<Desc/Clms Page number 1>
Gebruik van vaatwassamenstellingen.
Beschrijving Technisch gebied
De onderhavige uitvinding heeft betrekking op het gebied van machinaal vaatwassen. Meer in het bijzonder heeft de uitvinding betrekking op een werkwijze voor het gebruik van tabletten voor automatisch vaatwassen.
Achtergrond van de uitvinding
Het afwassen van artikelen in een in de handel verkrijgbare vaatwasmachine omvat gebruikmaking van drie soorten producten. Er wordt zout aan het zout-compartiment toegevoegd om het water zachter te maken, er wordt een vaatwasformulering gebruikt om de artikelen schoon te maken en er wordt een spoelhulpmiddel gebruikt om te verzekeren dat de artikelen zonder strepen of vlekken gespoeld worden.
De gebruikers vinden het lastig het zout en het spoelhulpmiddel in een vaatwasmachine te vervangen. De onderhavige uitvinding heeft betrekking op een werkwijze voor het vaatwassen die het zout en het spoelhulpmiddel bij het machinaal vaatwassen overbodig maakt.
Beschrijving van de uitvinding
Dienovereenkomstig voorziet de onderhavige uitvinding in het gebruik van een tablet voor machinaal vaatwassen bij een werkwijze voor het vaatwassen waarbij geen spoelhulpmiddel en geen zout in de machine wordt gebruikt, waarbij de tablet meer dan 45 gew. % vormingsmiddel omvat en een onderscheiden gedefinieerd gebied (A) heeft dat maximaal 30 gew. % van het totale gewicht van de tablet uitmaakt, waarbij het onderscheiden gedefinieerde gebied (A) een materiaal omvat dat het oplossen van het gebied (A) in water regelt.
<Desc/Clms Page number 2>
Bovendien wordt in de onderhavige aanvrage een werkwijze voor het afwassen van artikelen in een mechanische wasmachine gedefinieerd, welke werkwijze de stappen omvat van : i) het behandelen van de artikelen met een wasvloeistof waaraan een tablet wordt toegevoegd die meer dan 45 gew. % vormingsmiddel omvat en een afzonderlijk gede- finieerd gebied heeft dat maximaal 30 gew. % van het totale gewicht van de tablet uitmaakt, waarbij het onderscheiden gedefinieerde gebied een materiaal omvat dat het oplossen ervan in water vertraagt en waarbij geen bijkomend spoelhulpmiddel en/of zout in de machine aanwezig is.
In de context van de onderhavige uitvinding heeft de uitdrukking"bijkomend spoelhulpmiddel of zout" betrekking op een afzonderlijk spoelhulpmiddel of zoutproduct dat geen deel van de tablet uitmaakt.
Ook heeft de uitvinding betrekking op een kit van delen die een zoals hiervoor beschreven reinigingsmiddeltablet alsmede instructies omvat waarin wordt gesteld dat geen spoelhulpmiddel of zout aan de vaatwasmachine behoeft te worden toegevoegd.
Gedetailleerde beschrijving van de uitvinding
Tabletten volgens de uitvinding hebben twee gebieden, de gebieden A en B.
Gebied A
Zoals hiervoor is beschreven, omvat de tablet een gedefinieerd gebied (A) dat maximaal 30 gew. % van het totale gewicht van de tablet uitmaakt alsmede een materiaal dat het oplossen ervan in water regelt. Bij voorkeur is een materiaal aanwezig dat het oplossen van gebied A vertraagt.
Voor doeleinden van de uitvinding zal de rest van de tablet gebied (B) genoemd worden. De bestanddelen van het gedefinieerde gebied (A) zullen na de bestanddelen in de rest van de tablet (B) aan het water in de machine worden
<Desc/Clms Page number 3>
afgegeven. In een ander aspect van de onderhavige uitvinding lost het gedefinieerde gebied (A) bij voorkeur op bij een temperatuur hoger dan 50 C en bij voorkeur hoger dan 60 C.
De rest van de tablet (B) zal direct bij contact met water beginnen op te lossen. Bij voorkeur lost voor gebied (B) ten minste 60%, met meer voorkeur ten minste 80% en het liefst ten minste 95% van gebied (B) binnen 12 minuten in gedemineraliseerd water bij 500C op. Het verdient zeer de voorkeur dat gebied A vast is.
Het oplossen van gebied (A) kan vertraagd worden door de keuze van deeltjesvormige bestanddelen die zijn ingekapseld met een bestanddeel dat in water langzaam oplost of gedeeltelijk oplosbaar is. Dergelijke inkapselingsmaterialen omvatten celluloseacetaatftalaat (CAP), hydroxypropylmethylcellulose (HPMC), carboxymethylcellulose (CMC) en mengsels daarvan. Een hydroxypropylmethylcellulosepolymeer heeft bij voorkeur een naar het getal gemiddeld molecuulgewicht van 50. 000 tot 200. 000 en een viscositeit van een waterige oplossing van 2 gew. % bij 25 C (ADTMD2363) van 50. 000 tot 120. 000 cps. Een hydroxypropylmethylcellulosepolymeer dat bijzondere voorkeur geniet, is Methocel 0 J75MS-N met een viscositeit van een waterige oplossing van 2 gew. % bij 25 C van ca. 75. 000 cps.
Andere de voorkeur genietende inkapselingsmaterialen omvatten gelatine met een bekledingsterkte in het bereik van 30 tot 200 en bij voorkeur 75 tot 200.
De dikte van het inkapselingsmateriaal zal de oplossingssnelheid van het ingekapselde reinigingsmiddelbestanddeel bepalen en derhalve de afgiftesnelheid van het reinigingsmiddelbestanddeel aan het waswater bepalen.
Een ander voorbeeld van een wijze waarop het oplossen van het deelgebied A vertraagd kan worden, is het voormengen van de reinigingsmiddelbestanddelen in een matrix, die in water langzaam oplost of gedeeltelijk oplosbaar is.
Voorkeurspolymeren hiervoor omvatten polyethyleenglycol met een molecuulgewicht van 1000 tot 20. 000 en met meer voorkeur
<Desc/Clms Page number 4>
4000 tot 10. 000 of zelfs 12. 000.
Nog een ander voorbeeld van een wijze waarop het oplossen van gebied A geregeld kan worden, is het bekleden van gebied A met een bekledingslaag. De bekledingslaag omvat bij voorkeur een materiaal dat in bij voorkeur minder dan 15 minuten, met meer voorkeur minder dan 10 minuten, met nog meer voorkeur minder dan 5 minuten en het liefst minder dan 60 seconden bij contact met het gebied A vast wordt. Bij voorkeur is de bekledingslaag wateroplosbaar. Bekledinglagen die de voorkeur genieten, omvatten materialen die zijn gekozen uit de groep die wordt gevormd door vetzuren, alcoholen, diolen, esters en ethers, adipinezuur, carbonzuren, dicarbonzuren, polyvinylacetaat (PVA), polyvinylpyrrolidon (PVP), polyazijnzuur (PLA), polyethyleenglycol (PEG) en mengsels daarvan. Carbonzuren en dicarbonzuren die de voorkeur verdienen, omvatten bij voorkeur een even aantal koolstofatomen.
Bij voorkeur omvatten de carbonzuren of dicarbonzuren ten minste 4, liever ten minste 6, nog liever ten minste 8 koolstofatomen en het liefst 8 tot 13 koolstofatomen. De voorkeur genietende dicarbonzuren omvatten adipinezuur, suberinezuur, azelainezuur, subacinezuur, undecaandizuur, dodecaandizuur, tridecaandizuur en mengsels daarvan. De voorkeur genieten die vetzuren, die een koolstofketenlengte van C12 tot C22 en het liefst C18 tot C22 hebben. De bekledingslaag kan eveneens bij voorkeur een verbrekingsmiddel omvatten.
Geschikte bekledingen voor gebied A worden beschreven in WO 00/06684, JP 61-28440, JP 60-141705, JP 61-28441, JP 61-28596, JP 61-28597 en JP 61-28598.
Indien aanwezig omvat de bekledingslaag in het algemeen een niveau van ten minste 0, 05%, bij voorkeur ten minste 0, 1%, met meer voorkeur ten minste 1% en met de meeste voorkeur ten minste 2% of zelfs ten minste % van de reinigingsmiddeltablet.
De bekleding kan worden gebruikt om gebied A aan gebied B te binden.
In weer een ander voorbeeld is gebied A zodanig, dat
<Desc/Clms Page number 5>
het ten minste een bestanddeel omvat dat reageert met een uitwendige stimulus, zoals de temperatuur en de pH, om het oplossen te laten beginnen. Een voorbeeld van een bestanddeel dat het oplossen doet beginnen als reactie op een verandering van de temperatuur is een was. In het bijzonder wordt beoogd dat een geschikte was een smelttemperatuur hoger dan de kamertemperatuur, bij voorkeur hoger dan 40 C, liever hoger dan 500C en het liefst hoger dan 55 C zal hebben.
Het heeft de voorkeur als gebied A in de tablet aanwezig is.
Een voor de onderhavige uitvinding bruikbaar gebied A kan verder een wateroplosbaar zuurvormend middel of zout omvatten, bij voorkeur organische zuren met inbegrip van bijvoorbeeld carbonzuren, zoals citroenzuur en barnsteenzuur, polycarbonzuren, zoals polyacrylzuur, alsmede azijnzuur, boorzuur, malonzuur, adipinezuur, fumaarzuur, melkzuur, glycolzuur, wijnsteenzuur, tartronzuur, maleinezuur, derivaten en mengsels daarvan.
Geschikte wateroplosbare monomere of oligomere carboxylaat-vormende middelen kunnen uit een breed bereik van verbindingen worden gekozen, maar dergelijke verbindingen hebben bij voorkeur een logaritmische zuurconstante van de eerste carboxylgroep (pKl) kleiner dan 9, bij voorkeur tussen 2 en 8, 5 en met meer voorkeur tussen 2, 5 en 7, 5.
Het carboxylaat- of polycarboxylaat-vormende middel kan van een monomeer of oligomeer type zijn, hoewel monomere polycarboxylaten in het algemeen vanwege de kosten en werking de voorkeur genieten. Monomere en oligomere vormende middelen kunnen uit acyclische, alicyclische, heterocyclische en aromatische carboxylaten worden gekozen.
Geschikte carboxylaten die een carboxylgroep bevatten, omvatten wateroplosbare zouten van melkzuur, glycolzuur en etherderivaten daarvan. Polycarboxylaten die twee carboxylgroepen bevatten, omvatten wateroplosbare zouten van barnsteenzuur, malonzuur, (ethyleendioxy) diazijnzuur, maleinezuur, diglycolzuur, wijnsteenzuur, tartronzuur en
<Desc/Clms Page number 6>
fumaarzuur alsmede ethercarboxylaten en sulfinylcarboxylaten. Polycarboxylaten die drie carboxylgroepen bevatten, omvatten in het bijzonder wateroplosbare citraten, aconitraten en citraconaten alsmede succinaatderivaten zoals carboxymethyloxysuccinaten, lactoxysuccinaten en aminosuccinaten, en ook oxypolycarboxylaten zoals 20-oxa-l, l, 3- propaantricarboxylaten.
De hiervoor beschreven carboxylaatof polycarboxylaat-vormende verbindingen kunnen eveneens een tweeledige functie als regelmiddelen voor de pH hebben.
Polycarboxylaten die vier carboxylgroepen bevatten,
EMI6.1
omvatten oxydisuccinaten, 1, 1, en 1, carboxylaten. Sulfosubstituenten bevattende polycarboxylaten omvatten sulfosuccinaatderivaten alsmede sulfonhoudende gepyrolyseerde citraten.
Alicyclische en heterocyclische polycarboxylaten
EMI6.2
omvatten cyclopentaan-cis, cyclopentadienide-pentacarboxylaten, 2, cis, dicarboxylaten, 2, 1, en carboxymethylderiva- ten van polyhydrische alcoholen zoals sorbitol, mannitol en xylitol. Aromatische polycarboxylaten omvatten mellitinezuur, pyromellitinezuur en de ftaalzuurderivaten die zijn beschreven in het Britse octrooi no. 1. 425. 343.
Van de bovengenoemde zijn polycarboxylaten die de voorkeur genieten hydroxycarboxylaten die maximaal drie carboxylgroepen per molecuul bevatten, meer in het bijzonder citraten en citroenzuur.
Ook de stamzuren van de monomere of oligomere polycarboxylaat-chelaatvormende middelen of mengsels daarvan met hun zouten, b. v. citroenzuur of citraat/citroenzuur-mengsels worden als bestanddelen van vormingssystemen van fase A volgens de onderhavige uitvinding beoogd.
In gebied A kan een aanslagwerend middel aanwezig zijn. Geschikte aanslagwerende middelen zijn EDHP (hydroxye- thyleen-l, l-difosfonaat) en Bayhibit (2-fosfonobutaan-l, 2, 4-
<Desc/Clms Page number 7>
tricarbonzuur) en ook geschikt zijn polymeren zoals Alcosperse 240 zoals in US 5. 956. 855 en US 5. 547. 612 wordt beschreven. Als alternatief kunnen ook polymeren en copolymeren van acrylzuur met een molecuulgewicht tussen 500 en 20. 000 worden gebruikt. Aanslagwerende middelen zijn in zodanige niveaus aanwezig, dat 1-100 dpm bij een spoeling van 5 liter wordt afgegeven.
Bij voorkeur is in gebied A een oppervlakte-actiefmiddelsysteem aanwezig dat een oppervlakte-actief middel omvat dat uit niet-ionische, anionische, kationische, amfolytische en zwitterionische oppervlakte-actieve middelen alsmede mengsels daarvan is gekozen.
Het oppervlakte-actiefmiddelsysteem omvat met de meeste voorkeur een gering schuimend niet-ionisch oppervlakte-actief middel dat is gekozen voor het bevochtigende vermogen en bij voorkeur is gekozen uit ethoxygroepen en/of propoxygroepen houdende niet-ionische oppervlakte-actieve middelen en met meer voorkeur is gekozen uit niet-ionische ethoxy/propoxy-vetalcoholen als oppervlakte-actieve middelen.
Het oppervlakte-actiefmiddelsysteem is gewoonlijk in gebied A aanwezig bij een minimaal niveau van 0, 05 g en met meer voorkeur bij een minimaal niveau van 0, 1 g. Het maximale voorkeursniveau ligt bij voorkeur bij 0, 8 g of lager en liever bij 0, 6 g of lager. Het niveau dat de meeste voorkeur geniet, is 0, 2 g tot 0, 4 g. Het verdient zeer de voorkeur dat het niveau aan oppervlakte-actief middel, in het bijzonder niet-ionisch oppervlakte-actief middel, 25 gew. % tot 75 gew. % ten opzichte van het totale gewicht van het niet-ionische oppervlakte-actieve middel in de tablet bedraagt.
Er kunnen hydrotrope middelen aanwezig zijn, waarbij deze gewoonlijk aanwezig zijn bij niveaus van 0, 5 gew. % tot 20 gew. % en bij voorkeur 1 gew. % tot 10 gew. %.
Bruikbare hydrotrope middelen omvatten natrium-, kalium- en ammonium-xyleensulfonaten, natrium-, kalium- en ammonium-tolueensulfonaat, natrium-, kalium- en ammonium-
<Desc/Clms Page number 8>
cumeensulfonaat alsmede mengsels daarvan.
In een zeer de voorkeur genietend aspect van de uitvinding zal gebied A een pH als l%'s oplossing in gedestilleerd water bij 20 C lager dan 7, bij voorkeur 0, 5 tot 6, 5 en het liefst 0, 5 tot 1, 0 hebben.
Gebied B Vormend materiaal
Een samenstelling volgens de uitvinding kan een vormend middel bevatten. Het vormende middel kan een fosfaat-of niet-fosfaathoudend vormend middel zijn.
Samenstellingen volgens de uitvinding die een wateroplosbaar fosfaat-vormend middel omvatten, bevatten gewoonlijk dit vormende middel bij een niveau van 50 tot 90 gew. % en bij voorkeur 55 tot 80 gew. %.
Bijzondere voorkeur genieten fosfaat-vormende middelen. Specifieke voorbeelden van wateroplosbare fosfaatvormende middelen zijn alkalimetaaltripolyfosfaten, natrium- , kalium- en ammoniumpyrofosfaat, natrium-, kalium- en ammoniumorthofosfaat, natrium-polymeta/fosfaat waarbij de polymerisatiegraad in het bereik van 6 tot 21 ligt alsmede zouten van fytinezuur. Natrium- of kalium-tripolyfosfaat geniet de meeste voorkeur.
Samenstellingen volgens de uitvinding kunnen een wateroplosbaar niet-fosfaat-vormend middel omvatten. Dit is gewoonlijk aanwezig in een niveau van 1 tot 90 grew. %, bij voorkeur 10 tot 80 gew. % en het liefst 20 tot 70 gew. % ten opzichte van het gewicht van de samenstelling. Geschikte voorbeelden van niet-fosforhoudende anorganische vormende middelen omvatten wateroplosbare alkalimetaalcarbonaten,
EMI8.1
- ten met inbegrip van gelaagde silicaten zoals SKS-6, b. Clarent,-metasilicaten en kristallijne en amorfe alumino- silicaten. Specifieke voorbeelden omvatten natriumcarbonaat (met of zonder calciet-kiemen), kaliumcarbonaat, natrium- en kaliumwaterstofcarbonaat, silicaten met inbegrip van gelaagde silicaten en zeolieten.
<Desc/Clms Page number 9>
Organische reinigingsmiddelvormende middelen kunnen eveneens als niet-fosfaathoudende vormende middelen volgens de onderhavige uitvinding worden gebruikt. Voorbeelden van organische vormende middelen omvatten alkalimetaalcitraten,
EMI9.1
- boxylaten,-nitrilotriacetaten,-oxydisuccinaten,-alkyl-en - oxysuccinaten,-ethyleendiaminetetra-acetaten,-tartraatmonosuccinaten,-tartraat-disuccinaten,-tartraat-monoacetaten,-tartraat-diacetaten, geoxideerd zetmeel, geoxideerde heteropolymere polysachariden, polyhydroxysulfonaten, polycarboxylaten zoals polyacrylaten, polymaleaten, polyacetaten, polyhydroxyacrylaten, polyacrylaat/polymaleaat-en polyacrylaat/polymethacrylaat-copolymeren, acrylaat/maleaat/vinylalcohol-terpolymeren, aminopolycarboxylaten en polyacetaalcarboxylaten, alsmede polyaspartaten en mengsels daarvan.
Dergelijke carboxylaten worden beschreven in de USoctrooien nos. 4. 144. 226, 4. 146. 495 en 4. 686. 062. Alkalimetaalcitraten, nitrilotriacetaten, oxydisuccinaten, acryaat/maleaat-copolymeren en acrylaat/maleaat/vinylalco- hol-tertpolymeren zijn bijzondere voorkeur genietende nietfosfaathoudende vormende middelen.
Siliciumoxide-materiaal
Geschikte vormen van siliciumoxide omvatten amorf siliciumoxide, zoals geprecipiteerd siliciumoxide, pyrogeen siliciumoxide en siliciumoxide-gelen, zoals-hydrogelen, - xerogelen en-a rogelen, of de zuivere kristalvormen kwarts, tridymiet en kristobaliet, maar de amorfe vormen van siliciumoxide genieten de voorkeur. Geschikte siliciumoxiden kunnen gemakkelijk in de handel verkregen worden. Ze worden bijvoorbeeld onder de geregistreerde handelsnaam Gasil 200 (b. v. Crosfield, GB) verkocht.
Bij voorkeur is het siliciumoxide in het product in een zodanige vorm aanwezig, dat het kan oplossen wanneer het aan de wasvloeistof wordt toegevoegd. Daarom geniet toevoeging van siliciumoxide als toevoeging van schuimwerende
<Desc/Clms Page number 10>
siliciumoxidedeeltjes en siliconenolie geen voorkeur.
De deeltjesgrootte van het siliciumoxide-materiaal volgens de onderhavige uitvinding kan van belang zijn, in het bijzonder aangezien men gelooft dat enig siliciumoxidemateriaal dat bij de wasprocedure niet-opgelost blijft, zieh in een later stadium op het glas kan afzetten.
Derhalve geniet het de voorkeur dat een siliciumoxide-materiaal wordt gebruikt met een deeltjesgrootte (zoals bepaald met een Malvern-laser, d. w. z. de"geaggre- geerde" deeltjesgrootte) van maximaal 40 p. m en met de meeste voorkeur maximaal 20 m, waarbij betere wasresultaten worden verkregen. Met het oog op toevoeging aan een reinigingssamenstelling geniet het de voorkeur dat de deeltjes-
EMI10.1
grootte van het siliciumoxide-materiaal ten minste l} met meer voorkeur ten minste 2 jum en het liefst ten minste 5 jim bedraagt.
Bij voorkeur is de primaire deeltjesgrootte van het siliciumoxide in het algemeen kleiner dan ca. 30 nm en in het bijzonder kleiner dan ca. 25 nm. Bij voorkeur is de elementaire deeltjesgrootte kleiner dan 20 nm of zelfs 10 nm. Er is geen kritieke ondergrens voor de elementaire deeltjesgrootte : de ondergrens wordt bepaald door andere factoren zoals de bereidingswijze, enz. In het algemeen hebben in de handel verkrijgbare siliciumoxiden een elementaire deeltjesgrootte van 1 nm of meer.
Bij voorkeur is het siliciumoxide-materiaal in de wasvloeistof aanwezig in een niveau van ten minste 2, 5x10-4 gew. %, met meer voorkeur ten minste 12, 5x10-4 gew. % en met de meeste voorkeur ten minste 2, 5x10-3 gew. % ten opzichte van het gewicht van de wasvloeistof en bij voorkeur maximaal 1#10-1 gew. %, met meer voorkeur maximaal 8x10-2 gew. % en met de meeste voorkeur maximaal 5x10-2 gew. % ten opzichte van het gewicht van de wasvloeistof.
Bij voorkeur bedraagt het niveau aan opgelost siliciumoxide-materiaal in de wasvloeistof ten minste 80 dpm, liever ten minste 100 dpm en het liefst ten minste 120 dpm
<Desc/Clms Page number 11>
en bij voorkeur maximaal 1000 dpm. Opgemerkt wordt dat opdat het siliciumoxide-materiaal effectief is, het laagste niveau van het opgeloste siliciumoxide-materiaal van de pH-waarde afhangt, d. w. z. dat derhalve bij pH=6, 5 het niveau bij voorkeur ten minste 100 dpm, bij pH=7, 0 bij voorkeur ten minste 110 dpm, bij pH=7, 5 bij voorkeur ten minste 120 dpm, bij pH=9, 5 bij voorkeur ten minste 200 dpm, bij pH=10 bij voorkeur ten minste 300 dpm en bij pH=10, 5 bij voorkeur ten minste 400 dpm bedraagt.
Bij voorkeur is het siliciumoxide-materiaal in de reinigingssamenstelling aanwezig in een niveau van ten minste 0, 1 gew. %, met meer voorkeur ten minste 0, 5 gew. % en met de meeste voorkeur ten minste 1 gew. % ten opzichte van het gewicht van de reinigingssamenstelling en bij voorkeur maximaal 10 gew. %, met meer voorkeur maximaal 8 gew. % en met de meeste. voorkeur maximaal 5 gew. % ten opzichte van het gewicht van de reinigingssamenstelling.
Silicaten
De samenstelling omvat optioneel alkalimetaalsilicaten. Het alkalimetaal kan voorzien in een pH-regelend vermogen, in bescherming tegen corrosie van metalen en tegen aantasting van het vaatwerk, met inbegrip van voordelen voor porselein en glaswaren. Wanneer silicaten aanwezig zijn, moet het Si02-gehalte 1 gew. % tot 25 gew. %, bij voorkeur 2 gew. % tot 20 gew. % en met meer voorkeur 3 gew. % tot 10 gew. % op basis van het gewicht van het ADD zijn. De verhouding van Si02 ten opzichte van het alkalimetaaloxide (M2O, waarin M=alkalimetaal) is gewoonlijk 1 : 3, 5, bij voorkeur 1, 6 : 3 en met meer voorkeur 2 : 2, 8. Bij voorkeur is het alkalimetaalsilicaat water bevattend, met 15% tot 25% en met meer voorkeur 17% tot 20% water.
In het algemeen kunnen sterk alkalische alkalimetaalsilicaten worden gebruikt, hoewel minder alkalische waterhoudende alkalimetaalsilicaten met een Si02/M20-ver- houding van 2, 0 tot 2, 4, zoals vermeld is, bijzonder veel voorkeur genieten. Watervrije vormen van alkalimetaalsilica-
<Desc/Clms Page number 12>
ten met een Si02/M2O-verhouding van 2, 0 of meer genieten ook minder voorkeur omdat deze de neiging hebben aanzienlijk minder oplosbaar te zijn dan waterhoudende alkalimetaalsilicaten bij dezelfde verhouding.
Natrium- en kalium- en in het bijzonder natriumsilicaten genieten de voorkeur. Een bijzondere voorkeur genietend alkalimetaalsilicaat is een granulair waterhoudend natriumsilicaat met een Si02/Na20-verhouding van 2, 0 tot 2, 4, dat onder de naam Britesil H20 en Britesil H24 bij de firma PQ verkrijgbaar is. De meeste voorkeur verdient een granulair waterhoudend natriumsilicaat met een Si02/Na20- verhouding van 2, 0.
Hoewel gebruikelijke vormen, d. w. z. poeder en granulaten, van waterhoudende silicaatdeeltjes geschikt zijn, hebben silicaatdeeltjes die de voorkeur
EMI12.1
genieten een gemiddelde deeltjesgrootte tussen 300 en 900 am en is minder dan 40% kleiner'dan 150 pLm en minder dan 5% groter dan 1700 Bijzondere voorkeur geniet een sili- caatdeeltje met een gemiddelde deeltjesgrootte tussen 400 en 700 Mm en is minder dan 20% kleiner dan 150 m en minder dan 1% groter dan 1700 ktm. Samenstellingen volgens de onderhavige uitvinding met een pH van 9 of minder zullen bij voorkeur in hoofdzaak geen alkalimetaalsilicaat bevatten.
Enzymen
In samenstellingen volgens de uitvinding kunnen enzymen aanwezig zijn. Voorbeelden van enzymen die voor gebruik in reinigingssamenstellingen volgens de onderhavige uitvinding geschikt zijn, omvatten lipasen, peptidasen, amylasen (amilolytische enzymen) en andere enzymen die biochemische verontreinigingen en vlekken die bij reinigingssituaties worden aangetroffen, afbreken, modificeren of de afbraak of modificatie vergemakkelijken, zodat de verontreinigingen en vlekken gemakkelijker van het voorwerp dat wordt afgewassen worden verwijderd en de verontreinigingen en vlekken beter bij een volgende reiningsstap kunnen worden verwijderd. Door zowel afbraak als modificatie kan het
<Desc/Clms Page number 13>
verwijderen van verontreiniging worden verbeterd.
Welbekende en de voorkeur genietende voorbeelden van deze enzymen zijn lipasen, amylasen en proteasen. De meest algemeen in vaatwasmachinesamenstellingen gebruikte enzymen zijn amylolytische enzymen. Bij voorkeur bevat een samenstelling volgens de uitvinding ook een proteolytisch enzym.
De enzymen kunnen aanwezig zijn bij een hoeveelheid in gew. % van 0, 2 tot 7 gew. %. Voor amylolytische enzymen zal de eindsamenstelling een amylolytische activiteit van 102 tot 106 maltose-eenheden/kg hebben. Voor proteolytische enzymen zal de eindsamenstelling een proteolytische enzymactiviteit van 106 tot 109 glycine-eenheden/kg hebben.
Bleekmateriaal
Optioneel en bij voorkeur kunnen aan een samenstelling voor gebruik bij werkwijzen volgens de onderhavige uitvinding bleekmaterialen worden toegevoegd. Deze materialen kunnen in de vaste vorm of in de vorm van ingekapselde materialen en met minder voorkeur in opgeloste vorm worden toegevoegd.
Het bleekmateriaal kan een chloor of broom afgevend middel of een perzuurstofverbinding zijn. Bleekmaterialen op basis van perzuurstofverbindingen genieten evenwel de voorkeur.
Organische peroxyzuren of voorloperproducten daarvan worden gewoonlijk als het bleekmateriaal gebruikt. Bij de onderhavige uitvinding bruikbare peroxyzuren zijn vaste en bij voorkeur in hoofdzaak in water niet-oplosbare verbindingen. Met "bij voorkeur in hoofdzaak in water niet-oplosbaar" wordt in de onderhavige beschrijving een oplosbaarheid in water lager dan ca. 1 gew. % bij omgevingstemperatuur bedoeld. In het algemeen zijn ten minste 7 koolstofatomen bevattende peroxyzuren voldoende onoplosbaar in water voor gebruik bij de onderhavige uitvinding.
Eveneens worden gebruikelijk anorganische perzuurstof vormende verbindingen als bleekmateriaal volgens de onderhavige uitvinding gebruikt. Voorbeelden van deze materialen
<Desc/Clms Page number 14>
zijn monopersulfaat-, perboraat-monohydraat-, perboraat-te- trahydraat-en percarbonaatzouten.
Bij de onderhavige uitvinding bruikbare monoperoxyzuren omvatten alkylperoxyzuren en arylperoxyzuren zoals peroxybenzoëzuur en in de ring gesubstitueerde peroxybenzoëzu-
EMI14.1
ren (b. alifatische en gesubstitueerde alifatische monoperoxyzuren (b. en peroxystearinezuur), alsmede ftaloylamidoperoxycapronzuur (PAP).
Gebruikelijke bij de onderhavige uitvinding bruikbare diperoxyzuren omvatten alkyldiperoxyzuren en aryldiper-
EMI14.2
oxyzuren, zoals 1, diperoxyazelaïnezuur, diperoxybrassylinezuur, diperoxyseba- cinezuur en diperoxyisoftaalzuur alsmede 2-decyldiperoxybu- taan-l, 4-dizuur.
In de techniek zijn peroxyzuur-bleekmiddelvoorloperproducten welbekend. Als niet-beperkende voorbeelden kunnen N, N, N', N'-tetra-acetylethyleendiamine (TAED), natriumnonanoyloxybenzeensulfonaat (SNOBS), natrium-benzoyloxyben- zeensulfonaat (SBOBS) en het in US-A-4. 751. 015 beschreven kationische peroxyzuur-voorloperproduct (SPCC) worden genoemd.
Indien naar wens een bleekmiddelkatalysator, zoals
EMI14.3
het mangaancomplex, b. Mn-Me TACN, dat is beschreven in EP-A-0. of de sulfoniminen volgens US-A-5. en US-A-5. toegevoegd moet worden, kan dit worden toegevoegd in de vorm van een tweede ingekapseld materiaal afzonderlijk van de bleekmiddelcapsule of-granule. Eveneens kunnen kobalt-katalysatoren gebruikt worden.
Onder de geschikte reactieve oxidatiematerialen op basis van chloor of broom zijn heterocyclische N-broom-en N-chloorimiden zoals trichloorisocyanuurzuur, tribroomisocyanuurzuur, dibroomisocyanuurzuur en dichloorisocyanuurzuur alsmede zouten daarvan met kationen die deze verbindingen in water doen oplossen, zoals kalium-en natrium-kationen.
Hydantoïne-verbindingen zoals 1,3-dichloor-5,5dimethylhydantoïne zijn eveneens zeer qeschikt.
<Desc/Clms Page number 15>
Eveneens geschikt voor gebruik bij de onderhavige uitvinding zijn deeltjesvormige, wateroplosbare watervrije
EMI15.1
anorganische zouten zoals lithium-, pochloriet en-hypobromiet. Ook geschikte bleekmiddelmate- rialen zijn chloorhoudend trinatriumfosfaat en chloorisocyanuraten.
Inkapselingstechnieken zijn bekend voor zowel perzuurstof- als chloorbleekmiddelen, b. v zoals beschreven in
EMI15.2
US-A-4. US-A- 4. en EP-A-0. Inkapselingstechnieken zijn echter bijzonder toepasbaar wanneer gebruik wordt gemaakt van bleekmiddelsystemen op basis van een halogeen.
Samenstellingen volgens de uitvinding kunnen ca. 0, 5% tot ca. 3% avCl (beschikbaar chloor) aan chloorbleekmiddelen omvatten. Voor perzuurstofbleekmiddelen is een geschikt bereik eveneens 0, 5% tot 3% avO (beschikbare zuurstof). Bij
EMI15.3
voorkeur is de hoeveelheid bleekmateriaal in de wasvloeistof ten minste 12, en maximaal 0, ten opzichte van de vloeistof.
Oppervlakte-actief materiaal
Bij voorkeur aanwezig in de samenstelling is een oppervlakte-actiefmiddelsysteem dat een oppervlakte-actief middel omvat dat uit niet-ionische, anionische, kationische, amfolytische en zwitterionische oppervlakte-actieve middelen alsmede mengsels daarvan is gekozen.
Gewoonlijk is het oppervlakte-actieve middel een gering tot niet schuimend niet-ionisch oppervlakte-actief middel, dat een niet-ionisch alkoxy-oppervlakte-actief middel omvat waarin de alkoxyeenheid wordt gekozen uit de groep die wordt gevormd door ethyleenoxide, propyleenoxide en mengsels daarvan en het oppervlakte-actieve middel bij voorkeur wordt gebruikt om het reinigingsvermogen te verbeteren zonder bovenmatig schuimen.
Voorbeelden van geschikte niet-ionische oppervlakteactieve middelen voor gebruik bij de uitvinding zijn gering
<Desc/Clms Page number 16>
tot niet schuimende ethoxyalcoholen met rechte ketens uit de serie Plurafac@ LF die worden verkocht door de firma BSF, die uit de serie Synperonic RA, die door ICI worden verkocht en die uit de serie Triton@ DF, die door de firma Rohm & Haas worden verkocht.
Andere oppervlakte-actieve middelen zoals anionische oppervlakte-actieve middelen kunnen gebruikt worden maar kunnen de bijkomende aanwezigheid van een schuimwerend middel vereisen om schuimvorming te onderdrukken. Wanneer een anionisch oppervlakte-actief middel wordt gebruikt, is het met voordeel aanwezig in een niveau van 2 gew. % of minder.
Wateroplosbare polymere polycarboxylverbindingen
Met voordeel is er een wateroplosbare polymere polycarboxylverbinding in de vaatwassamenstelling aanwezig. Bij voorkeur zijn deze verbindingen homo- of copolymeren van polycarboxylverbindingen, in het bijzonder copolymere verbindingen waarin het zuurmonomeer twee of meer carboxylgroepen, door niet meer dan twee koolstofatomen gescheiden, omvat. Eveneens kunnen zouten van deze stoffen worden gebruikt.
Polymere polycarboxylaten die bijzondere voorkeur genieten, zijn copolymeren die zijn afgeleid van monomeren van acrylzuren en maleinezuur. Het gemiddelde molecuulgewicht van deze polymeren in de zuurvorm ligt bij voorkeur in het bereik van 4000 tot 70. 000.
Een ander type polymere polycarboxylverbindingen dat geschikt is voor gebruik in een samenstelling volgens de uitvinding wordt gevormd door homopolymere polycarbonzuurverbindingen met acrylzuur als de monomeereenheid. Het gemiddelde molecuulgewicht van dergelijke homopolymeren in de zuurvorm ligt bij voorkeur in het bereik van 1000 tot 100. 000 en in het bijzonder van 3000 tot 10. 000.
Acrylsulfonpolymeren zoals beschreven in EP 851. 022 (Unilever) zijn eveneens geschikt.
Bij voorkeur is dit polymeermateriaal aanwezig in een
<Desc/Clms Page number 17>
niveau van ten minste 0, 1 gew. % en met meer voorkeur in niveaus van 1 gew. % tot 7 gew. % ten opzichte van het totale gewicht van de samenstelling.
Cheleermiddel
In de samenstelling kan een cheleermiddel aanwezig zijn. Indien dit aanwezig is, verdient het de voorkeur dat het niveau van het cheleermiddel 0, 5 tot 3 gew. % ten opzichte van het totale gewicht van de samenstelling bedraagt.
De voorkeur genietende cheleermiddelen omvatten organische fosfonaten, aminocarboxylaten, polyfunctioneel gesubstitueerde verbindingen en mengsels daarvan.
Bijzondere voorkeur genietende cheleermiddelen zijn
EMI17.1
organische fosfonaten zoals a-hydroxy-2-fenylethyldifosfonaat, ethyleendifosfonaat, hydroxy-l. deen-l, en hydroxyethyleen-l. meeste voorkeur verdienen hydroxyethyleen-l, en 2-fosfonobu- l-hexylideen-vinyli-taan-l, 2, 4-tricarbonzuur.
Middelen tegen glansverlies
Ook kunnen middelen tegen glansverlies zoals benzotriazool en de middelen die zijn beschreven in EP 723. 577 (Unilever) worden toegevoegd.
Optionele bestanddelen
Optionele bestanddelen zijn bijvoorbeeld buffermiddelen, reductiemiddelen, b. v. boraten, alkalimetaalhydroxide en de welbekende enzymstabiliseermiddelen zoals polyalcoholen, b. v. glycerol en borax ; aanslagwerende middelen, kristalgroeiremmers, drempelmiddelen, verdikkingsmiddelen, geurstoffen en kleurstoffen en dergelijke.
Reductiemiddelen kunnen bijvoorbeeld worden gebruikt om het verschijnen van een enzym-deactiverende concentratie van een oxidatieve bleekmiddelverbinding te voorkomen.
Geschikte middelen omvatten reductieve zwaveloxyzuren en
<Desc/Clms Page number 18>
zouten daarvan. Vanwege de beschikbaarheid, de lage kostprijs en hoge werking genieten alkalimetaal-en ammoniumzouten van zwaveloxyzuren met inbegrip van ammoniumsulfiet
EMI18.1
( zSOg), natriumsulfiet (NaSO), (NaHS03), natriummetabisulfiet (NazSOs), kaliummetabisulfiet (KzSzOs), lithiumhydrosulfiet (Li2S204), de voorkeur, waarbij natriumsulfiet bijzondere voorkeur geniet. Nog een bruikbaar reductiemiddel is ascorbinezuur, hoewel het vanwege de kostprijs geen bijzondere voorkeur verdient. De hoeveelheid te gebruiken reductiemiddelen kan van geval tot geval variëren afhankelijk van het soort bleekmiddel en de vorm die dit heeft, maar gewoonlijk zal een bereik van ca.
0, 01 gew. % tot ca. 1, 0 gew. % en bij voorkeur ca. 0, 02 gew. % tot ca. 0, 5 gew. % voldoende zijn. pH van de wasvloeistof
De uitvinding heeft betrekking op werkwijzen voor het afwassen in mechanische vaatwasmachines waarbij de wasvloeistof een lage pH heeft. Met" lage pH" wordt in de onderhavige beschrijving bedoeld dat de pH van de wasvloeistof bij voorkeur hoger is dan ca. 6, 5, met meer voorkeur 7, 5 of hoger en het liefst 8, 5 of hoger. Bij voorkeur is de pH lager dan ca. 11, met meer voorkeur lager dan ca. 10 en liever lager dan ca. 9, 5. Het meest voordelige pH-bereik is 8, 5 tot 10, 5.
Temperatuur van de afwaswerkwijze
De onderhavige uitvinding heeft bij voorkeur betrekking op werkwijzen voor het mechanisch afwassen van vuile artikelen met een wasvloeistof bij een temperatuur lager dan 55 C.
De uitvinding zal thans door de volgende niet-beperkende voorbeelden worden geillustreerd.
Alle percentages (gew. %) zijn op basis van het gewicht.
<Desc/Clms Page number 19>
EMI19.1
<tb>
<tb>
Product <SEP> 1 <SEP> Gew. <SEP> dln
<tb> Gebied <SEP> A
<tb> Citroenzuur
<tb> 15% <SEP> Niet-ionisch <SEP> LF <SEP> 400 <SEP> S <SEP> v. <SEP> BSAF <SEP> 2,2
<tb> EHDP <SEP> of <SEP> Bayhibit <SEP> AM <SEP> 1
<tb> Koolwaterstofwas-smp. <SEP> 58 C <SEP> 6, <SEP> 8 <SEP>
<tb> Gebied <SEP> B
<tb> Natrium-tripolyfosfaat <SEP> 55, <SEP> 54 <SEP>
<tb> Natrium-disilicaat <SEP> 10, <SEP> 41 <SEP>
<tb> - <SEP> Sokalan <SEP> PA <SEP> 25CL <SEP> (polyacrylaat <SEP> met <SEP> 3, <SEP> 1 <SEP>
<tb> laag <SEP> molecuulgewicht)
<tb> 85% <SEP> TAED <SEP> 2, <SEP> 4 <SEP>
<tb> EHDP <SEP> of <SEP> Bayhibit <SEP> AM <SEP> 0, <SEP> 4 <SEP>
<tb> Natriumperboraat <SEP> 9
<tb> Niet-ionisch <SEP> LF <SEP> 403 <SEP> v. <SEP> BASF <SEP> 1
<tb> Enzymen <SEP> (Savinade/Amylase <SEP> 1 <SEP> :
<SEP> 1- <SEP> 3, <SEP> 1 <SEP>
<tb> gew. <SEP> mengsel) <SEP>
<tb> BTA <SEP> (benzotriazool) <SEP> 0, <SEP> 05 <SEP>
<tb>
Bovenstaand testregiemproduct 1 (gebied A & B) in een totale dosering van 25 g.
Geen zout of spoelhulpmiddel extra aan de machine toegevoegd.
Product 2 gebied B is 21, 25 g + 3 ml afzonderlijk spoel-- hulpmiddel, geregenereerde ionenwisselaar.
Product 3 : referentieproduct met gebruikmaking van een geregenereerde ionenwisselaar en standaardproducten (een tablet Sun en spoelhulpmiddel zoals in Frankrijk verkocht).
<Desc/Clms Page number 20>
Afwasmachine : Miele G685 550 universeel programma, 10 achtereenvolgende afwasbeurten. Vlek- en filmvorming subjectief bepaald na 10 afwasbeurten. Lage uitslagen zijn de beste.
EMI20.1
<tb>
<tb>
Filmvorming <SEP> Vlekvorming
<tb> Resultaten <SEP> : <SEP> Product <SEP> 1 <SEP> 2 <SEP> 2, <SEP> 1
<tb> Product <SEP> 2 <SEP> 1, <SEP> 8 <SEP> 2, <SEP> 3 <SEP>
<tb> Product <SEP> 3 <SEP> 1, <SEP> 9 <SEP> 2, <SEP> 4 <SEP>
<tb>
Er werden geen significante verschillen gevonden.
EMI20.2
<tb>
<tb>
Product <SEP> 4 <SEP> Gew. <SEP> dln
<tb> Gebied <SEP> A
<tb> Citroenzuur <SEP> 5 <SEP>
<tb> 15% <SEP> Niet-ionisch <SEP> LF <SEP> 400 <SEP> S <SEP> v. <SEP> BSAF <SEP> 2, <SEP> 2
<tb> EHDP <SEP> of <SEP> Bayhibit <SEP> AM <SEP> 0, <SEP> 2
<tb> PEG <SEP> 6000 <SEP> 5, <SEP> 6
<tb> Acumer <SEP> 3100 <SEP> v. <SEP> Rohm <SEP> & <SEP> Haas <SEP> 1, <SEP> 0 <SEP>
<tb> Bekleding* <SEP> 1, <SEP> 0 <SEP>
<tb> Gebied <SEP> B
<tb> Natrium-tripolyfosfaat <SEP> 55, <SEP> 54 <SEP>
<tb> Natrium-disilicaat <SEP> 10, <SEP> 41 <SEP>
<tb> Sokalan <SEP> PA <SEP> 25CL <SEP> (polyacrylaat <SEP> met <SEP> 3, <SEP> 1 <SEP>
<tb> laag <SEP> molecuulgewicht)
<tb> 85% <SEP> TAED <SEP> 2, <SEP> 4 <SEP>
<tb> EHDP <SEP> of <SEP> Bayhibit <SEP> AM <SEP> 0, <SEP> 4 <SEP>
<tb>
<Desc/Clms Page number 21>
EMI21.1
<tb>
<tb> Natriumperboraat <SEP> 9
<tb> Niet-ionisch <SEP> LF <SEP> 403 <SEP> v.
<SEP> BASF <SEP> 1
<tb> Enzymen <SEP> (Savinade/Amylase <SEP> 1 <SEP> : <SEP> 1- <SEP> 3, <SEP> 1 <SEP>
<tb> gew. <SEP> mengsel)
<tb> BTA <SEP> (benzotriazool) <SEP> 0,05
<tb>
De bekleding wordt op gebied A gesproeid. Deze omvat een 2 : 1-verhouding van polymeer AEA (v. Sankyo) en Mawiol 5088 (v. Clariant) Bovenstaand testregiemproduct 4 (gebied A & B) in een totale dosering van 25 g. Geen zout of spoelhulpmiddel extra aan de machine toegevoegd.
Product 5 alleen gebied B bij 21, 25 g + 3 ml afzonderlijk spoelhulpmiddel (Sun uit Frankrijk), geregenereerde ionenwisselaar.
Product 6 : referentieproduct met gebruikmaking van een geregenereerde ionenwisselaar en standaardproducten (een tablet Sun en spoelhulpmiddel uit Frankrijk).
Afwasmachine : Miele G685 550 universeel programma, 10 achtereenvolgende afwasbeurten. Vlek- en filmvorming subjectief bepaald na 10 afwasbeurten. Lage uitslagen zijn de beste.
EMI21.2
<tb>
<tb>
Filmvorming <SEP> Vlekvorming
<tb> Resultaten <SEP> : <SEP> Product <SEP> 4 <SEP> 2 <SEP> 2, <SEP> 3 <SEP>
<tb> Product <SEP> 5 <SEP> 1, <SEP> 8 <SEP> 2, <SEP> 3 <SEP>
<tb> Product <SEP> 6 <SEP> 1, <SEP> 9 <SEP> 2, <SEP> 4 <SEP>
<tb>
Er werden geen significante verschillen gevonden.
<Desc / Clms Page number 1>
Use of dishwashing compositions.
Description Technical field
The present invention relates to the field of machine dishwashing. More particularly, the invention relates to a method for using tablets for automatic dishwashing.
BACKGROUND OF THE INVENTION
Washing items in a commercially available dishwasher includes the use of three types of products. Salt is added to the salt compartment to soften the water, a dishwashing formulation is used to clean the items and a rinse aid is used to ensure that the items are rinsed without streaks or stains.
Users find it difficult to replace the salt and rinse aid in a dishwasher. The present invention relates to a dishwashing method which renders the salt and rinse aid superfluous in the machine dishwashing process.
Description of the invention
Accordingly, the present invention provides for the use of a machine dishwashing tablet in a dishwashing process in which no rinse aid and no salt is used in the machine, the tablet exceeding 45 wt. % forming agent and has a distinct defined range (A) that has a maximum of 30 wt. % of the total weight of the tablet, wherein the distinguished defined area (A) comprises a material that controls the dissolution of the area (A) in water.
<Desc / Clms Page number 2>
In addition, in the present application a method for washing articles in a mechanical washing machine is defined, which method comprises the steps of: i) treating the articles with a washing liquid to which a tablet is added that is more than 45 wt. % forming agent and has a separately defined region that has a maximum of 30 wt. % of the total weight of the tablet, the distinctly defined area comprising a material that delays its dissolution in water and wherein no additional rinse aid and / or salt is present in the machine.
In the context of the present invention, the term "additional rinse aid or salt" refers to a separate rinse aid or salt product that is not part of the tablet.
The invention also relates to a kit of parts comprising a detergent tablet as described above as well as instructions in which it is stated that no rinsing aid or salt need be added to the dishwasher.
Detailed description of the invention
Tablets according to the invention have two regions, regions A and B.
Area A
As described above, the tablet comprises a defined area (A) that is at most 30 wt. % of the total weight of the tablet and a material that controls its dissolution in water. Preferably a material is present which delays the dissolution of region A.
For purposes of the invention, the remainder of the tablet area (B) will be mentioned. The components of the defined area (A) will be added to the water in the machine after the components in the rest of the tablet (B)
<Desc / Clms Page number 3>
handed in. In another aspect of the present invention, the defined area (A) preferably dissolves at a temperature higher than 50 ° C and preferably higher than 60 ° C.
The remainder of the tablet (B) will begin to dissolve immediately upon contact with water. Preferably for region (B) at least 60%, more preferably at least 80% and most preferably at least 95% of region (B) dissolves in demineralized water at 50 ° C within 12 minutes. It is highly preferred that region A be fixed.
The dissolution of region (A) can be delayed by the selection of particulate constituents encapsulated with a constituent that slowly dissolves in water or is partially soluble. Such encapsulation materials include cellulose acetate phthalate (CAP), hydroxypropyl methyl cellulose (HPMC), carboxymethyl cellulose (CMC), and mixtures thereof. A hydroxypropyl methylcellulose polymer preferably has a number average molecular weight of 50,000 to 200,000 and a viscosity of an aqueous solution of 2 wt. % at 25 C (ADTMD2363) from 50,000 to 120,000 cps. A particularly preferred hydroxypropyl methylcellulose polymer is Methocel J75MS-N with a viscosity of an aqueous solution of 2 wt. % at 25 ° C of about 75,000 cps.
Other preferred encapsulation materials include gelatin with a coating strength in the range of 30 to 200 and preferably 75 to 200.
The thickness of the encapsulating material will determine the dissolution rate of the encapsulated detergent component and therefore determine the release rate of the detergent component to the wash water.
Another example of a manner in which the dissolution of the sub-area A can be delayed is the pre-mixing of the cleaning agent components in a matrix which slowly dissolves in water or is partially soluble.
Preferred polymers for this include polyethylene glycol with a molecular weight of 1,000 to 20,000 and more preferably
<Desc / Clms Page number 4>
4000 to 10,000 or even 12,000.
Yet another example of how the dissolution of region A can be controlled is the coating of region A with a coating layer. The coating layer preferably comprises a material which solidifies in preferably less than 15 minutes, more preferably less than 10 minutes, even more preferably less than 5 minutes and most preferably less than 60 seconds on contact with the region A. The coating layer is preferably water-soluble. Preferred coatings include materials selected from the group consisting of fatty acids, alcohols, diols, esters and ethers, adipic acid, carboxylic acids, dicarboxylic acids, polyvinyl acetate (PVA), polyvinylpyrrolidone (PVP), polyacetic acid (PLA), polyethylene glycol (PEG) and mixtures thereof. Preferred carboxylic acids and dicarboxylic acids preferably include an even number of carbon atoms.
Preferably, the carboxylic acids or dicarboxylic acids comprise at least 4, more preferably at least 6, even more preferably at least 8 carbon atoms and most preferably 8 to 13 carbon atoms. Preferred dicarboxylic acids include adipic acid, suberic acid, azelaic acid, subacic acid, undecanedioic acid, dodecanedioic acid, tridecanedioic acid and mixtures thereof. Preferred are those fatty acids that have a carbon chain length of C12 to C22 and most preferably C18 to C22. The coating layer may also preferably comprise a breaker.
Suitable coatings for region A are described in WO 00/06684, JP 61-28440, JP 60-141705, JP 61-28441, JP 61-28596, JP 61-28597 and JP 61-28598.
If present, the coating layer generally comprises a level of at least 0.05%, preferably at least 0.01%, more preferably at least 1% and most preferably at least 2% or even at least% of the detergent tablet.
The coating can be used to bind region A to region B.
In yet another example, area A is such that
<Desc / Clms Page number 5>
it comprises at least one component that reacts with an external stimulus, such as temperature and pH, to start the dissolution. An example of a component that causes dissolution to begin in response to a change in temperature is a wax. In particular, it is contemplated that a suitable wax will have a melting temperature higher than the room temperature, preferably higher than 40 ° C, more preferably higher than 50 ° C, and most preferably higher than 55 ° C.
It is preferred if region A is present in the tablet.
A region A useful for the present invention may further comprise a water-soluble acid-forming agent or salt, preferably organic acids including, for example, carboxylic acids such as citric acid and succinic acid, polycarboxylic acids such as polyacrylic acid, as well as acetic acid, boric acid, malonic acid, adipic acid, fumaric acid, lactic acid , glycolic acid, tartaric acid, tartronic acid, maleic acid, derivatives and mixtures thereof.
Suitable water-soluble monomeric or oligomeric carboxylate-forming agents can be selected from a wide range of compounds, but such compounds preferably have a logarithmic acid constant of the first carboxyl group (pK1) less than 9, preferably between 2 and 8, 5 and more preferably between 2, 5 and 7, 5.
The carboxylate or polycarboxylate forming agent can be of a monomer or oligomer type, although monomeric polycarboxylates are generally preferred because of their cost and performance. Monomeric and oligomeric forming agents can be selected from acyclic, alicyclic, heterocyclic and aromatic carboxylates.
Suitable carboxylates containing a carboxyl group include water-soluble salts of lactic acid, glycolic acid, and ether derivatives thereof. Polycarboxylates containing two carboxyl groups include water-soluble salts of succinic acid, malonic acid, (ethylenedioxy) diacetic acid, maleic acid, diglycolic acid, tartaric acid, tartronic acid and
<Desc / Clms Page number 6>
fumaric acid and ether carboxylates and sulfinyl carboxylates. Polycarboxylates containing three carboxyl groups include in particular water-soluble citrates, aconitrates and citraconates as well as succinate derivatives such as carboxymethyloxysuccinates, lactoxysuccinates and amino succinates, and also oxypolycarboxylates such as 20-oxa-1, 1,3-propane tricarboxylates.
The above-described carboxylate or polycarboxylate-forming compounds can also have a dual function as pH control agents.
Polycarboxylates containing four carboxyl groups
EMI6.1
include oxydisuccinates, 1, 1, and 1, carboxylates. Polycarboxylates containing sulfo substituents include sulfosuccinate derivatives as well as sulfone-containing pyrolyzed citrates.
Alicyclic and heterocyclic polycarboxylates
EMI6.2
cyclopentane cis, cyclopentadienide pentacarboxylates, 2, cis, dicarboxylates, 2, 1, and carboxymethyl derivatives of polyhydric alcohols such as sorbitol, mannitol and xylitol. Aromatic polycarboxylates include mellitic acid, pyromellitic acid, and the phthalic acid derivatives described in U.K. Patent No. 1,452,439.
Of the aforementioned, preferred polycarboxylates are hydroxycarboxylates containing up to three carboxyl groups per molecule, more particularly citrates and citric acid.
Also the parent acids of the monomeric or oligomeric polycarboxylate chelating agents or mixtures thereof with their salts, e.g. Citric acid or citrate / citric acid mixtures are contemplated as components of Phase A forming systems of the present invention.
An anti-fogging agent may be present in area A. Suitable antifungal agents are EDHP (hydroxyethylene-1,1-diphosphonate) and Bayhibit (2-phosphonobutane-1, 2, 4
<Desc / Clms Page number 7>
tricarboxylic acid) and also suitable are polymers such as Alcosperse 240 as described in US 5,956,855 and US 5,547,612. Alternatively, polymers and copolymers of acrylic acid with a molecular weight between 500 and 20,000 can be used. Antifouling agents are present at levels such that 1-100 ppm is released at a 5 liter flush.
Preferably in region A a surfactant system is present which comprises a surfactant selected from non-ionic, anionic, cationic, ampholytic and zwitterionic surfactants as well as mixtures thereof.
The surfactant system most preferably comprises a low foaming non-ionic surfactant selected for the wetting power and preferably selected from ethoxy groups and / or propoxy groups containing non-ionic surfactants and more preferably selected from non-ionic ethoxy / propoxy fatty alcohols as surfactants.
The surfactant system is usually present in region A at a minimum level of 0.05 g and more preferably at a minimum level of 1.0 g. The maximum preferred level is preferably 0, 8 g or lower and more preferably at 0, 6 g or lower. The most preferred level is 0, 2 g to 0. 4 g. It is highly preferred that the level of surfactant, in particular nonionic surfactant, be 25 wt. % to 75 wt. % relative to the total weight of the nonionic surfactant in the tablet.
Hydrotropic agents may be present, usually present at levels of 0.5 wt. % to 20 wt. % and preferably 1 wt. % to 10 wt. %.
Useful hydrotropic agents include sodium, potassium, and ammonium xylene sulfonates, sodium, potassium, and ammonium toluene sulfonate, sodium, potassium, and ammonium.
<Desc / Clms Page number 8>
cumenesulphonate and mixtures thereof.
In a very preferred aspect of the invention, region A will have a pH as 1% solution in distilled water at 20 ° C lower than 7, preferably 0, 5 to 6, 5 and most preferably 0, 5 to 1, 0 to have.
Area B Forming material
A composition according to the invention can contain a forming agent. The forming agent can be a phosphate or non-phosphate-forming agent.
Compositions according to the invention comprising a water-soluble phosphate-forming agent usually contain this-forming agent at a level of 50 to 90 wt. % and preferably 55 to 80 wt. %.
Phosphate-forming agents are particularly preferred. Specific examples of water-soluble phosphate-forming agents are alkali metal tripolyphosphates, sodium, potassium and ammonium pyrophosphate, sodium, potassium and ammonium orthophosphate, sodium polymeta / phosphate with the degree of polymerization in the range of 6 to 21 as well as salts of phytic acid. Sodium or potassium tripolyphosphate is most preferred.
Compositions according to the invention may comprise a water-soluble non-phosphate-forming agent. This is usually present in a level of 1 to 90 grew. %, preferably 10 to 80 wt. % and preferably 20 to 70 wt. % relative to the weight of the composition. Suitable examples of non-phosphorous inorganic forming agents include water-soluble alkali metal carbonates,
EMI8.1
- including layered silicates such as SKS-6, b. Clarent, metasilicates and crystalline and amorphous alumino silicates. Specific examples include sodium carbonate (with or without calcite seeds), potassium carbonate, sodium and potassium hydrogen carbonate, silicates including layered silicates and zeolites.
<Desc / Clms Page number 9>
Organic detergent-forming agents can also be used as non-phosphate-forming agents of the present invention. Examples of organic forming agents include alkali metal citrates,
EMI9.1
- boxylates, nitrilotriacetates, oxydisuccinates, alkyl and oxysuccinates, ethylenediaminetetraacetates, tartrate monosuccinates, tartrate disuccinates, tartrate monoacetates, tartrate diacetates, oxidized starch, polysedoxysedoxysylated, polyseroxysated, polycarboxyloxate polyacrylates, polymaleates, polyacetates, polyhydroxyacrylates, polyacrylate / polymalate and polyacrylate / polymethacrylate copolymers, acrylate / maleate / vinyl alcohol terpolymers, amino polycarboxylates and polyacetal carboxylates, as well as polyaspartates and mixtures thereof.
Such carboxylates are described in U.S. Patent Nos. 4.144. 226, 4. 146. 495 and 4. 686. 062. Alkali metal citrates, nitrilotriacetates, oxydisuccinates, acrylate / maleate copolymers and acrylate / maleate / vinyl alcohol tert polymers are particularly preferred non-phosphate-forming agents.
Silicon oxide material
Suitable forms of silica include amorphous silica, such as precipitated silica, fumed silica and silica gels, such as hydrogels, xerogels, and gels, or the pure crystal forms of quartz, tridymite, and crystalloblite, but amorphous forms of silica are preferred. Suitable silicon oxides can easily be obtained commercially. For example, they are sold under the registered trade name Gasil 200 (e.g., Crosfield, GB).
Preferably, the silica is present in the product in such a form that it can dissolve when added to the wash liquor. That is why the addition of silicon oxide is added as the addition of anti-foam
<Desc / Clms Page number 10>
silica particles and silicone oil are not preferred.
The particle size of the silica material according to the present invention can be important, particularly since it is believed that any silica material that remains undissolved in the washing procedure can deposit on the glass at a later stage.
Therefore, it is preferred that a silica material is used with a particle size (as determined with a Malvern laser, i.e. the "aggregated" particle size) of up to 40 p. m and most preferably a maximum of 20 m, whereby better washing results are obtained. In view of addition to a cleaning composition, it is preferable that the particulate matter
EMI10.1
size of the silica material is at least 1 µm, more preferably at least 2 µm and most preferably at least 5 µm.
Preferably, the primary particle size of the silica is generally less than about 30 nm and in particular less than about 25 nm. The elementary particle size is preferably less than 20 nm or even 10 nm. There is no critical lower limit for the elementary particle size: the lower limit is determined by other factors such as the preparation method, etc. In general, commercially available silicon oxides have an elementary particle size of 1 nm or more.
Preferably, the silica material is present in the wash fluid at a level of at least 2.5 x 10 -4 wt. %, more preferably at least 12.5x10-4 wt. % and most preferably at least 2.5x10 -3 wt. % with respect to the weight of the washing liquid and preferably a maximum of 1 # 10-1 wt. %, more preferably a maximum of 8 x 10 -2 wt. % and most preferably a maximum of 5 x 10 -2 wt. % with respect to the weight of the washing liquid.
Preferably, the level of dissolved silica material in the wash liquor is at least 80 ppm, more preferably at least 100 ppm, and most preferably at least 120 ppm
<Desc / Clms Page number 11>
and preferably a maximum of 1000 ppm. It is noted that in order for the silica material to be effective, the lowest level of the dissolved silica material depends on the pH value, d. w. so that at pH = 6.5, the level is preferably at least 100 ppm, at pH = 7.0, preferably at least 110 ppm, at pH = 7.5, preferably at least 120 ppm, at pH = 9, 5 is preferably at least 200 ppm, at pH = 10, preferably at least 300 ppm, and at pH = 10, preferably at least 400 ppm.
Preferably, the silica material is present in the cleaning composition at a level of at least 0.1 wt. %, more preferably at least 0.5 wt. % and most preferably at least 1 wt. % with respect to the weight of the cleaning composition and preferably a maximum of 10 wt. %, more preferably a maximum of 8 wt. % and with the most. preferably a maximum of 5 wt. % relative to the weight of the cleaning composition.
Silicates
The composition optionally comprises alkali metal silicates. The alkali metal can provide a pH-adjusting ability, protection against corrosion of metals and against deterioration of the crockery, including benefits for porcelain and glassware. When silicates are present, the SiO 2 content must be 1 wt. % to 25 wt. %, preferably 2 wt. % to 20 wt. % and more preferably 3 wt. % to 10 wt. % based on the weight of the ADD. The ratio of SiO 2 to the alkali metal oxide (M 2 O, where M = alkali metal) is usually 1: 3, 5, preferably 1, 6: 3 and more preferably 2: 2, 8. Preferably the alkali metal silicate is water-containing, with 15% to 25% and more preferably 17% to 20% water.
In general, highly alkaline alkali metal silicates can be used, although fewer alkaline aqueous alkali metal silicates with an SiO 2 / M 2 O ratio of 2, 0 to 2, 4, as mentioned, are particularly preferred. Anhydrous forms of alkali metal silicate
<Desc / Clms Page number 12>
Sates with an SiO 2 / M 2 O ratio of 2, 0 or more are also less preferred because they tend to be considerably less soluble than aqueous alkali metal silicates at the same ratio.
Sodium and potassium and in particular sodium silicates are preferred. A particularly preferred alkali metal silicate is a granular aqueous sodium silicate with an SiO 2 / Na 2 O ratio of 2, 0 to 2, 4, which is available from PQ under the name Britesil H20 and Britesil H24. Most preferred is a granular aqueous sodium silicate with an SiO 2 / Na 2 O ratio of 2.0.
Although usual forms, d. w. powder and granules of silicate containing aqueous particles are suitable, silicate particles are preferred
EMI12.1
have an average particle size between 300 and 900 am and is less than 40% smaller than 150 µm and less than 5% greater than 1700 Particularly preferred is a silicate particle with an average particle size between 400 and 700 Mm and is less than 20% smaller than 150 m and less than 1% larger than 1700 ktm. Compositions of the present invention with a pH of 9 or less will preferably contain substantially no alkali metal silicate.
Enzymes
Enzymes may be present in compositions of the invention. Examples of enzymes suitable for use in cleaning compositions of the present invention include lipases, peptidases, amylases (amilolytic enzymes) and other enzymes that degrade, modify, or facilitate degradation or modification, biochemical contaminants and stains encountered in cleaning situations the contaminants and stains can be removed more easily from the object being washed and the contaminants and stains can be removed more easily during a subsequent cleaning step. It can be done through both breakdown and modification
<Desc / Clms Page number 13>
removal of pollution.
Well-known and preferred examples of these enzymes are lipases, amylases and proteases. The enzymes most commonly used in dishwashing machine compositions are amylolytic enzymes. Preferably, a composition according to the invention also contains a proteolytic enzyme.
The enzymes may be present in an amount by weight. % from 0, 2 to 7 wt. %. For amylolytic enzymes, the final composition will have an amylolytic activity of 102 to 106 maltose units / kg. For proteolytic enzymes, the final composition will have a proteolytic enzyme activity of 10 6 to 10 9 glycine units / kg.
Bleaching material
Optionally and preferably, bleaching materials may be added to a composition for use in methods of the present invention. These materials can be added in the solid form or in the form of encapsulated materials and less preferably in dissolved form.
The bleaching material can be a chlorine or bromine releasing agent or a peroxygen compound. However, bleaching materials based on peroxygen compounds are preferred.
Organic peroxyacids or precursor products thereof are usually used as the bleaching material. Peroxyacids useful in the present invention are solid and preferably substantially water-insoluble compounds. With "preferably substantially water-insoluble" in the present specification, a water solubility of less than about 1 wt. % at ambient temperature. In general, peroxy acids containing at least 7 carbon atoms are sufficiently water-insoluble for use in the present invention.
Also commonly used inorganic peroxygen-forming compounds are used as bleaching material according to the present invention. Examples of these materials
<Desc / Clms Page number 14>
are monopersulfate, perborate monohydrate, perborate tetrahydrate and percarbonate salts.
Monoperoxyacids useful in the present invention include alkyl peroxyacids and aryl peroxyacids such as peroxybenzoic acid and ring-substituted peroxybenzoic acid
EMI14.1
aliphatic and substituted aliphatic monoperoxyacids (b. and peroxystearic acid), as well as phthaloylamidoperoxycaproic acid (PAP).
Conventional diperoxy acids useful in the present invention include alkyldiperoxy acids and aryldiperoxy acids
EMI14.2
oxyacids, such as 1, diperoxyazelinic acid, diperoxybrassylic acid, diperoxysebacic acid and diperoxyisophthalic acid, and 2-decyldiperoxybutan-1,4-diacid.
Peroxyacid bleach precursor products are well known in the art. As non-limiting examples, N, N, N ', N'-tetraacetylethylenediamine (TAED), sodium nonanoyloxybenzene sulfonate (SNOBS), sodium benzoyloxybenzene sulfonate (SBOBS) and US-A-4. 751,015 described cationic peroxyacid precursor product (SPCC).
If desired, a bleach catalyst, such as
EMI14.3
the manganese complex, e.g. Mn-Me TACN, which is described in EP-A-0. or the sulfonimines according to US-A-5. and US-A-5. to be added, this can be added in the form of a second encapsulated material separate from the bleaching capsule or granule. Cobalt catalysts can also be used.
Among the suitable reactive oxidation materials based on chlorine or bromine are heterocyclic N-bromine and N-chloroimides such as trichloroisocyanuric acid, tribromoisocyanuric acid, dibromoisocyanuric acid and dichloroisisocyanuric acid as well as salts thereof with cations that dissolve these compounds in water, such as potassium and sodium cations.
Hydantoin compounds such as 1,3-dichloro-5,5-dimethylhydantoin are also very suitable.
<Desc / Clms Page number 15>
Also suitable for use with the present invention are particulate, water-soluble anhydrous
EMI15.1
inorganic salts such as lithium, pochlorite and hypobromite. Also suitable bleaching materials are chlorine-containing trisodium phosphate and chloroisocyanurates.
Encapsulation techniques are known for both peroxygen and chlorine bleaches, e.g. as described in
EMI15.2
US-A-4. US-A-4 and EP-A-0. However, encapsulation techniques are particularly applicable when using halogen bleaching agent systems.
Compositions of the invention may comprise from about 0.5% to about 3% avCl (available chlorine) of chlorine bleaches. For peroxygen bleaching agents, a suitable range is also 0.5% to 3% avO (available oxygen). Bee
EMI15.3
preferably the amount of bleaching material in the washing liquid is at least 12, and at most 0, relative to the liquid.
Surface-active material
Preferably present in the composition is a surfactant system comprising a surfactant selected from nonionic, anionic, cationic, ampholytic and zwitterionic surfactants as well as mixtures thereof.
Typically, the surfactant is a low to non-foaming non-ionic surfactant comprising a non-ionic alkoxy surfactant in which the alkoxy unit is selected from the group consisting of ethylene oxide, propylene oxide, and mixtures thereof and the surfactant is preferably used to improve cleaning performance without excessive foaming.
Examples of suitable non-ionic surfactants for use in the invention are small
<Desc / Clms Page number 16>
to non-foaming straight chain ethoxy alcohols from the Plurafac @ LF sold by BSF, those from the Synperonic RA series, sold by ICI, and those from the Triton @ DF, sold by the Rohm & Haas company.
Other surfactants such as anionic surfactants can be used but may require the additional presence of a foam inhibitor to suppress foaming. When an anionic surfactant is used, it is advantageously present in a level of 2 wt. % or less.
Water-soluble polymeric polycarboxyl compounds
Advantageously, a water-soluble polymeric polycarboxyl compound is present in the dishwashing composition. These compounds are preferably homo- or copolymers of polycarboxyl compounds, in particular copolymeric compounds in which the acid monomer comprises two or more carboxyl groups separated by no more than two carbon atoms. Salts of these substances can also be used.
Particularly preferred polymeric polycarboxylates are copolymers derived from monomers of acrylic acids and maleic acid. The average molecular weight of these polymers in the acid form is preferably in the range of 4,000 to 70,000.
Another type of polymeric polycarboxyl compounds suitable for use in a composition according to the invention is formed by homopolymeric polycarboxylic acid compounds with acrylic acid as the monomer unit. The average molecular weight of such homopolymers in the acid form is preferably in the range of 1000 to 100,000 and in particular of 3,000 to 10,000.
Acrylic sulfone polymers such as described in EP 851,022 (Unilever) are also suitable.
Preferably, this polymer material is present in one
<Desc / Clms Page number 17>
level of at least 0, 1 wt. % and more preferably in levels of 1 wt. % to 7 wt. % relative to the total weight of the composition.
Chelating agent
A chelating agent may be present in the composition. If present, it is preferred that the level of the chelating agent be 0.5, 3 to 3 wt. % relative to the total weight of the composition.
Preferred chelating agents include organic phosphonates, aminocarboxylates, polyfunctionally substituted compounds and mixtures thereof.
Particularly preferred chelating agents are
EMI17.1
organic phosphonates such as α-hydroxy-2-phenylethyl diphosphonate, ethylenediphosphonate, hydroxy-1. deen-1, and hydroxyethylene-1. most preferred are hydroxyethylene-1, and 2-phosphonobu-1-hexylidene-vinylitanium-1, 2,4-tricarboxylic acid.
Means against loss of shine
Gloss loss agents such as benzotriazole and the agents described in EP 723 577 (Unilever) can also be added.
Optional components
Optional components are, for example, buffering agents, reducing agents, e.g. borates, alkali metal hydroxide and the well-known enzyme stabilizers such as polyalcohols, e.g. glycerol and borax; antifouling agents, crystal growth inhibitors, threshold agents, thickeners, fragrances and colorants and the like.
For example, reducing agents can be used to prevent the appearance of an enzyme-deactivating concentration of an oxidative bleaching compound.
Suitable agents include reductive sulfur oxyacids and
<Desc / Clms Page number 18>
salts thereof. Due to availability, low cost and high performance, alkali metal and ammonium salts enjoy sulfur oxyacids including ammonium sulfite
EMI18.1
(zSOg), sodium sulfite (NaSO), (NaHSO 3), sodium metabisulfite (Na 2 SO 3), potassium metabisulphite (K 2 S 2 O 5), lithium hydrosulfite (Li 2 S 2 O 4), with sodium sulfite being particularly preferred. Another useful reducing agent is ascorbic acid, although it is not particularly preferred because of the cost. The amount of reducing agents to be used may vary from case to case depending on the type of bleaching agent and the form it has, but usually a range of about
0.01 wt. % to approx. 1.0 wt. % and preferably about 0.02 wt. % to about 0.5 wt. % to be enough. pH of the washing liquid
The invention relates to methods for washing dishes in mechanical dishwashing machines in which the washing liquid has a low pH. By "low pH" in the present description it is meant that the pH of the wash liquid is preferably higher than about 6, 5, more preferably 7, 5 or higher and most preferably 8, 5 or higher. Preferably the pH is lower than ca. 11, more preferably lower than ca. 10 and more preferably lower than ca. 9.5. The most advantageous pH range is 8, 5 to 10.5.
Temperature of the washing process
The present invention preferably relates to methods for mechanically washing dirty articles with a washing liquid at a temperature below 55 C.
The invention will now be illustrated by the following non-limiting examples.
All percentages (% by weight) are based on weight.
<Desc / Clms Page number 19>
EMI19.1
<tb>
<tb>
Product <SEP> 1 <SEP> Wt. <SEP> parts
<tb> Area <SEP> A
<tb> Citric acid
<tb> 15% <SEP> Non-ionic <SEP> LF <SEP> 400 <SEP> S <SEP> v. <SEP> BSAF <SEP> 2.2
<tb> EHDP <SEP> or <SEP> Bayhibit <SEP> AM <SEP> 1
<tb> Hydrocarbon wax m.p. <SEP> 58 C <SEP> 6, <SEP> 8 <SEP>
<tb> Area <SEP> B
<tb> Sodium tripolyphosphate <SEP> 55, <SEP> 54 <SEP>
<tb> Sodium disilicate <SEP> 10, <SEP> 41 <SEP>
<tb> - <SEP> Sokalan <SEP> PA <SEP> 25CL <SEP> (polyacrylate <SEP> with <SEP> 3, <SEP> 1 <SEP>
<tb> low <SEP> molecular weight)
<tb> 85% <SEP> TAED <SEP> 2, <SEP> 4 <SEP>
<tb> EHDP <SEP> or <SEP> Bayhibit <SEP> AM <SEP> 0, <SEP> 4 <SEP>
<tb> Sodium perborate <SEP> 9
<tb> Non-ionic <SEP> LF <SEP> 403 <SEP> v. <SEP> BASF <SEP> 1
<tb> Enzymes <SEP> (Savinade / Amylase <SEP> 1 <SEP>:
<SEP> 1- <SEP> 3, <SEP> 1 <SEP>
<tb> weighted <SEP> mixture) <SEP>
<tb> BTA <SEP> (benzotriazole) <SEP> 0, <SEP> 05 <SEP>
<tb>
The above test regimen product 1 (area A & B) in a total dosage of 25 g.
No extra salt or rinse aid added to the machine.
Product 2 area B is 21, 25 g + 3 ml separate rinse - tool, regenerated ion exchanger.
Product 3: reference product using a regenerated ion exchanger and standard products (a Sun tablet and rinsing aid as sold in France).
<Desc / Clms Page number 20>
Dishwasher: Miele G685 550 universal program, 10 consecutive washings. Staining and film formation subjectively determined after 10 washes. Low results are the best.
EMI20.1
<tb>
<tb>
Film formation <SEP> Staining
<tb> Results <SEP>: <SEP> Product <SEP> 1 <SEP> 2 <SEP> 2, <SEP> 1
<tb> Product <SEP> 2 <SEP> 1, <SEP> 8 <SEP> 2, <SEP> 3 <SEP>
<tb> Product <SEP> 3 <SEP> 1, <SEP> 9 <SEP> 2, <SEP> 4 <SEP>
<tb>
No significant differences were found.
EMI20.2
<tb>
<tb>
Product <SEP> 4 <SEP> Wt. <SEP> parts
<tb> Area <SEP> A
<tb> Citric acid <SEP> 5 <SEP>
<tb> 15% <SEP> Non-ionic <SEP> LF <SEP> 400 <SEP> S <SEP> v. <SEP> BSAF <SEP> 2, <SEP> 2
<tb> EHDP <SEP> or <SEP> Bayhibit <SEP> AM <SEP> 0, <SEP> 2
<tb> PEG <SEP> 6000 <SEP> 5, <SEP> 6
<tb> Acumer <SEP> 3100 <SEP> v. <SEP> Rohm <SEP> & <SEP> Haas <SEP> 1, <SEP> 0 <SEP>
<tb> Upholstery * <SEP> 1, <SEP> 0 <SEP>
<tb> Area <SEP> B
<tb> Sodium tripolyphosphate <SEP> 55, <SEP> 54 <SEP>
<tb> Sodium disilicate <SEP> 10, <SEP> 41 <SEP>
<tb> Sokalan <SEP> PA <SEP> 25CL <SEP> (polyacrylate <SEP> with <SEP> 3, <SEP> 1 <SEP>
<tb> low <SEP> molecular weight)
<tb> 85% <SEP> TAED <SEP> 2, <SEP> 4 <SEP>
<tb> EHDP <SEP> or <SEP> Bayhibit <SEP> AM <SEP> 0, <SEP> 4 <SEP>
<tb>
<Desc / Clms Page number 21>
EMI21.1
<tb>
<tb> Sodium perborate <SEP> 9
<tb> Non-ionic <SEP> LF <SEP> 403 <SEP> v.
<SEP> BASF <SEP> 1
<tb> Enzymes <SEP> (Savinade / Amylase <SEP> 1 <SEP>: <SEP> 1- <SEP> 3, <SEP> 1 <SEP>
<tb> weighted <SEP> mixture)
<tb> BTA <SEP> (benzotriazole) <SEP> 0.05
<tb>
The coating is sprayed on area A. This includes a 2: 1 ratio of polymer AEA (v. Sankyo) and Mawiol 5088 (v. Clariant) The above test control product 4 (area A & B) in a total dosage of 25 g. No extra salt or rinse aid added to the machine.
Product 5 only area B with 21, 25 g + 3 ml separate rinsing aid (Sun from France), regenerated ion exchanger.
Product 6: reference product using a regenerated ion exchanger and standard products (a Sun tablet and flushing aid from France).
Dishwasher: Miele G685 550 universal program, 10 consecutive washings. Staining and film formation subjectively determined after 10 washes. Low results are the best.
EMI21.2
<tb>
<tb>
Film formation <SEP> Staining
<tb> Results <SEP>: <SEP> Product <SEP> 4 <SEP> 2 <SEP> 2, <SEP> 3 <SEP>
<tb> Product <SEP> 5 <SEP> 1, <SEP> 8 <SEP> 2, <SEP> 3 <SEP>
<tb> Product <SEP> 6 <SEP> 1, <SEP> 9 <SEP> 2, <SEP> 4 <SEP>
<tb>
No significant differences were found.