 nm or more.
Bij voorkeur is het siliciumoxide-materiaal in de wasvloeistof aanwezig in een niveau van ten minste 2,5xl0-4 gew.%, met meer voorkeur ten minste 12,5xl0'4 gew.% en met de meeste voorkeur ten minste 2,5xl0'3 gew.% ten opzichte · 30 van het gewicht van de wasvloeistof en bij voorkeur maximaal lxlO-1 gew.%, met meer voorkeur maximaal 8xl0"2 gew.% en met de meeste voorkeur maximaal 5xl0~2 gew.% ten opzichte van het gewicht van de wasvloeistof.Preferably, the silica material is present in the washing liquid at a level of at least 2.5x10-4 wt%, more preferably at least 12.5x10 4 wt%, and most preferably at least 2.5x10 4 wt%. 3% by weight relative to the weight of the washing liquid and preferably maximum 1x10-1% by weight, more preferably maximum 8x10-10% by weight and most preferably maximum 5x10-10% by weight the weight of the washing liquid.
Bij voorkeur bedraagt het niveau aan opgelost silici-35 umoxide-materiaal in de wasvloeistof ten minste 80 dpm, liever ten minste 100 dpm en het liefst ten minste 120 dpm 016 8^3 11 en bij voorkeur maximaal 1000 dpm. Opgemerkt wordt dat opdat het siliciumoxide-materiaal effectief is, het laagste niveau van het opgeloste siliciumoxide-materiaal van de pH-waarde afhangt, d.w.z. dat derhalve bij pH=6,5 het niveau bij 5 voorkeur ten minste 100 dpm, bij pH=7,0 bij voorkeur ten minste 110 dpm, bij pH=7,5 bij voorkeur ten minste 120 dpm, bij pH=9,5 bij voorkeur ten minste 200 dpm, bij pH=10 bij voorkeur ten minste 300 dpm en bij pH=10,5 bij voorkeur ten minste 400 dpm bedraagt.Preferably, the level of dissolved silica-material in the washing liquid is at least 80 ppm, more preferably at least 100 ppm, and most preferably at least 120 ppm, and preferably at most 1000 ppm. It is noted that in order for the silica material to be effective, the lowest level of the dissolved silica material depends on the pH value, ie that at pH = 6.5 the level is preferably at least 100 ppm, at pH = 7 , Preferably at least 110 ppm, at pH = 7.5 preferably at least 120 ppm, at pH = 9.5 preferably at least 200 ppm, at pH = 10 preferably at least 300 ppm and at pH = 10 Is preferably at least 400 ppm.
10 Bij voorkeur is het siliciumoxide-materiaal in de reinigingssamenstelling aanwezig in een niveau van ten minste 0,1 gew.%, met meer voorkeur ten minste 0,5 gew.% en met de meeste voorkeur ten minste 1 gew.% ten opzichte van het gewicht van de reinigingssamenstelling en bij voorkeur 15 maximaal 10 gew.%, met meer voorkeur maximaal 8 gew.% en met de meeste· voorkeur maximaal 5 gew.% ten opzichte van het gewicht van de reinigingssamenstelling.Preferably, the silicon oxide material in the cleaning composition is present at a level of at least 0.1 wt%, more preferably at least 0.5 wt%, and most preferably at least 1 wt%, relative to the weight of the cleaning composition and preferably a maximum of 10% by weight, more preferably a maximum of 8% by weight and most preferably a maximum of 5% by weight, relative to the weight of the cleaning composition.
Silicaten 20 De samenstelling omvat optioneel alkalimetaalsilica- ten. Het alkalimetaal kan voorzien in een pH-regelend vermogen, in bescherming tegen corrosie van metalen en tegen aantasting van het vaatwerk, met inbegrip van voordelen voor porselein en glaswaren. Wanneer silicaten aanwezig zijn, 25 moet het SiC>2-gehalte 1 gew.% tot 25 gew.%, bij voorkeur 2 gew.% tot 20 gew.% en met meer voorkeur 3 gew.% tot 10 gew.% op basis van het gewicht van het ADD zijn. De verhouding van S1O2 ten opzichte van het alkalimetaaloxide (M20, waarin M=alkalimetaal) is gewoonlijk 1:3,5, bij voorkeur 1,6:3 en 30 met meer voorkeur 2:2,8. Bij voorkeur is het alkalimetaalsilicaat water bevattend, met 15% tot 25% en met meer voorkeur 17% tot 20% water.Silicates The composition optionally includes alkali metal silicates. The alkali metal can provide a pH adjusting ability, protection against corrosion of metals and deterioration of the dishes, including benefits for porcelain and glassware. When silicates are present, the SiC> 2 content should be 1 wt% to 25 wt%, preferably 2 wt% to 20 wt%, and more preferably 3 wt% to 10 wt% based on the weight of the ADD. The ratio of S1O2 to the alkali metal oxide (M20, where M = alkali metal) is usually 1: 3.5, preferably 1.6: 3, and more preferably 2: 2.8. Preferably, the alkali metal silicate is water-containing, from 15% to 25%, and more preferably 17% to 20%, water.
In het algemeen kunnen sterk alkalische alkalime-taalsilicaten worden gebruikt, hoewel minder alkalische 35 waterhoudende alkalimetaalsilicaten met een Si02/M20-ver-houding van 2,0 tot 2,4, zoals vermeld is, bijzonder veel voorkeur genieten. Watervrije vormen van alkalimetaalsilica- 1016803 12 ten met een Si02/M20-verhouding van 2,0 of meer genieten ook minder voorkeur omdat deze de neiging hebben aanzienlijk minder oplosbaar te zijn dan waterhoudende alkalime-taalsilicaten bij dezelfde verhouding.Generally, highly alkaline alkali metal silicates can be used, although less alkaline aqueous alkali metal silicates with an SiO 2 / M 2 O ratio of 2.0 to 2.4 as mentioned are particularly preferred. Anhydrous forms of alkali metal silicates with an SiO 2 / M 2 O ratio of 2.0 or more are also less preferred because they tend to be considerably less soluble than aqueous alkali metal silicates at the same ratio.
5 Natrium- en kalium- en in het bijzonder natriumsili- caten genieten de voorkeur. Een bijzondere voorkeur genietend alkalimetaalsilicaat is een granulair waterhoudend natriumsilicaat met een SiC>2/Na20-verhouding van 2,0 tot 2,4, dat onder de naam Britesil H20 en Britesil H24 bij de 10 firma PQ verkrijgbaar is. De meeste voorkeur verdient een granulair waterhoudend natriumsilicaat met een Si02/Na20-verhouding van 2,0. Hoewel gebruikelijke vormen, d.w.z. poeder en granulaten, van waterhoudende silicaatdeeltjes geschikt zijn, hebben silicaatdeeltjes die de voorkeur 15 genieten een gemiddelde deeltjesgrootte tussen 300 en 900 pm en is minder dan 40% kleiner 'dan 150 pm en minder dan 5% groter dan 1700 pm. Bijzondere voorkeur geniet een sili-caatdeeltje met een gemiddelde deeltjesgrootte tussen 400 en 700 pm en is minder dan 20% kleiner dan 150 pm en minder dan 20 1% groter dan 1700 pm. Samenstellingen volgens de onderhavige uitvinding met een pH van 9 of minder zullen bij voorkeur in hoofdzaak geen alkalimetaalsilicaat bevatten.Sodium and potassium and in particular sodium silicates are preferred. A particularly preferred alkali metal silicate is a granular hydrous sodium silicate with a SiC> 2 / Na 2 O ratio of 2.0 to 2.4, which is available from PQ under the name of Britesil H20 and Britesil H24. Most preferred is a granular aqueous sodium silicate with an SiO 2 / Na 2 O ratio of 2.0. While conventional forms, ie, powder and granules, of hydrous silicate particles are suitable, preferred silicate particles have an average particle size between 300 and 900 µm and are less than 40% less than 150 µm and less than 5% larger than 1700 µm . Particular preference is given to a silicate particle with an average particle size between 400 and 700 µm and is less than 20% less than 150 µm and less than 20% larger than 1700 µm. Preferably, compositions of the present invention having a pH of 9 or less will essentially contain no alkali metal silicate.
Enzymen 25 In samenstellingen volgens de uitvinding kunnen enzymen aanwezig zijn. Voorbeelden van enzymen die voor gebruik in reinigingssamenstellingen volgens de onderhavige uitvinding geschikt zijn, omvatten lipasen, peptidasen, amylasen (amilolytische enzymen) en andere enzymen die ' 30 biochemische verontreinigingen en vlekken die bij reini-gingssituaties worden aangetroffen, afbreken, modificeren of de afbraak of modificatie vergemakkelijken, zodat de verontreinigingen en vlekken gemakkelijker van het voorwerp dat wordt afgewassen worden verwijderd en de verontreinigingen 35 en vlekken beter bij een volgende reiningsstap kunnen worden verwijderd. Door zowel afbraak als modificatie kan het 1 016803 13 verwijderen van verontreiniging worden verbeterd.Enzymes Enzymes may be present in compositions of the invention. Examples of enzymes suitable for use in cleaning compositions of the present invention include lipases, peptidases, amylases (amilolytic enzymes) and other enzymes that break down, modify or degrade biochemical contaminants and stains found in cleaning situations or facilitate modification so that the contaminants and stains are more easily removed from the object being washed and the contaminants and stains are more easily removed in a subsequent cleaning step. The removal of contamination can be improved by both degradation and modification.
Welbekende en de voorkeur genietende voorbeelden van deze enzymen zijn lipasen, amylasen en proteasen. De meest algemeen in vaatwasmachinesamenstellingen gebruikte enzymen 5 zijn amylolytische enzymen. Bij voorkeur bevat een samenstelling volgens de uitvinding ook een proteolytisch enzym.Well-known and preferred examples of these enzymes are lipases, amylases and proteases. The most commonly used enzymes in dishwasher compositions are amylolytic enzymes. Preferably, a composition according to the invention also contains a proteolytic enzyme.
De enzymen kunnen aanwezig zijn bij een hoeveelheid in gew.% van 0,2 tot 7 gew.%. Voor amylolytische enzymen zal de eindsamenstelling een amylolytische activiteit van 102 tot 10 106 maltose-eenheden/kg hebben. Voor proteolytische enzymen zal de eindsamenstelling een proteolytische enzymactiviteit van 106 tot 109 glycine-eenheden/kg hebben.The enzymes can be present in an amount in weight percent from 0.2 to 7 weight percent. For amylolytic enzymes, the final composition will have an amylolytic activity of 102 to 106 maltose units / kg. For proteolytic enzymes, the final composition will have a proteolytic enzyme activity of 106 to 109 glycine units / kg.
Bleekmateriaal 15 Optioneel en bij voorkeur kunnen aan een samenstel ling voor gebruik bij werkwijzen volgens de onderhavige uitvinding bleekmaterialen worden toegevoegd. Deze materialen kunnen in de vaste vorm of in de vorm van ingekapselde materialen en met minder voorkeur in opgeloste vorm worden 20 toegevoegd.Bleaching Material Optionally and preferably bleaching materials can be added to a composition for use in methods of the present invention. These materials can be added in the solid form or in the form of encapsulated materials and less preferably in dissolved form.
Het bleekmateriaal kan een chloor of broom afgevend middel of een perzuurstofverbinding zijn. Bleekmaterialen op basis van perzuurstofverbindingen genieten evenwel de voorkeur.The bleaching material can be a chlorine or bromine releasing agent or a peroxygen compound. However, bleaching materials based on peroxygen compounds are preferred.
25 Organische peroxyzuren of voorloperproducten daarvan worden gewoonlijk als het bleekmateriaal gebruikt. Bij de onderhavige uitvinding bruikbare peroxyzuren zijn vaste en bij voorkeur in hoofdzaak in water niet-oplosbare verbindingen. Met "bij voorkeur in hoofdzaak in water niet-oplos-30 baar" wordt in de onderhavige beschrijving een oplosbaarheid in water lager dan ca. 1 gew.% bij omgevingstemperatuur bedoeld. In het algemeen zijn ten minste 7 koolstofatomen bevattende peroxyzuren voldoende onoplosbaar in.water voor -gebruik bij de onderhavige uitvinding.Organic peroxyacids or precursor products thereof are usually used as the bleaching material. Peroxyacids useful in the present invention are solid and preferably substantially water-insoluble compounds. By "preferably substantially water-insoluble" in the present specification is meant water solubility of less than about 1% by weight at ambient temperature. In general, at least 7 carbon atoms containing peroxyacids are sufficiently insoluble in water for use in the present invention.
35 Eveneens worden gebruikelijk anorganische perzuurstof vormende verbindingen als bleekmateriaal volgens de onderhavige uitvinding gebruikt. Voorbeelden van deze materialen 1016803 14 zijn monopersulfaat-, perboraat-monohydraat-, perboraat-te-trahydraat- en percarbonaatzouten.Also, conventional inorganic peroxygen-forming compounds are used as the bleaching material of the present invention. Examples of these materials are 101680314 monopersulfate, perborate monohydrate, perborate tetrahydrate and percarbonate salts.
Bij de onderhavige uitvinding bruikbare monoperoxyzu-ren omvatten alkylperoxyzuren en arylperoxyzuren zoals per-5 oxybenzoëzuur en in de ring gesubstitueerde peroxybenzoëzu-ren (b.v. peroxy-a-naftozuur), alifatische en gesubstitueerde alifatische monoperoxyzuren (b.v. peroxylaurinezuur en peroxystearinezuur), alsmede ftaloylamidoperoxycapronzuur (PAP).Monoperoxy acids useful in the present invention include alkyl peroxyacids and arylperoxyacids such as peroxybenzoic acid and ring-substituted peroxybenzoic acids (eg peroxy-a-naphthoic acid), aliphatic and substituted aliphatic monoperoxy acids (eg peroxylauric acid and peroxystearic acid) (as well as phthaloyloic acid) ).
10 Gebruikelijke bij de onderhavige uitvinding bruikbare diperoxyzuren omvatten alkyldiperoxyzuren en aryldiper-oxyzuren, zoals 1,12-diperoxydodecaandizuur (DPDA), 1,9- diperoxyazelainezuur, diperoxybrassylinezuur, diperoxyseba-cinezuur en diperoxyisoftaalzuur alsmede 2-decyldiperoxybu-15 taan-1,4-dizuur.Common diperoxy acids useful in the present invention include alkyl diperoxy acids and aryldiperoxy acids, such as 1,12-diperoxydodecanedioic acid (DPDA), 1,9-diperoxyazelaic acid, diperoxybrassylineic acid, diperoxysebicic acid and diperoxyisophthalic acid, as well as 2-decyldiperoxybutan-15-tane-15-tane-15 diacid.
In de techniek zijn peroxyzuur-bleekmiddelvoorloper-producten welbekend. Als niet-beperkende voorbeelden kunnen N,N,N',N'-tetra-acetylethyleendiamine (TAED), natrium-nonanoyloxybenzeensulfonaat (SNOBS), natrium-benzoyloxyben-20 zeensulfonaat (SBOBS) en het in US-A-4.751.015 beschreven kationische peroxyzuur-voorloperproduct (SPCC) worden genoemd.Peroxyacid bleach precursor products are well known in the art. As non-limiting examples, N, N, N ', N'-tetraacetylethylenediamine (TAED), sodium nonanoyloxybenzene sulfonate (SNOBS), sodium benzoyloxybenzene sulfonate (SBOBS) and the one described in US-A-4,751,015 cationic peroxyacid precursor product (SPCC).
Indien naar wens een bleekmiddelkatalysator, zoals het mangaancomplex, b.v. Mn-Me TACN, dat is beschreven in 25 EP-A-0.458.397 of de sulfoniminen volgens US-A-5.041.232 en US-A-5.047.163, toegevoegd moet worden, kan dit worden toegevoegd in de vorm van een tweede ingekapseld materiaal afzonderlijk van de bleekmiddelcapsule of -granule. Eveneens kunnen kobalt-katalysatoren gebruikt worden.If desired, a bleaching catalyst such as the manganese complex, e.g. Mn-Me TACN, which is described in EP-A-0.458.397 whether the sulfonimines according to US-A-5.041.232 and US-A-5.047.163 should be added, this can be added in the form of a second encapsulated material separately from the bleach capsule or granule. Cobalt catalysts can also be used.
30 Onder de geschikte reactieve oxidatiematerialen op basis van chloor of broom zijn heterocyclische N-broom- en N-chloorimiden zoals trichloorisocyanuurzuur, tribroomiso-cyanuurzuur, dibroomisocyanuurzuur en dichloorisocyanuurzuur alsmede zouten daarvan met kationen die deze verbindingen in 35 water doen oplossen, zoals kalium- en natrium-kationen.Among the suitable reactive oxidation materials based on chlorine or bromine are heterocyclic N-bromine and N-chlorimides such as trichloroisocyanuric acid, tribromoisocyanuric acid, dibromoisocyanuric acid and dichloroisocyanuric acid as well as salts thereof with cations dissolving these compounds in water, such as potassium and sodium cations.
Hydantoine-verbindingen zoals 1,3-dichloor-5,5- dimethylhydantoïne zijn eveneens zeer geschikt.Hydantoin compounds such as 1,3-dichloro-5,5-dimethylhydantoin are also very suitable.
10 75 S 03 1510 75 S 03 15
Eveneens geschikt voor gebruik bij de onderhavige uitvinding zijn deeltjesvorraige, wateroplosbare watervrije anorganische zouten zoals lithium-, natrium- en calciumhy-pochloriet en -hypobromiet. Ook geschikte bleekmiddelmate-5 rialen zijn chloorhoudend trinatriumfosfaat en chloorisocy-anuraten.Also suitable for use in the present invention are particulate, water-soluble anhydrous inorganic salts such as lithium, sodium and calcium hypochlorite and hypobromite. Also suitable bleaching materials are chlorine-containing trisodium phosphate and chloroisocyanurates.
Inkapselingstechnieken zijn bekend voor zowel per-zuurstof- als chloorbleekmiddelen, b.v zoals beschreven in US-A-4.126.573, US-A-4.327.151, US-A-3.983.254, US-A-10 4.279.764, US-A-3.036.013, EP-A-0.436.971 en EP-A-0.510.761.Encapsulation techniques are known for both peroxygen and chlorine bleaches, eg, as described in US-A-4,126,573, US-A-4,327,151, US-A-3,983,254, US-A-10 4,279,764, US -A-3.036.013, EP-A-0.436.971 and EP-A-0.510.761.
Inkapselingstechnieken zijn echter bijzonder toepasbaar wanneer gebruik wordt gemaakt van bleekmiddelsystemen op basis van een halogeen.Encapsulation techniques, however, are particularly applicable when using halogen-based bleach systems.
Samenstellingen volgens de uitvinding kunnen ca. 0,5% 15 tot ca. 3% avCl (beschikbaar chloor) aan chloorbleekmiddelen omvatten. Voor perzuurstofbleekmiddelen is een geschikt bereik eveneens 0,5% tot 3% avO (beschikbare zuurstof). Bij voorkeur is de hoeveelheid bleekmateriaal in de wasvloeistof ten minste 12,5xl0-4% en maximaal 0,03 gew.% avO ten 20 opzichte van de vloeistof.Compositions of the invention may comprise from about 0.5% to about 3% avCl (available chlorine) of chlorine bleaches. For peroxygen bleaches, a suitable range is also 0.5% to 3% avO (available oxygen). Preferably the amount of bleaching material in the washing liquid is at least 12.5 x 10-4% and at most 0.03 wt% avO relative to the liquid.
Oppervlakte-actief materiaalSurfactant material
Bij voorkeur aanwezig in de samenstelling is een oppervlakte-actiefmiddelsysteem dat een oppervlakte-actief 25 middel omvat dat uit niet-ionische, anionische, kationische, amfolytische en zwitterionische oppervlakte-actieve middelen alsmede mengsels daarvan is gekozen.Preferably present in the composition is a surfactant system comprising a surfactant selected from nonionic, anionic, cationic, ampholytic and zwitterionic surfactants as well as mixtures thereof.
Gewoonlijk is het oppervlakte-actieve middel een gering tot niet schuimend niet-ionisch oppervlakte-actief 30 middel, dat een niet-ionisch alkoxy-oppervlakte-actief middel omvat waarin de alkoxyeènheid wordt gekozen uit de groep die wordt gevormd door ethyleenoxide, propyleenoxide en mengsels daarvan en het oppervlakte-actieve .middel bij -voorkeur wordt gebruikt om het reinigingsvermogen te verbe-35 teren zonder bovenmatig schuimen.Usually the surfactant is a low to non-foaming non-ionic surfactant comprising a nonionic alkoxy surfactant in which the alkoxy unit is selected from the group consisting of ethylene oxide, propylene oxide and mixtures thereof and the surfactant is preferably used to improve cleaning performance without excessive foaming.
Voorbeelden van geschikte niet-ionische oppervlakte-actieve middelen voor gebruik bij de uitvinding zijn gering 1016803 16 tot niet schuimende ethoxyalcoholen met rechte ketens uit de serie Plurafac® LF die worden verkocht door de firma BSF, die uit de serie Synperonic RA, die door ICI worden verkocht en die uit de serie Triton® DF, die door de firma 5 Rohm & Haas worden verkocht.Examples of suitable nonionic surfactants for use in the invention are low 1016803 16 to straight chain non-foaming ethoxy alcohols of the Plurafac® LF series sold by BSF, those of the Synperonic RA series, manufactured by ICI and those from the Triton® DF series, which are sold by 5 Rohm & Haas.
Andere oppervlakte-actieve middelen zoals anionische oppervlakte-actieve middelen kunnen gebruikt worden maar kunnen de bijkomende aanwezigheid van een schuimwerend middel vereisen om schuimvorming te onderdrukken. Wanneer 10 een anionisch oppervlakte-actief middel wordt gebruikt, is het met voordeel aanwezig in een niveau van 2 gew.% of minder.Other surfactants such as anionic surfactants can be used but may require the additional presence of an anti-foaming agent to suppress foaming. When an anionic surfactant is used, it is advantageously present at a level of 2 wt% or less.
Wateroplosbare polymere polycarboxylverbindingen 15 Met voordeel is er een wateroplosbare polymere poly- carboxylverbinding in de vaatwassamenstelling aanwezig. Bij voorkeur zijn deze verbindingen homo- of copolymeren van polycarboxylverbindingen, in het bijzonder copolymere verbindingen waarin het zuurmonomeer twee of meer carboxyl-20 groepen, door niet meer dan twee koolstofatomen gescheiden, omvat. Eveneens kunnen zouten van deze stoffen worden gebruikt.Water-soluble polymeric polycarboxyl compounds. A water-soluble polymeric polycarboxyl compound is advantageously present in the dishwashing composition. Preferably these compounds are homo- or copolymers of polycarboxyl compounds, especially copolymeric compounds in which the acid monomer comprises two or more carboxyl groups separated by no more than two carbon atoms. Salts of these substances can also be used.
Polymere polycarboxylaten die bijzondere voorkeur genieten, zijn copolymeren die zijn afgeleid van monomeren 25 van acrylzuren en maleïnezuur. Het gemiddelde molecuulge-wicht van deze polymeren in de zuurvorm ligt bij voorkeur in het bereik van 4000 tot 70.000.Particularly preferred polymeric polycarboxylates are copolymers derived from monomers of acrylic acids and maleic acid. The average molecular weight of these polymers in the acid form is preferably in the range of 4,000 to 70,000.
Een ander type polymere polycarboxylverbindingen dat geschikt is voor gebruik in een samenstelling volgens de 30 uitvinding wordt gevormd door homopolymere polycarbonzuur-verbindingen met acrylzuur als de monomeereenheid. Het gemiddelde molecuulgewicht van dergelijke homopolymeren in de zuurvorm ligt bij voorkeur in het bereik van 1000 tot 100.000 en in het bijzonder van 3000 tot 10.000.Another type of polymeric polycarboxyl compounds suitable for use in a composition according to the invention are homopolymeric polycarboxylic compounds with acrylic acid as the monomer unit. The average molecular weight of such homopolymers in the acid form is preferably in the range of from 1000 to 100,000 and in particular from 3,000 to 10,000.
35 Acrylsulfonpolymeren zoals beschreven in EP 851.022 (Unilever) zijn eveneens geschikt.Acrylic sulfone polymers as described in EP 851,022 (Unilever) are also suitable.
Bij voorkeur is dit polymeermateriaal aanwezig in een 1016803 17 niveau van ten minste 0,1 gew.% en met meer voorkeur in niveaus van 1 gew.% tot 7 gew.% ten opzichte van het totale gewicht van de samenstelling.Preferably, this polymer material is present at a level of at least 0.1 wt%, and more preferably at levels from 1 wt% to 7 wt%, relative to the total weight of the composition.
5 Cheleermiddel5 Chelating agent
In de samenstelling kan een cheleermiddel aanwezig zijn. Indien dit aanwezig is, verdient het de voorkeur dat het niveau van het cheleermiddel 0,5 tot 3 gew.% ten opzichte van het totale gewicht van de samenstelling bedraagt.A chelating agent may be present in the composition. If present, it is preferable that the level of the chelating agent is 0.5 to 3% by weight relative to the total weight of the composition.
10 De voorkeur genietende cheleermiddelen omvatten organische fosfonaten, aminocarboxylaten, polyfunctioneel gesubstitueerde verbindingen en mengsels daarvan.Preferred chelating agents include organic phosphonates, amino carboxylates, polyfunctionally substituted compounds and mixtures thereof.
Bijzondere voorkeur genietende cheleermiddelen zijn organische fosfonaten zoals a-hydroxy-2-fenylethyldifosfo-15 naat, ethyleendifosfonaat, hydroxy-1,1-hexylideen-vinyli-deen-1,1-difosfonaat, 1,2-dihydroxyethaan-l,1-difosfonaat en hydroxyethyleen-1,1-difosfonaat. De meeste voorkeur verdienen hydroxyethyleen-1,1-difosfonaat en 2-fosfonobu-taan-1,2,4-tricarbonzuur.Particularly preferred chelating agents are organic phosphonates such as α-hydroxy-2-phenylethyl diphosphonate, ethylene diphosphonate, hydroxy-1,1-hexylidene-vinylidene-1,1-diphosphonate, 1,2-dihydroxyethane-1,1-diphosphonate and hydroxyethylene-1,1-diphosphonate. Most preferred are hydroxyethylene-1,1-diphosphonate and 2-phosphonobutane-1,2,4-tricarboxylic acid.
2020
Middelen tegen glansverliesAnti-shine agents
Ook kunnen middelen tegen glansverlies zoals benzot-riazool en de middelen die zijn beschreven in EP 723.577 25 (Unilever) worden toegevoegd.Also, gloss loss agents such as benzotrizole and the agents described in EP 723,577 (Unilever) can be added.
Optionele bestanddelenOptional components
Optionele bestanddelen zijn bijvoorbeeld buffermidde-len, reductiemiddelen, b.v. boraten, alkalimetaalhydroxide 30 en de welbekende enzymstabiliseermiddelen zoals polyalcoho-len, b.v. glycerol en borax; aanslagwerende middelen, kris-talgroeiremmers, drempelmiddelen, verdikkingsmiddelen, geurstoffen en kleurstoffen en dergelijke.Optional components are, for example, buffering agents, reducing agents, e.g. borates, alkali metal hydroxide and the well-known enzyme stabilizers such as polyalcohols, e.g. glycerol and borax; anti-scale agents, crystal growth inhibitors, threshold agents, thickeners, fragrances and dyes and the like.
Reductiemiddelen kunnen bijvoorbeeld worden gebruikt 35 om het verschijnen van een enzym-deactiverende concentratie van een oxidatieve bleekmiddelverbinding te voorkomen. Geschikte middelen omvatten reductieve zwaveloxyzuren en 18 zouten daarvan. Vanwege de beschikbaarheid, de lage kostprijs en hoge werking genieten alkalimetaal- en ammonium-zouten van zwaveloxyzuren met inbegrip van ammoniumsulfiet ((NH4)2S03), natriumsulfiet (Na2SC>3) , natriumwaterstofsulfiet 5 (NaHSCb) , natriummetabisulfiet (Na2S205), kaliummetabisulfiet (K2S205), lithiumhydrosulf iet (Li2S204) , enz., de voorkeur, waarbij natriumsulfiet bijzondere voorkeur geniet. Nog een bruikbaar reductiemiddel is ascorbinezuur, hoewel het vanwege de kostprijs geen bijzondere voorkeur verdient. De 10 hoeveelheid te gebruiken reductiemiddelen kan van geval tot geval variëren afhankelijk van het soort bleekmiddel en de vorm die dit heeft, maar gewoonlijk zal een bereik van ca. 0,01 gew.% tot ca. 1,0 gew.% en bij voorkeur ca. 0,02 gew.% tot ca. 0,5 gew.% voldoende zijn.For example, reducing agents can be used to prevent the appearance of an enzyme-deactivating concentration of an oxidative bleaching compound. Suitable agents include reductive sulfur oxyacids and 18 salts thereof. Due to its availability, low cost and high performance, alkali metal and ammonium salts enjoy sulfur oxyacids including ammonium sulfite ((NH4) 2S03), sodium sulfite (Na2SC> 3), sodium hydrogen sulfite 5 (NaHSCb), sodium metabisulfite (Na2S205), potassium metabisulfite ( K2S205), lithium hydrosulfite (Li2S204), etc., with sodium sulfite being particularly preferred. Another useful reducing agent is ascorbic acid, although it is not particularly preferred because of the cost. The amount of reducing agents to be used may vary from case to case depending on the type of bleach and the form it has, but usually will range from about 0.01 wt% to about 1.0 wt% and preferably about 0.02 wt% to about 0.5 wt% are sufficient.
15 pH van de wasvloeistof15 pH of the washing liquid
De uitvinding heeft betrekking op werkwijzen voor het afwassen in mechanische vaatwasmachines waarbij de wasvloeistof een lage pH heeft. Met "lage pH" wordt in de 20 onderhavige beschrijving bedoeld dat de pH van de wasvloeistof bij voorkeur hoger is dan ca. 6,5, met meer voorkeur 7,5 of hoger en het liefst 8,5 of hoger. Bij voorkeur is de pH lager dan ca. 11, met meer voorkeur lager dan ca. 10 en liever lager dan ca. 9,5. Het meest voordelige pH-bereik is 25 8,5 tot 10,5.The invention relates to methods for washing in mechanical dishwashers in which the washing liquid has a low pH. By "low pH" in the present description is meant that the pH of the washing liquid is preferably higher than about 6.5, more preferably 7.5 or higher and most preferably 8.5 or higher. Preferably, the pH is less than about 11, more preferably less than about 10, more preferably less than about 9.5. The most advantageous pH range is 8.5 to 10.5.
Temperatuur van de afwaswerkwijzeTemperature of the washing process
De onderhavige uitvinding heeft bij voorkeur betrekking op werkwijzen voor het mechanisch afwassen van vuile 30 artikelen met een wasvloeistof bij een temperatuur lager dan 55°C.The present invention preferably relates to methods for mechanical washing of dirty articles with a washing liquid at a temperature below 55 ° C.
De uitvinding zal thans door de volgende niet-beper-kende voorbeelden worden geïllustreerd.The invention will now be illustrated by the following non-limiting examples.
Alle percentages (gew.%) zijn op basis van het ge- 35 wicht.All percentages (wt%) are based on weight.
1016803 191016803 19
Product 1 Gew.dlnProduct 1 parts by weight
Gebied AArea A
Citroenzuur 5 15% Niet-ionisch LF 400 S v. BSAF 2,2 ^ EHDP of Bayhibit AM 1Citric Acid 5 15% Nonionic LF 400 S v. BSAF 2,2 ^ EHDP or Bayhibit AM 1
Koolwaterstofwas - smp. 58°C 6,8Hydrocarbon wax - mp. 58 ° C 6.8
Gebied BArea B
Natrium-tripolyfosfaat 55,54Sodium tripolyphosphate 55.54
Natrium-disilicaat 10,41 - Sokalan PA 25CL (polyacrylaat met 3,1 laag molecuulgewicht) 85% TAED 2,4 EHDP of Bayhibit AM 0,4 15 Natriumperboraat 9Sodium Disilicate 10.41 - Sokalan PA 25CL (Low Molecular Weight 3.1 Polyacrylate) 85% TAED 2.4 EHDP or Bayhibit AM 0.4 15 Sodium Perborate 9
Niet-ionisch LF 403 v. BASF 1Nonionic LF 403 v. BASF 1
Enzymen (Savinade/Amylase 1:1- 3,1 gew.mengsel) BTA (benzotriazool) 0,05 20 Bovenstaand testregiemproduct 1 (gebied A & B) in een totale dosering van 25 g.Enzymes (Savinade / Amylase 1: 1 - 3.1 wt. Mixture) BTA (Benzotriazole) 0.05 20 Test Regimen Product 1 above (Area A & B) in a total dose of 25 g.
Geen zout of spoelhulpmiddel extra aan de machine toegevoegd.No additional salt or rinse aid added to the machine.
Product 2 gebied B is 21,25 g + 3 ml afzonderlijk spoel- * 25 hulpmiddel, geregenereerde ionenwisselaar.Product 2 area B is 21.25 g + 3 ml separate rinse aid, regenerated ion exchanger.
Product 3: referentieproduct met gebruikmaking van een geregenereerde ionenwisselaar en standaardproducten (een tablet Sun en spoelhulpmiddel zoals in Frankrijk verkocht).Product 3: Reference product using a regenerated ion exchanger and standard products (a Sun tablet and rinse aid as sold in France).
1016803 f 201016803 f 20
Afwasmachine: Miele G685 55° universeel programma, 10 achtereenvolgende afwasbeurten. Vlek- en filmvorming subjectief bepaald na 10 afwasbeurten. Lage uitslagen zijn de beste.Dishwasher: Miele G685 55 ° universal program, 10 consecutive washes. Stain and film formation subjectively determined after 10 washes. Low results are the best.
55
Filmvorming VlekvormingFilm formation Spot formation
Resultaten: Product 1 2 2,1Results: Product 1 2 2.1
Product 2 1,8 2,3Product 2 1.8 2.3
Product 3 1,9 2,4 10 Er werden geen significante verschillen gevonden.Product 3 1.9 2.4 10 No significant differences were found.
Product 4 Gew.dlnProduct 4 parts by weight
15 Gebied A15 Area A
Citroenzuur 5 15% Niet-ionisch LF 400 S v. BSAF 2,2 EHDP of Bayhibit AM 0,2 PEG 6000 5,6 20 Acumer 3100 v. Rohm & Haas 1,0Citric acid 5 15% Non-ionic LF 400 S v. BSAF 2.2 EHDP or Bayhibit AM 0.2 PEG 6000 5.6 20 Acumer 3100 v. Rohm & Haas 1.0
Bekleding* 1,0Upholstery * 1.0
Gebied BArea B
Natrium-tripolyfosfaat 55,54Sodium tripolyphosphate 55.54
Natrium-disilicaat 10,41 25 Sokalan PA 25CL (polyacrylaat met 3,1 laag molecuulgewicht) 85% TAED 2,4 EHDP of Bayhibit AM 0,4 1016803 *1 21Sodium Disilicate 10.41 25 Sokalan PA 25CL (Low Molecular Weight 3.1 Polyacrylate) 85% TAED 2.4 EHDP or Bayhibit AM 0.4 1016803 * 1 21
Natriumperboraat 9Sodium perborate 9
Niet-ionisch LF 403 v. BASF 1Nonionic LF 403 v. BASF 1
Enzymen (Savinade/Amylase 1:1- 3,1 gew.mengsel) 5 BTA (benzotriazool) 0,05Enzymes (Savinade / Amylase 1: 1 - 3.1 wt. Mixture) 5 BTA (Benzotriazole) 0.05
De bekleding wordt op gebied A gesproeid. Deze omvat een 2:1-verhouding van polymeer AEA (v. Sankyo) en Mawiol 5088 (v. Clariant) 10 Bovenstaand testregiemproduct 4 (gebied A & B) in een totale dosering van 25 g. Geen zout of spoelhulpmiddel extra aan de machine toegevoegd.The coating is sprayed on area A. This includes a 2: 1 ratio of polymer AEA (v. Sankyo) and Mawiol 5088 (v. Clariant) 10 Test Regimen Product 4 above (area A & B) in a total dose of 25 g. No additional salt or rinse aid added to the machine.
Product 5 alleen gebied B bij 21,25 g + 3 ml afzonderlijk spoelhulpmiddel (Sun uit Frankrijk), geregenereerde ionen-15 wisselaar.Product 5 area B only at 21.25 g + 3 ml separate flushing aid (Sun from France), regenerated ion-15 exchanger.
Product 6: referentieproduct met gebruikmaking van een geregenereerde ionenwisselaar en standaardproducten (een tablet Sun en spoelhulpmiddel uit Frankrijk).Product 6: reference product using a regenerated ion exchanger and standard products (a Sun tablet and rinse aid from France).
Afwasmachine: Miele G685 55° universeel programma, 10 20 achtereenvolgende afwasbeurten. Vlek- en filmvorming sub jectief bepaald na 10 afwasbeurten. Lage uitslagen zijn de beste.Dishwasher: Miele G685 55 ° universal program, 10 to 20 consecutive washes. Stain and film formation determined subjectively after 10 washes. Low results are the best.
Filmvorming Vlekvorming 25 Resultaten: Product 4 2 2,3Film formation Spot formation 25 Results: Product 4 2 2.3
Product 5 1,8 2,3Product 5 1.8 2.3
Product 6 1,9 2,4Product 6 1.9 2.4
Er werden geen significante verschillen gevonden.No significant differences were found.
10168031016803
Claims (10)
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB9929967 | 1999-12-17 | ||
GBGB9929967.9A GB9929967D0 (en) | 1999-12-17 | 1999-12-17 | Use of dish-washing compositions |
EP00300928 | 2000-02-07 | ||
EP00300928 | 2000-02-07 |
Publications (2)
Publication Number | Publication Date |
---|---|
NL1016803A1 NL1016803A1 (en) | 2001-06-21 |
NL1016803C2 true NL1016803C2 (en) | 2001-06-25 |
Family
ID=26072995
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
NL1016803A NL1016803C2 (en) | 1999-12-17 | 2000-12-05 | Use of dishwashing compositions. |
Country Status (7)
Country | Link |
---|---|
AT (1) | ATE235545T1 (en) |
BE (1) | BE1013471A3 (en) |
DE (1) | DE60001795T2 (en) |
FR (1) | FR2802548B1 (en) |
GB (1) | GB2358405B (en) |
NL (1) | NL1016803C2 (en) |
PT (1) | PT1111037E (en) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE10032611A1 (en) † | 2000-07-07 | 2002-01-24 | Henkel Kgaa | Dishwasher detergent with additional benefits |
DE60232809D1 (en) * | 2001-11-14 | 2009-08-13 | Procter & Gamble | MACHINERY DISHWASHER IN THE FORM OF A SINGLE DOSE CONTAINING A POLISHING INGREDIENT |
Family Cites Families (17)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE3541153A1 (en) * | 1985-11-21 | 1987-05-27 | Henkel Kgaa | MULTILAYER DETERGENT IN MELT BLOCK SHAPE |
DE3541146A1 (en) * | 1985-11-21 | 1987-05-27 | Henkel Kgaa | MULTILAYERED DETERGENT TABLETS FOR MACHINE DISHWASHER |
DE3541147A1 (en) * | 1985-11-21 | 1987-05-27 | Henkel Kgaa | CLEANER COMPACT |
US5133892A (en) * | 1990-10-17 | 1992-07-28 | Lever Brothers Company, Division Of Conopco, Inc. | Machine dishwashing detergent tablets |
US5783540A (en) * | 1996-12-23 | 1998-07-21 | Lever Brothers Company, Division Of Conopco, Inc. | Machine dishwashing tablets delivering a rinse aid benefit |
US5837663A (en) * | 1996-12-23 | 1998-11-17 | Lever Brothers Company, Division Of Conopco, Inc. | Machine dishwashing tablets containing a peracid |
US5900395A (en) * | 1996-12-23 | 1999-05-04 | Lever Brothers Company | Machine dishwashing tablets containing an oxygen bleach system |
GB2327949A (en) * | 1997-08-02 | 1999-02-10 | Procter & Gamble | Detergent tablet |
US5972870A (en) * | 1997-08-21 | 1999-10-26 | Vision International Production, Inc. | Multi-layered laundry tablet |
GB9721363D0 (en) * | 1997-10-09 | 1997-12-10 | Mcbride Robert Ltd | Dishwasher tablets |
ES2142784T3 (en) * | 1997-11-26 | 2003-01-16 | Procter & Gamble | METHOD FOR WASHING DISH. |
DE19758177A1 (en) * | 1997-12-30 | 1999-07-01 | Henkel Kgaa | Process for producing a dishwasher detergent tablet |
EP1051476A1 (en) * | 1998-01-26 | 2000-11-15 | The Procter & Gamble Company | Multi-layer detergent tablet |
FR2778666B1 (en) * | 1998-05-14 | 2003-01-17 | Chimiotechnic | THREE-LAYERED DETERGENT TABLET |
GB9815525D0 (en) * | 1998-07-17 | 1998-09-16 | Procter & Gamble | Detergent tablet |
DE19834180A1 (en) * | 1998-07-29 | 2000-02-03 | Benckiser Nv | Composition for use in a dishwasher |
US5962387A (en) * | 1998-10-16 | 1999-10-05 | Colgate Palmolive Company | Automatic dishwashing tablets |
-
2000
- 2000-11-10 DE DE60001795T patent/DE60001795T2/en not_active Revoked
- 2000-11-10 PT PT00310008T patent/PT1111037E/en unknown
- 2000-11-10 GB GB0027599A patent/GB2358405B/en not_active Expired - Fee Related
- 2000-11-10 AT AT00310008T patent/ATE235545T1/en not_active IP Right Cessation
- 2000-12-05 NL NL1016803A patent/NL1016803C2/en not_active IP Right Cessation
- 2000-12-13 FR FR0016221A patent/FR2802548B1/en not_active Expired - Fee Related
- 2000-12-13 BE BE2000/0784A patent/BE1013471A3/en not_active IP Right Cessation
Also Published As
Publication number | Publication date |
---|---|
FR2802548A1 (en) | 2001-06-22 |
NL1016803A1 (en) | 2001-06-21 |
GB0027599D0 (en) | 2000-12-27 |
PT1111037E (en) | 2003-07-31 |
FR2802548B1 (en) | 2006-08-04 |
GB2358405B (en) | 2004-10-20 |
BE1013471A3 (en) | 2002-02-05 |
ATE235545T1 (en) | 2003-04-15 |
DE60001795T2 (en) | 2003-10-23 |
DE60001795D1 (en) | 2003-04-30 |
GB2358405A (en) | 2001-07-25 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US5230822A (en) | Wax-encapsulated particles | |
AU652438B2 (en) | Wax-encapsulated particles and method for making same | |
EP2537916B1 (en) | Bleaching compositions comprising a perfume delivery system | |
US5200236A (en) | Method for wax encapsulating particles | |
EP0770121B1 (en) | Washing process and composition | |
NZ285678A (en) | Peroxygen bleach composition comprising a peroxygen bleaching compound and as a bleaching compound activator an optionally substituted bi-(tri-)-cyclic dione; liquid or powder bleaching compositions; dioxiranes | |
EP2392639B1 (en) | Mixture of a surfactant with a solid compound for improving rinsing performance of automatic dishwashing detergents | |
NL1016803C2 (en) | Use of dishwashing compositions. | |
EP1111037B1 (en) | Use of dish-washing compositions | |
EP1328613B1 (en) | Dish-washing compositions | |
US6463939B1 (en) | Dish washing process | |
US20030176308A1 (en) | Detergent compositions containing components modified to float in water | |
EP1239026B1 (en) | Detergent tablets | |
EP0628625B1 (en) | Protease compatible with lipase in dry, concentrated bleach compositions | |
JPH11511780A (en) | Detergent composition comprising specific lipolytic enzyme and coal soap dispersant | |
US6310023B1 (en) | Machine dish wash compositions | |
EP1328611B1 (en) | Dish-washing compositions | |
WO2012140413A1 (en) | Coated fabric care agent | |
ZA200106894B (en) | Detergent tablets. | |
EP2803719A1 (en) | Cleaning composition | |
EP1190029A1 (en) | Dish washing process and compositions relating thereto | |
JP2002529582A (en) | Bleach-containing detergent composition | |
ZA200105695B (en) | Dish washing process and compolsitions relating thereto. | |
WO2001002524A1 (en) | Dish washing compositions |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AD1A | A request for search or an international type search has been filed | ||
PD2A | A request for search or an international type search has been filed | ||
VD1 | Lapsed due to non-payment of the annual fee |
Effective date: 20080701 |