KR20240094169A - B-세포 성숙 항원을 표적화하는 신규한 키메라 항원 수용체 및 이의 용도 - Google Patents
B-세포 성숙 항원을 표적화하는 신규한 키메라 항원 수용체 및 이의 용도 Download PDFInfo
- Publication number
- KR20240094169A KR20240094169A KR1020220174221A KR20220174221A KR20240094169A KR 20240094169 A KR20240094169 A KR 20240094169A KR 1020220174221 A KR1020220174221 A KR 1020220174221A KR 20220174221 A KR20220174221 A KR 20220174221A KR 20240094169 A KR20240094169 A KR 20240094169A
- Authority
- KR
- South Korea
- Prior art keywords
- bcma
- seq
- car
- amino acid
- cells
- Prior art date
Links
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 title claims abstract description 135
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 title claims abstract description 135
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 title claims abstract description 134
- 108010003723 Single-Domain Antibodies Proteins 0.000 title claims description 29
- 230000008685 targeting Effects 0.000 title abstract description 27
- 230000014509 gene expression Effects 0.000 claims abstract description 30
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 28
- 201000010099 disease Diseases 0.000 claims abstract description 27
- 239000000203 mixture Substances 0.000 claims abstract description 18
- 210000003719 b-lymphocyte Anatomy 0.000 claims abstract description 14
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 63
- 230000027455 binding Effects 0.000 claims description 54
- 108091033319 polynucleotide Proteins 0.000 claims description 46
- 239000002157 polynucleotide Substances 0.000 claims description 46
- 102000040430 polynucleotide Human genes 0.000 claims description 46
- 239000000427 antigen Substances 0.000 claims description 38
- 102000036639 antigens Human genes 0.000 claims description 38
- 108091007433 antigens Proteins 0.000 claims description 38
- 239000013598 vector Substances 0.000 claims description 34
- 108090000623 proteins and genes Proteins 0.000 claims description 31
- -1 IL-2Rβ Proteins 0.000 claims description 27
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 24
- 210000002865 immune cell Anatomy 0.000 claims description 23
- 102000004169 proteins and genes Human genes 0.000 claims description 23
- 235000013305 food Nutrition 0.000 claims description 22
- 239000012634 fragment Substances 0.000 claims description 22
- 239000008194 pharmaceutical composition Substances 0.000 claims description 17
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 claims description 16
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 claims description 14
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 13
- 101000633786 Homo sapiens SLAM family member 6 Proteins 0.000 claims description 12
- 102100032816 Integrin alpha-6 Human genes 0.000 claims description 12
- 102100029197 SLAM family member 6 Human genes 0.000 claims description 12
- 108010074687 Signaling Lymphocytic Activation Molecule Family Member 1 Proteins 0.000 claims description 12
- 230000000295 complement effect Effects 0.000 claims description 12
- 230000004068 intracellular signaling Effects 0.000 claims description 12
- 208000034578 Multiple myelomas Diseases 0.000 claims description 11
- 239000004480 active ingredient Substances 0.000 claims description 11
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 claims description 10
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 claims description 10
- 230000000139 costimulatory effect Effects 0.000 claims description 9
- 239000003446 ligand Substances 0.000 claims description 9
- 102100024263 CD160 antigen Human genes 0.000 claims description 8
- 101000761938 Homo sapiens CD160 antigen Proteins 0.000 claims description 8
- 101001078158 Homo sapiens Integrin alpha-1 Proteins 0.000 claims description 8
- 101000994375 Homo sapiens Integrin alpha-4 Proteins 0.000 claims description 8
- 101000994365 Homo sapiens Integrin alpha-6 Proteins 0.000 claims description 8
- 101001035237 Homo sapiens Integrin alpha-D Proteins 0.000 claims description 8
- 101001046687 Homo sapiens Integrin alpha-E Proteins 0.000 claims description 8
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 claims description 8
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 claims description 8
- 101000971538 Homo sapiens Killer cell lectin-like receptor subfamily F member 1 Proteins 0.000 claims description 8
- 101000633780 Homo sapiens Signaling lymphocytic activation molecule Proteins 0.000 claims description 8
- 102100025323 Integrin alpha-1 Human genes 0.000 claims description 8
- 102100032818 Integrin alpha-4 Human genes 0.000 claims description 8
- 102100039904 Integrin alpha-D Human genes 0.000 claims description 8
- 102100022341 Integrin alpha-E Human genes 0.000 claims description 8
- 102100022338 Integrin alpha-M Human genes 0.000 claims description 8
- 102100022297 Integrin alpha-X Human genes 0.000 claims description 8
- 102100025304 Integrin beta-1 Human genes 0.000 claims description 8
- 102100025390 Integrin beta-2 Human genes 0.000 claims description 8
- 102100021458 Killer cell lectin-like receptor subfamily F member 1 Human genes 0.000 claims description 8
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 claims description 8
- 102100038082 Natural killer cell receptor 2B4 Human genes 0.000 claims description 8
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 8
- 102000014128 RANK Ligand Human genes 0.000 claims description 8
- 108010025832 RANK Ligand Proteins 0.000 claims description 8
- 102100027744 Semaphorin-4D Human genes 0.000 claims description 8
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 claims description 8
- 238000004519 manufacturing process Methods 0.000 claims description 7
- 102000005962 receptors Human genes 0.000 claims description 7
- 108020003175 receptors Proteins 0.000 claims description 7
- 102100027207 CD27 antigen Human genes 0.000 claims description 6
- 101150013553 CD40 gene Proteins 0.000 claims description 6
- 102100035793 CD83 antigen Human genes 0.000 claims description 6
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 6
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 claims description 6
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 claims description 6
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 claims description 6
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 6
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 claims description 6
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 claims description 6
- 108091008874 T cell receptors Proteins 0.000 claims description 6
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 claims description 6
- 102100027208 T-cell antigen CD7 Human genes 0.000 claims description 6
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 claims description 6
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 claims description 6
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 6
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 claims description 6
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 claims description 6
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 claims description 6
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 claims description 6
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 claims description 6
- 102000003298 tumor necrosis factor receptor Human genes 0.000 claims description 6
- 102100038078 CD276 antigen Human genes 0.000 claims description 5
- 101710185679 CD276 antigen Proteins 0.000 claims description 5
- 101000914496 Homo sapiens T-cell antigen CD7 Proteins 0.000 claims description 5
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 claims description 5
- 101710089372 Programmed cell death protein 1 Proteins 0.000 claims description 5
- 102100023990 60S ribosomal protein L17 Human genes 0.000 claims description 4
- 208000023275 Autoimmune disease Diseases 0.000 claims description 4
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 claims description 4
- 102100027205 B-cell antigen receptor complex-associated protein alpha chain Human genes 0.000 claims description 4
- 101710095183 B-cell antigen receptor complex-associated protein alpha chain Proteins 0.000 claims description 4
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 claims description 4
- 108010056102 CD100 antigen Proteins 0.000 claims description 4
- 108010017009 CD11b Antigen Proteins 0.000 claims description 4
- 102100038077 CD226 antigen Human genes 0.000 claims description 4
- 108010062802 CD66 antigens Proteins 0.000 claims description 4
- 102100027217 CD82 antigen Human genes 0.000 claims description 4
- 101710139831 CD82 antigen Proteins 0.000 claims description 4
- 102100024533 Carcinoembryonic antigen-related cell adhesion molecule 1 Human genes 0.000 claims description 4
- 102100027816 Cytotoxic and regulatory T-cell molecule Human genes 0.000 claims description 4
- 102100025137 Early activation antigen CD69 Human genes 0.000 claims description 4
- 101000585551 Equus caballus Pregnancy-associated glycoprotein Proteins 0.000 claims description 4
- 102100022086 GRB2-related adapter protein 2 Human genes 0.000 claims description 4
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 claims description 4
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 claims description 4
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 claims description 4
- 101000884298 Homo sapiens CD226 antigen Proteins 0.000 claims description 4
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 claims description 4
- 101000900690 Homo sapiens GRB2-related adapter protein 2 Proteins 0.000 claims description 4
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 claims description 4
- 101001046683 Homo sapiens Integrin alpha-L Proteins 0.000 claims description 4
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 claims description 4
- 101001046668 Homo sapiens Integrin alpha-X Proteins 0.000 claims description 4
- 101001015037 Homo sapiens Integrin beta-7 Proteins 0.000 claims description 4
- 101001047640 Homo sapiens Linker for activation of T-cells family member 1 Proteins 0.000 claims description 4
- 101001090688 Homo sapiens Lymphocyte cytosolic protein 2 Proteins 0.000 claims description 4
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 claims description 4
- 101000589305 Homo sapiens Natural cytotoxicity triggering receptor 2 Proteins 0.000 claims description 4
- 101000873418 Homo sapiens P-selectin glycoprotein ligand 1 Proteins 0.000 claims description 4
- 101001124867 Homo sapiens Peroxiredoxin-1 Proteins 0.000 claims description 4
- 101000692259 Homo sapiens Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 Proteins 0.000 claims description 4
- 101000702132 Homo sapiens Protein spinster homolog 1 Proteins 0.000 claims description 4
- 101000633778 Homo sapiens SLAM family member 5 Proteins 0.000 claims description 4
- 101000633784 Homo sapiens SLAM family member 7 Proteins 0.000 claims description 4
- 101000946860 Homo sapiens T-cell surface glycoprotein CD3 epsilon chain Proteins 0.000 claims description 4
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 claims description 4
- 101000795169 Homo sapiens Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 claims description 4
- 101000648507 Homo sapiens Tumor necrosis factor receptor superfamily member 14 Proteins 0.000 claims description 4
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 claims description 4
- 101000679857 Homo sapiens Tumor necrosis factor receptor superfamily member 3 Proteins 0.000 claims description 4
- 102100022339 Integrin alpha-L Human genes 0.000 claims description 4
- 108010041100 Integrin alpha6 Proteins 0.000 claims description 4
- 108010030465 Integrin alpha6beta1 Proteins 0.000 claims description 4
- 102100033016 Integrin beta-7 Human genes 0.000 claims description 4
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 claims description 4
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 claims description 4
- 102100024032 Linker for activation of T-cells family member 1 Human genes 0.000 claims description 4
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 claims description 4
- 102100034709 Lymphocyte cytosolic protein 2 Human genes 0.000 claims description 4
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 claims description 4
- 101100236305 Mus musculus Ly9 gene Proteins 0.000 claims description 4
- 102000027581 NK cell receptors Human genes 0.000 claims description 4
- 108091008877 NK cell receptors Proteins 0.000 claims description 4
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 claims description 4
- 108010004217 Natural Cytotoxicity Triggering Receptor 1 Proteins 0.000 claims description 4
- 108010004222 Natural Cytotoxicity Triggering Receptor 3 Proteins 0.000 claims description 4
- 102100032870 Natural cytotoxicity triggering receptor 1 Human genes 0.000 claims description 4
- 102100032851 Natural cytotoxicity triggering receptor 2 Human genes 0.000 claims description 4
- 102100032852 Natural cytotoxicity triggering receptor 3 Human genes 0.000 claims description 4
- 101710141230 Natural killer cell receptor 2B4 Proteins 0.000 claims description 4
- 102100034925 P-selectin glycoprotein ligand 1 Human genes 0.000 claims description 4
- 102100026066 Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 Human genes 0.000 claims description 4
- 102100029216 SLAM family member 5 Human genes 0.000 claims description 4
- 102100029198 SLAM family member 7 Human genes 0.000 claims description 4
- 102000008115 Signaling Lymphocytic Activation Molecule Family Member 1 Human genes 0.000 claims description 4
- 102100035794 T-cell surface glycoprotein CD3 epsilon chain Human genes 0.000 claims description 4
- 102100035268 T-cell surface protein tactile Human genes 0.000 claims description 4
- 108010065158 Tumor Necrosis Factor Ligand Superfamily Member 14 Proteins 0.000 claims description 4
- 102100024586 Tumor necrosis factor ligand superfamily member 14 Human genes 0.000 claims description 4
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 claims description 4
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 claims description 4
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 claims description 4
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 claims description 4
- 102100022156 Tumor necrosis factor receptor superfamily member 3 Human genes 0.000 claims description 4
- 101001038499 Yarrowia lipolytica (strain CLIB 122 / E 150) Lysine acetyltransferase Proteins 0.000 claims description 4
- 108010072917 class-I restricted T cell-associated molecule Proteins 0.000 claims description 4
- 102000003675 cytokine receptors Human genes 0.000 claims description 4
- 108010057085 cytokine receptors Proteins 0.000 claims description 4
- 102000006495 integrins Human genes 0.000 claims description 4
- 108010044426 integrins Proteins 0.000 claims description 4
- 230000031146 intracellular signal transduction Effects 0.000 claims description 4
- 210000001616 monocyte Anatomy 0.000 claims description 4
- 210000000581 natural killer T-cell Anatomy 0.000 claims description 4
- 239000013612 plasmid Substances 0.000 claims description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 3
- 102100028976 HLA class I histocompatibility antigen, B alpha chain Human genes 0.000 claims description 3
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 claims description 3
- 210000004443 dendritic cell Anatomy 0.000 claims description 3
- 230000001419 dependent effect Effects 0.000 claims description 3
- 201000005787 hematologic cancer Diseases 0.000 claims description 3
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 claims description 3
- 210000000822 natural killer cell Anatomy 0.000 claims description 3
- 230000001177 retroviral effect Effects 0.000 claims description 3
- 201000000596 systemic lupus erythematosus Diseases 0.000 claims description 3
- 102100038080 B-cell receptor CD22 Human genes 0.000 claims description 2
- 102100037904 CD9 antigen Human genes 0.000 claims description 2
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 claims description 2
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 claims description 2
- 101000738354 Homo sapiens CD9 antigen Proteins 0.000 claims description 2
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 claims description 2
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 claims description 2
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 claims description 2
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 claims description 2
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 claims description 2
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 claims description 2
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 claims description 2
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 claims description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 claims description 2
- 101000809875 Homo sapiens TYRO protein tyrosine kinase-binding protein Proteins 0.000 claims description 2
- 108010053727 Interleukin-15 Receptor alpha Subunit Proteins 0.000 claims description 2
- 102100020789 Interleukin-15 receptor subunit alpha Human genes 0.000 claims description 2
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 claims description 2
- 101710099301 Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 claims description 2
- 102000010168 Myeloid Differentiation Factor 88 Human genes 0.000 claims description 2
- 108010077432 Myeloid Differentiation Factor 88 Proteins 0.000 claims description 2
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 claims description 2
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 claims description 2
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 claims description 2
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 claims description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 claims description 2
- 102100038717 TYRO protein tyrosine kinase-binding protein Human genes 0.000 claims description 2
- 210000003651 basophil Anatomy 0.000 claims description 2
- 210000003979 eosinophil Anatomy 0.000 claims description 2
- 210000002540 macrophage Anatomy 0.000 claims description 2
- 210000000440 neutrophil Anatomy 0.000 claims description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 claims description 2
- 101100347633 Drosophila melanogaster Mhc gene Proteins 0.000 claims 1
- 206010025135 lupus erythematosus Diseases 0.000 claims 1
- 210000004027 cell Anatomy 0.000 abstract description 86
- 230000001225 therapeutic effect Effects 0.000 abstract description 3
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 abstract 6
- 239000002585 base Substances 0.000 description 22
- 238000000034 method Methods 0.000 description 20
- 108090000765 processed proteins & peptides Proteins 0.000 description 17
- 206010028980 Neoplasm Diseases 0.000 description 16
- 150000002632 lipids Chemical class 0.000 description 12
- 230000036541 health Effects 0.000 description 11
- 150000007523 nucleic acids Chemical class 0.000 description 11
- 108091007741 Chimeric antigen receptor T cells Proteins 0.000 description 10
- 229920001184 polypeptide Polymers 0.000 description 10
- 102000004196 processed proteins & peptides Human genes 0.000 description 10
- 238000011282 treatment Methods 0.000 description 10
- 235000013361 beverage Nutrition 0.000 description 9
- 239000002502 liposome Substances 0.000 description 9
- 102000039446 nucleic acids Human genes 0.000 description 9
- 108020004707 nucleic acids Proteins 0.000 description 9
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 7
- 201000011510 cancer Diseases 0.000 description 7
- 230000001965 increasing effect Effects 0.000 description 7
- 101000801255 Homo sapiens Tumor necrosis factor receptor superfamily member 17 Proteins 0.000 description 6
- 241000713666 Lentivirus Species 0.000 description 6
- 230000001105 regulatory effect Effects 0.000 description 6
- 102100033726 Tumor necrosis factor receptor superfamily member 17 Human genes 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 238000002659 cell therapy Methods 0.000 description 5
- 238000010586 diagram Methods 0.000 description 5
- 239000003814 drug Substances 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 239000013604 expression vector Substances 0.000 description 5
- 235000013376 functional food Nutrition 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 230000002147 killing effect Effects 0.000 description 5
- 238000004020 luminiscence type Methods 0.000 description 5
- 239000002609 medium Substances 0.000 description 5
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 230000002269 spontaneous effect Effects 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 238000002156 mixing Methods 0.000 description 4
- 210000004881 tumor cell Anatomy 0.000 description 4
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 230000006044 T cell activation Effects 0.000 description 3
- 230000002159 abnormal effect Effects 0.000 description 3
- 101150063416 add gene Proteins 0.000 description 3
- 150000001413 amino acids Chemical class 0.000 description 3
- 238000002617 apheresis Methods 0.000 description 3
- 239000011324 bead Substances 0.000 description 3
- 150000001720 carbohydrates Chemical class 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 235000009508 confectionery Nutrition 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 210000003743 erythrocyte Anatomy 0.000 description 3
- 235000013373 food additive Nutrition 0.000 description 3
- 239000002778 food additive Substances 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 235000013402 health food Nutrition 0.000 description 3
- 239000012642 immune effector Substances 0.000 description 3
- 229940121354 immunomodulator Drugs 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 239000000693 micelle Substances 0.000 description 3
- 238000004091 panning Methods 0.000 description 3
- 238000003752 polymerase chain reaction Methods 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- 108091033409 CRISPR Proteins 0.000 description 2
- 241000282836 Camelus dromedarius Species 0.000 description 2
- 108010087819 Fc receptors Proteins 0.000 description 2
- 102000009109 Fc receptors Human genes 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 210000001772 blood platelet Anatomy 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 239000003086 colorant Substances 0.000 description 2
- 238000012790 confirmation Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 235000015203 fruit juice Nutrition 0.000 description 2
- 235000020510 functional beverage Nutrition 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 239000002773 nucleotide Substances 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 230000035699 permeability Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 210000004180 plasmocyte Anatomy 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 238000001959 radiotherapy Methods 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 235000013616 tea Nutrition 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 238000010361 transduction Methods 0.000 description 2
- 230000026683 transduction Effects 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 230000032258 transport Effects 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- 235000013343 vitamin Nutrition 0.000 description 2
- 239000011782 vitamin Substances 0.000 description 2
- 229930003231 vitamin Natural products 0.000 description 2
- 229940088594 vitamin Drugs 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- LDGWQMRUWMSZIU-LQDDAWAPSA-M 2,3-bis[(z)-octadec-9-enoxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)C)OCCCCCCCC\C=C/CCCCCCCC LDGWQMRUWMSZIU-LQDDAWAPSA-M 0.000 description 1
- FVFVNNKYKYZTJU-UHFFFAOYSA-N 6-chloro-1,3,5-triazine-2,4-diamine Chemical group NC1=NC(N)=NC(Cl)=N1 FVFVNNKYKYZTJU-UHFFFAOYSA-N 0.000 description 1
- HJCMDXDYPOUFDY-WHFBIAKZSA-N Ala-Gln Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O HJCMDXDYPOUFDY-WHFBIAKZSA-N 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- 108010011485 Aspartame Proteins 0.000 description 1
- 108010046304 B-Cell Activation Factor Receptor Proteins 0.000 description 1
- 102000007536 B-Cell Activation Factor Receptor Human genes 0.000 description 1
- 208000028564 B-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 1
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 1
- 238000010354 CRISPR gene editing Methods 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 208000003322 Coinfection Diseases 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 238000009007 Diagnostic Kit Methods 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 206010051151 Hyperviscosity syndrome Diseases 0.000 description 1
- 239000000232 Lipid Bilayer Substances 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 101710085938 Matrix protein Proteins 0.000 description 1
- 101710127721 Membrane protein Proteins 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 239000012124 Opti-MEM Substances 0.000 description 1
- 229920002230 Pectic acid Polymers 0.000 description 1
- 208000002151 Pleural effusion Diseases 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 108700026226 TATA Box Proteins 0.000 description 1
- 241001122767 Theaceae Species 0.000 description 1
- 102000008579 Transposases Human genes 0.000 description 1
- 108010020764 Transposases Proteins 0.000 description 1
- 102100036922 Tumor necrosis factor ligand superfamily member 13B Human genes 0.000 description 1
- 206010054094 Tumour necrosis Diseases 0.000 description 1
- 241001492404 Woodchuck hepatitis virus Species 0.000 description 1
- ATBOMIWRCZXYSZ-XZBBILGWSA-N [1-[2,3-dihydroxypropoxy(hydroxy)phosphoryl]oxy-3-hexadecanoyloxypropan-2-yl] (9e,12e)-octadeca-9,12-dienoate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCC\C=C\C\C=C\CCCCC ATBOMIWRCZXYSZ-XZBBILGWSA-N 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 235000013334 alcoholic beverage Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- 229940035676 analgesics Drugs 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 239000000730 antalgic agent Substances 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000009830 antibody antigen interaction Effects 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 238000011394 anticancer treatment Methods 0.000 description 1
- 239000000823 artificial membrane Substances 0.000 description 1
- 239000000605 aspartame Substances 0.000 description 1
- 235000010357 aspartame Nutrition 0.000 description 1
- IAOZJIPTCAWIRG-QWRGUYRKSA-N aspartame Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(=O)OC)CC1=CC=CC=C1 IAOZJIPTCAWIRG-QWRGUYRKSA-N 0.000 description 1
- 229960003438 aspartame Drugs 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 238000010170 biological method Methods 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 238000001815 biotherapy Methods 0.000 description 1
- 208000034158 bleeding Diseases 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 238000010322 bone marrow transplantation Methods 0.000 description 1
- 235000008429 bread Nutrition 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical compound OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 235000019219 chocolate Nutrition 0.000 description 1
- WLNARFZDISHUGS-MIXBDBMTSA-N cholesteryl hemisuccinate Chemical compound C1C=C2C[C@@H](OC(=O)CCC(O)=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 WLNARFZDISHUGS-MIXBDBMTSA-N 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000012761 co-transfection Methods 0.000 description 1
- 238000001246 colloidal dispersion Methods 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 238000002784 cytotoxicity assay Methods 0.000 description 1
- 231100000263 cytotoxicity test Toxicity 0.000 description 1
- 235000013365 dairy product Nutrition 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 230000000779 depleting effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 235000015872 dietary supplement Nutrition 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 235000019634 flavors Nutrition 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 235000012041 food component Nutrition 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 239000005417 food ingredient Substances 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 230000008571 general function Effects 0.000 description 1
- 238000010362 genome editing Methods 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 238000000227 grinding Methods 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000008821 health effect Effects 0.000 description 1
- 238000001794 hormone therapy Methods 0.000 description 1
- 102000046935 human TNFRSF17 Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 235000015243 ice cream Nutrition 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 238000012804 iterative process Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 235000013372 meat Nutrition 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 210000001806 memory b lymphocyte Anatomy 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 235000021096 natural sweeteners Nutrition 0.000 description 1
- 235000012149 noodles Nutrition 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- LCLHHZYHLXDRQG-ZNKJPWOQSA-N pectic acid Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)O[C@H](C(O)=O)[C@@H]1OC1[C@H](O)[C@@H](O)[C@@H](OC2[C@@H]([C@@H](O)[C@@H](O)[C@H](O2)C(O)=O)O)[C@@H](C(O)=O)O1 LCLHHZYHLXDRQG-ZNKJPWOQSA-N 0.000 description 1
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 238000001126 phototherapy Methods 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 235000013550 pizza Nutrition 0.000 description 1
- 239000010318 polygalacturonic acid Substances 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000001124 posttranscriptional effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 1
- 235000013580 sausages Nutrition 0.000 description 1
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical compound O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 235000011888 snacks Nutrition 0.000 description 1
- 235000014347 soups Nutrition 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 235000013599 spices Nutrition 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 238000011476 stem cell transplantation Methods 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 230000002992 thymic effect Effects 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- NRWCNEBHECBWRJ-UHFFFAOYSA-M trimethyl(propyl)azanium;chloride Chemical compound [Cl-].CCC[N+](C)(C)C NRWCNEBHECBWRJ-UHFFFAOYSA-M 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 150000003722 vitamin derivatives Chemical class 0.000 description 1
- 235000012431 wafers Nutrition 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
- C12N15/625—DNA sequences coding for fusion proteins containing a sequence coding for a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Medicinal Chemistry (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Cell Biology (AREA)
- Wood Science & Technology (AREA)
- Biophysics (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- General Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Epidemiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Hematology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Mycology (AREA)
Abstract
본 발명은 B-세포 성숙 항원을 표적화하는 신규한 키메라 항원 수용체 및 이의 용도에 관한 것으로, 본 발명에서 제조된 BCMA를 표적으로 하는 키메라 항원 수용체 및 CAR-면역 세포는 BCMA와 효과적으로 결합할 뿐만 아니라, BCMA와 결합한 CAR-면역 세포의 활성화가 이루어진 것을 확인하였다. 또한, 본 발명의 CAR-면역 세포는 BCMA를 발현하는 세포를 효과적으로 사멸시키는 것을 확인하였으므로, 본 발명의 BCMA를 표적으로 하는 키메라 항원 수용체 및 CAR-면역 세포는 B 세포 또는 BCMA 발현과 관련된 질환 예방 또는 치료용 조성물로 유용하게 활용할 수 있다.
Description
본 발명은 B-세포 성숙 항원을 표적화하는 신규한 키메라 항원 수용체 및 이의 용도에 관한 것이다.
최근 암세포 표적 키메라 항원 수용체(Chimeric Antigen Receptor; CAR) 유전자를 도입하여 생산된 T 세포(CAR-T 세포)의 개선된 항암 효과가 입증되면서, 타겟 암세포에 대한 특이성과 활성화를 촉진하여 항암 치료 효용성을 증진하기 위한 방법으로 CAR-면역세포 치료제 개발에 대한 관심이 대두되고 있다.
통상적으로 키메라 항원 수용체는 하나의 종양 관련 항원 결합 영역(세포외 항원 결합 도메인), 막관통 영역(막관통 도메인), 공동자극 영역 및 세포내 신호 전달 영역(세포내 신호전달 도메인)으로 구성된다. CAR 면역세포 치료법은 일반적으로 유전자 형질 도입 기술을 통하여, 예컨대, 종양 관련 항원을 식별하는 최소 항체 결합단편(Single chain fragment variable, scFv)과 T 세포 활성화 서열의 융합 단백질을 T 세포 표면에 발현시키고, 상기 CAR 분자를 발현하는 T 세포는 항원의존적이나, 비 MHC 제한된 방식으로 종양 항원과 결합하여, 종양세포를 특이적으로 살해한다.
이러한 CAR 면역세포 치료법의 유효성은 종양 관련 항원을 식별하는 항체의 특이성 및 항원과 결합되는 친화력에 의존한다. 따라서, 항원 결합 영역의 설계는 새로운 CAR 기술이 개발되는 데 있어 중요한 관건이다.
낙타과 동물 유래 중쇄항체(Heavy chain antibody, HCAb)에서 가장 작고, 항원과 완전히 결합될 수 있는 단일 도메인 항체 단편, 즉, 경쇄가 없는 중쇄항체의 가변 영역(VHH)은, 구조가 간단하고, 분자량은 보통 항체 분자량의 1/10로서, 체외 발현 시스템에서 고효율적으로 발현되고 정제될 수 있으며, 아울러 인간 항체와의 유사성(homology)이 높아 면역원성 위험성도 낮다는 장점이 있다. 고특이성, 고친화력, 면역원성은 낮고, 삼투성이 좋으며, 종양 치료할 때, 통상적인 항체와 접촉될 수 없는 비교적 은폐된 타겟과 접촉될 수 있는 가능성을 갖고 있다. 산업적 활용에 있어서도 나노바디 구조는 높은 열 안정성을 가지고 있어서, 진단키트 제작에의 활용에 용이하고, 항체 제품으로 제작시 완제품에 대한 보관 및 사용에서 높은 편의성을 제공한다.
이러한 특성에 기반하여, 단일 도메인 항체를 CAR의 항원 결합 영역으로서 CAR 수식하는 것은 CAR 면역 세포 치료법의 발전 추세 중의 하나이다.
한편, CD269 또는 TNFRSF17로도 알려진 B-세포 성숙 항원(B-cell maturation antigen: BCMA)은 종양괴사인자(tumor necrosis factor) 수용체 패밀리의 구성원이다. BCMA가 B-세포 활성화 인자 수용체(B-cell activating factor receptor: BAFF) 및 B-세포 증식 유도 리간드(B-cell proliferation-inducing ligand: APRIL)와 결합하여 상이한 발달 단계에서 B 세포의 생존을 촉진할 수 있음이 보고된 바 있다. 비정상적인 신호전달은 B 세포의 비정상적인 증식을 초래하여 다발성 골수종 등과 같은 자가 면역 질환(autoimmune diseases) 및 종양형성(tumorigenesis)을 초래할 수 있다.
다발성 골수종은 형질세포가 비정상적으로 분화 및 증식하여 나타나는 혈액암의 일종으로, 이는 종양을 생성하고 뼈를 녹여 통증을 유발한다. 이뿐만 아니라, 다발성 골수종은 골수를 침범하여 백혈구, 적혈구, 혈소판 수치를 감소시킴으로써 빈혈, 감염, 출혈의 위험성도 증가시킨다. 나아가, 골수종 세포는 비정상 면역단백인 M 단백(M protein)을 생성하기도 하며, 이는 혈액의 농도를 증가시켜 혈액과점도증후군을 초래하거나 신장에 손상을 주기도 한다.
이러한 다발성 골수종에 대한 일부 치료법은 다른 암에 대한 치료법, 예를 들면, 화학요법 또는 방사선 요법, 줄기세포 이식 또는 골수 이식, 표적화된 요법 또는 생물학적 요법과 유사하다. 항체-기초된 세포 면역요법은 혈액학적 악성, 특히 B 세포 비호지킨 림프종을 앓는 환자에 대한 실제적인 임상적 유익성이 확인되었으나, 대부분의 환자가 재발하거나 2차 저항이 발생하는 문제점이 있으므로, 다발성 골수종을 치료하기 위한 효과적인 면역치료적 작용제가 요구되고 있다.
상술한 상황 하에서, 본 발명자들은 다발성 골수종 등과 같은 B 세포와 관련된 질환의 치료제를 개발하기 위해 예의 노력한 결과, BCMA를 표적으로 하는 단일 도메인 항체(single domain antibody, sdAb)를 선별하였으며, 상기 선별된 항-BCMA sdAb를 기반으로 하여, 최종적으로 BCMA를 표적으로 하는 키메라 항원 수용체(CAR)및 이를 표면에 발현하는 CAR-면역 세포를 제조하였다. 상기 제조된 BCMA 표적 CAR-면역 세포가 BCMA와 특이적으로 결합하여, BCMA 발현 종양세포를 효과적으로 현저하게 사멸시키는 것을 규명함으로써, 본 발명을 완성하였다.
따라서, 본 발명의 일 목적은, BCMA(B-cell maturation antigen)에 특이적으로 결합하는, 단일 도메인 항체(single domain antibody, sdAb) 또는 이의 항원-결합 단편을 제공하는 데 있다.
또한, 본 발명의 다른 목적은, BCMA-결합 도메인, 막관통 도메인(transmembrane domain), 공동자극 도메인(costimulatory domain) 및 세포 내 신호전달 도메인(intracellular signal transduction domain)을 포함하는 키메라 항원 수용체(chimeric antigen receptor: CAR)를 제공하는 데 있다.
또한, 본 발명의 또 다른 목적은, 상기 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드를 제공하는 데 있다.
또한, 본 발명의 또 다른 목적은, 상기 폴리뉴클레오타이드를 포함하는 벡터를 제공하는 데 있다.
또한, 본 발명의 또 다른 목적은, 상기 키메라 항원 수용체(CAR)를 표면에 발현하는, 단리된 면역 세포를 제공하는 데 있다.
또한, 본 발명의 또 다른 목적은, BCMA 발현과 관련된 질환 예방 또는 치료용 약학적 조성물을 제공하는 데 있다.
또한, 본 발명의 또 다른 목적은, BCMA 발현과 관련된 질환 예방 또는 개선용 식품 조성물을 제공하는 데 있다.
또한, 본 발명의 또 다른 목적은, 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드 또는 이를 포함하는 벡터를, 단리된 면역 세포에 도입시키는 단계를 포함하는, 면역 세포의 제조 방법을 제공하는 데 있다.
또한, 본 발명의 또 다른 목적은, 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드; 또는 키메라 항원 수용체(CAR)를 표면에 발현하는 단리된 면역 세포를, 약학적 유효량으로 대상(subject)에게 투여하는 단계를 포함하는, BCMA 발현과 관련된 질환 예방 또는 치료 방법을 제공하는 데 있다.
본 명세서에서 사용한 용어는 단지 설명을 목적으로 사용된 것으로, 한정하려는 의도로 해석되어서는 안된다. 단수의 표현은 문맥상 명백하게 다르게 뜻하지 않는 한, 복수의 표현을 포함한다. 본 명세서에서, "포함하다" 또는 "가지다" 등의 용어는 명세서 상에 기재된 특징, 숫자, 단계, 동작, 구성요소, 부품 또는 이들을 조합한 것이 존재함을 지정하려는 것이지, 하나 또는 그 이상의 다른 특징들이나 숫자, 단계, 동작, 구성요소, 부품 또는 이들을 조합한 것들의 존재 또는 부가 가능성을 미리 배제하지 않는 것으로 이해되어야 한다.
다르게 정의되지 않는 한, 기술적이거나 과학적인 용어를 포함해서 여기서 사용되는 모든 용어들은 실시예가 속하는 기술 분야에서 통상의 지식을 가진 자에 의해 일반적으로 이해되는 것과 동일한 의미를 가지고 있다. 일반적으로 사용되는 사전에 정의되어 있는 것과 같은 용어들은 관련 기술의 문맥 상 가지는 의미와 일치하는 의미를 가지는 것으로 해석되어야 하며, 본 출원에서 명백하게 정의하지 않는 한, 이상적이거나 과도하게 형식적인 의미로 해석되지 않는다.
이하, 본 발명을 보다 상세하게 설명한다.
본 발명의 일 양태에 따르면, 본 발명은 서열번호 7 내지 9 중 어느 하나의 아미노산 서열로 표시되는 CDR1(complementary determining region 1); 서열번호 10 내지 12 중 어느 하나의 아미노산 서열로 표시되는 CDR2(complementary determining region 2); 및 서열번호 13 내지 15 중 어느 하나의 아미노산 서열로 표시되는 CDR3(complementary determining region 3);를 포함하며, BCMA(B-cell maturation antigen)에 특이적으로 결합하는, 단일 도메인 항체(single domain antibody, sdAb) 또는 이의 항원-결합 단편을 제공한다.
본 발명에서는 BCMA와 특이적으로 결합하는 단일 도메인 항체를 제작하고 스크리닝하여 하기와 같은 신규한 단일 도메인 항체 3 종을 확립하였으며, 각각 (i) 항-BCMA sdAb No.7, (ii) 항-BCMA sdAb No.11 및 (iii) 항-BCMA sdAb No.19로 명명하였다.
본 발명의 바람직한 구현예에 따르면, 상기 단일 도메인 항체는,
(i) 서열번호 7의 아미노산 서열로 표시되는 CDR1, 서열번호 10의 아미노산 서열로 표시되는 CDR2 및 서열번호 13의 아미노산 서열로 표시되는 CDR3를 포함하는 중쇄 가변 도메인(VHH)(항-BCMA sdAb No.7);
(ii) 서열번호 8의 아미노산 서열로 표시되는 CDR1, 서열번호 11의 아미노산 서열로 표시되는 CDR2 및 서열번호 14의 아미노산 서열로 표시되는 CDR3를 포함하는 중쇄 가변 도메인(VHH)(항-BCMA sdAb No.11); 또는
(iii) 서열번호 9의 아미노산 서열로 표시되는 CDR1, 서열번호 12의 아미노산 서열로 표시되는 CDR2 및 서열번호 15의 아미노산 서열로 표시되는 CDR3를 포함하는 중쇄 가변 도메인(VHH)(항-BCMA sdAb No.19);을 포함한다.
상기 (i) 중쇄 가변 도메인(VHH)은 서열번호 1로 표시되는 아미노산 서열로 이루어지고, 서열번호 4로 표시되는 염기서열에 의해 코딩된다.
상기 (ii) 중쇄 가변 도메인(VHH)은 서열번호 2로 표시되는 아미노산 서열로 이루어지고, 서열번호 5로 표시되는 염기서열에 의해 코딩된다.
상기 (iii) 중쇄 가변 도메인(VHH)은 서열번호 3로 표시되는 아미노산 서열로 이루어지고 서열번호 6로 표시되는 염기서열에 의해 코딩된다.
본 명세서에서, 용어 "단일 도메인 항체(single-domain antibody, sdAb)"는 통상적으로 항체 중쇄의 가변 영역(VH 영역) 또는 항체 경쇄의 가변 영역(VL 영역)으로 구성되는 항체 단편을 의미하며 나노 항체(Nanobody)로도 지칭된다. 이러한 단일 도메인 항체는 단일 단량체 가변 도메인으로 구성된 항체 단편이므로, 전체 항체와 같이 특정 항원에 선택적으로 결합이 가능할 뿐만 아니라, 중쇄만 가지고 있어 CDR 영역의 서열 조합이 일반적인 항체에 비해 복잡도가 높지 않아 인실리코 기반의 합성 라이브러리 구축이 용이하다는 장점이 있다.
본 발명의 단일 도메인 항체는 낙타과 동물의 중쇄항체로부터 인조 공학에 따라 제조되는 것으로, "VHH(variable heavy chain domains of heavy chain antibody)"와 혼용된다.
본 출원에서, 용어 "CDR"는 통상적으로 상보성 결정 영역을 의미하는 것으로, CDR는 주로 항원 부위와 결합된다. 중쇄의 CDR는 통상적으로 CDR1, CDR2와 CDR3으로 불리우고, N-단으로부터 순서대로 번호를 매긴다. 본 출원에서, 통상적인 방법으로 CDR를 한정하거나 동정할 수 있다.
본 발명의 일 실시예에서, 도 1에 나타난 바와 같이,본 발명의 항-BCMA sdAb가 BCMA를 발현하는 다발성골수종 H929세포에 특이적으로 결합한 것을 확인하였다.
따라서, 본 발명의 항-BCMA sdAb를 이용하여 BCMA를 표적으로 하는 키메라 항원 수용체(CAR, chimeric antigen receptor) 제조에 유리하게 적용할 수 있다.
또한, 본 발명에 포함된 단백질, 폴리펩타이드 및/또는 아미노산 서열은 적어도 단백질 또는 폴리펩타이드와 동일하거나 유사한 기능을 갖는 기능성 변이체(functional variants) 또는 상동체를 포함하는 것으로 이해되어야 한다.
본 발명에서, 기능적 변이체(functional variants)는 상기 단백질 및/또는 폴리펩타이드의 아미노산 서열에서 하나 이상의 아미노산을 치환, 결실 또는 첨가함으로써 수득되는 단백질 또는 폴리펩타이드일 수 있다. 예를 들어, 기능적 변이체(functional variants)는 1에서 30, 1에서 20 또는 1에서 10 또는 1, 2, 3, 4 또는 5와 같은 하나 이상의 아미노산의 치환, 결실 및/또는 삽입으로 인해 상이한 아미노산 서열을 갖는 단백질 또는 폴리펩타이드를 포함할 수 있다. 기능적 변이체(functional variants)는 변형되지 않은 단백질 또는 폴리펩타이드 (치환, 결실 또는 첨가)의 생물학적 특성을 실질적으로 유지시킬 수 있다. 예를 들어, 기능적 변이체(functional variants)는 원래 단백질 또는 폴리펩타이드의 생물학적 활성 (항원 결합 능력과 같은)의 적어도 60%, 70%, 80%, 90% 또는 100%로 유지될 수 있다.
본 발명에서, 상동체는 상기 단백질 및/또는 폴리펩타이드와 아미노산 서열 상동성이 약 85 % 이상(예컨대, 약 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 또는 그 이상)인 단백질 또는 폴리펩타이드(예를 들어 BCMA 또는 이의 단편과 특이적으로 결합할 수 있는 항체)일 수 있다.
본 발명에서, 상동성은 일반적으로 둘 이상의 서열 사이의 유사성, 유사성 또는 상관성을 지칭한다.
또한, 본 발명의 다른 양태에 따르면, 본 발명은 BCMA-결합 도메인, 막관통 도메인(transmembrane domain), 공동자극 도메인(costimulatory domain) 및 세포 내 신호전달 도메인(intracellular signal transduction domain)을 포함하는 키메라 항원 수용체(chimeric antigen receptor: CAR)를 제공한다.
본 발명의 상기 키메라 항원 수용체(chimeric antigen receptors, CAR)에서, 상기 BCMA-결합 도메인은 BCMA와 특이적으로 결합할 수 있는 단일 도메인 항체(single domain antibody, sdAb) 또는 이의 항원-결합 단편을 포함하며, 상기 단일 도메인 항체(single domain antibody, sdAb)는, 서열번호 7 내지 9 중 어느 하나의 아미노산 서열로 표시되는 CDR1(complementary determining region 1); 서열번호 10 내지 12 중 어느 하나의 아미노산 서열로 표시되는 CDR2(complementary determining region 2); 및 서열번호 13 내지 15 중 어느 하나의 아미노산 서열로 표시되는 CDR3(complementary determining region 3);를 포함하는 것을 특징으로 한다.
본 발명에서, 용어 "키메라 항원 수용체 (CAR)"는 일반적으로 항원 및 하나 이상의 세포 내 도메인과 결합하는 능력을 갖는 세포 외 도메인을 함유하는 융합 단백질을 지칭한다. CAR는 키메라 항원 수용체 T 세포(CAR-T)의 핵심 부분이며, 항원(예를 들어, 종양 관련 항원(BCMA)) 결합 도메인, 막 관통 도메인, 공동 자극 도메인 및 세포 내 신호전달 도메인을 포함할 수 있다. CAR는 항체의 항원(예를 들어 BCMA) 특이성에 기초하여 T 세포 수용체-활성화 세포 내 도메인과 조합될 수 있다. 유전자가 변형된 CAR-발현 T 세포는 표적 항원-발현 악성 세포를 특이적으로 식별하고 제거할 수 있다.
본 발명에서, 용어 "BCMA(B-cell maturation antigen)"는 B-세포 성숙 항원을 지칭한다. BCMA(TNFRSF17, BCM 또는 CD269로도 공지됨)는 종양 괴사 수용체 (TNFR) 패밀리의 구성원이고, 최종 분화 B 세포, 예를 들어 기억 B 세포 및 형질 세포 상에서 우세하게 발현된다. BCMA는 종양 세포(예를 들어, 다발성 골수종 세포)에서 발현되거나 또는 종양 세포 표면에 위치된다. 본 발명의 "BCMA"는 전장 야생형 BCMA의 돌연변이, 예를 들어 점 돌연변이, 단편, 삽입, 결실 및 스플라이스 변이체를 포함하는 단백질을 포함할 수 있다.
본 발명에서, 용어 "BCMA-결합 도메인(BCMA-binding domain)"은 일반적으로 BCMA 단백질에 특이적으로 결합할 수 있는 도메인을 지칭한다. 예를 들어, BCMA-결합 도메인은 B 세포에서 발현된 인간 BCMA 폴리펩타이드 또는 이의 단편에 특이적으로 결합할 수 있는 항-BCMA 항체 또는 이의 단편을 함유할 수 있다.
본 발명에서, 용어 "결합 도메인(binding domain)"은 "세포 외 도메인(extracellular domain)", "세포 외 결합 도메인(extracellular binding domain)", "항원-특이적 결합 도메인(antigenspecific binding domain)" 및 "세포 외 항원-특이적 결합 도메인(extracellular antigen-specific biding domain)"은 상호 교환적으로 사용될 수 있으며, 표적 항원(예를 들어 BCMA)에 특이적으로 결합하는 능력을 갖는 CAR 도메인 또는 단편을 지칭한다.
본 발명에 있어서, 상기 항-BCMA 항체 또는 이의 단편은 상술한 항-BCMA sdAb와 혼용된다.
본 발명에서, 용어 "막관통 도메인(transmembrane domain)"은 일반적으로 세포막을 통과하고 세포 내 신호전달 도메인에 연결되어 신호전달의 역할을 하는 CAR의 도메인을 지칭한다. 상기 막관통 도메인은 CD8, FcγR, ICOS(CD278), 4-1BB(CD137), OX40(CD134), CD27, CD28, IL-2Rβ, CD40, DAP10, MHC class I 분자, TNF 수용체 단백질, Immunoglobulin-유사 단백질, 사이토카인 수용체, 인테그린, SLAM 단백질, 활성화 NK 세포 수용체, BTLA, Toll 리간드 수용체, CD2, CD7, CD30, CDS, ICAM-1, B7-H3, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8α, CD8β, ITGA4, VLA1, CD49a, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, CD19a, CD83 특이적 리간드, CD247, CD3δ, CD3ε, CD3γ, CD3ζ, Ig alpha(CD79a), IL-2Rγ, IL-7Rα, PD-1, TNFSF14, CD45, CD5, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD154, T 세포 수용체의 알파 쇄, T 세포 수용체의 베타 쇄 및 T 세포 수용체의 제타 쇄로 이루어진 군으로부터 선택된 1 종 이상일 수 있으며, 바람직하게는 서열번호 25의 아미노산 서열로 표시되는 CD8일 수 있다.
본 발명에서, 용어 "공동 자극 도메인(costimulatory domain)"은 일반적으로 림프구의 항원에 대한 효과적인 반응에 필요한 세포 표면 분자인 면역 자극 분자를 제공할 수 있는 세포 내 도메인을 지칭한다. 상기 기재된 공동자극 도메인(costimulatory domain)은 CD27, CD28, CD8, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, 림프구 기능-연관 항원-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3 및 CD83로 이루어진 군으로부터 선택된 1종 이상일 수 있으며,바람직하게는 서열번호 26의 아미노산 서열로 표시되는 4-1BB일 수 있다.
본 발명에서, 용어 "세포 내 신호전달 도메인(intracellular signal transduction domain)"은 일반적으로 세포 내부에 위치하고 신호를 전달할 수 있는 도메인을 지칭한다. 본 발명에서, 세포 내 신호전달 도메인은 키메라 항원 수용체의 세포 내 신호전달 도메인이다. 예를 들어, 세포 내 신호전달 도메인은 CD3ζ, FcγR, ICOS(CD278), 4-1BB(CD137), OX40(CD134), CD27, CD28, IL-2Rβ, IL-15R-α, MyD88, DAP10, DAP12, MHC class I 분자, TNF 수용체 단백질, Immunoglobulin-유사 단백질, 사이토카인 수용체, 인테그린, SLAM 단백질, 활성화 NK 세포 수용체, BTLA, Toll 리간드 수용체, CD2, CD7, CD30, CD40, CDS, ICAM-1, B7-H3, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8α, CD8β, IL2Rγ, IL7Rα, ITGA4, VLA1, CD49a, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, CD19a, CD83 특이적 리간드, CD247, CD3δ, CD3ε, CD3γ, CD8, Ig alpha(CD79a), IL-2Rγ, IL-7Rα, PD-1 및 TNFSF14로 이루어진 군으로부터 선택된 1 종 이상일 수 있으며, 바람직하게는 서열번호 27의 아미노산 서열로 표시되는 CD3ζ일 수 있다.
본 발명에 있어서, BCMA-결합 도메인의 C 말단 및 막관통 도메인의 N 말단 사이에 위치된 힌지 부위(hinge region)를 추가로 포함할 수 있으며, 상기 힌지는 CD8 힌지, IgG1 힌지 및 FcγRIIIα 힌지로 이루어진 군으로부터 선택된 1 종 이상일 수 있으며, 바람직하게는 서열번호 24의 아미노산 서열로 표시되는 CD8 힌지일 수 있다. 상기 "힌지 부위(hinge region)"는 일반적으로 항원-결합 영역과 면역 세포 Fc 수용체 (FcR)-결합영역 사이의 연결 영역을 지칭한다.
본 발명에 있어서, BCMA-결합 도메인의 N 말단에 시그널 펩타이드(signal peptide)를 추가로 포함할 수 있으며, 상기 "시그널 펩타이드(signal peptide)"는 일반적으로 단백질 전달을 안내하기 위한 펩타이드 사슬을 지칭한다. 시그널 펩타이드는 5 내지 30 개의 아미노산 길이를 갖는 짧은 펩타이드일 수 있으며, 본 발명에서는 바람직하게 서열번호 23의 아미노산 서열을 이용하였다.
또한, 본 발명의 또 다른 양태에 따르면,본 발명은 상술한 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드를 제공한다.
본 발명에 있어서, 상기 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드는 BCMA-결합 도메인를 코딩하는 폴리뉴클레오타이드; 막관통 도메인을 코딩하는 폴리뉴클레오타이드; 공동 자극 도메인을 코팅하는 폴리뉴클레오타이드; 및 세포 내 신호전달 도메인을 코딩하는 폴리뉴클레오타이드를 포함할 수 있다.
상기 BCMA-결합 도메인을 코딩하는 폴리뉴클레오타이드는 바람직하게 항-BCMA sdAb No.7, 항-BCMA sdAb No.11 및 항-BCMA sdAb No.19를 코딩하는 폴리뉴클레오타이드일 수 있으며, 구체적인 염기서열은 상술한 바와 같다.
본 발명의 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드는 바람직하게, 서열번호 17의 염기서열로 표시되는 시그널 펩타이드; 각각 서열번호 4 내지 6의 염기서열로 표시되는 항-BCMA sdAb; 서열번호 18의 염기서열로 표시되는 CD8 힌지; 서열번호 19의 염기서열로 표시되는 막관통 도메인; 서열번호 20의 염기서열로 표시되는 4-1BB(공동자극 도메인); 및 서열번호 21의 염기서열로 표시되는 CD3ζ(세포 내 신호전달 도메인)로 구성될 수 있다.
본 발명에서, 용어 "폴리뉴클레오타이드"는 일반적으로 임의의 길이로 분리된 핵산 분자(nucleic acid molecule), 데옥시리보뉴클레오티드 또는 리보뉴클레오티드, 또는 그의 유사체를 지칭한다. 일부 구현예에서, 본 발명의 폴리뉴클레오타이드는 (1) 중합효소 연쇄반응(PCR) 증폭과 같은 in-vitro 증폭; (2) 클로닝 및 재조합; (3) 절단(digestion) 및 겔 전기영동 분리와 같은 정제; (4) 화학 합성과 같은 합성을 통해 제조될 수 있으며, 바람직하게 분리된 폴리뉴클레오타이드는 재조합 DNA 기술에 의해 제조된다. 본 발명에서, 항체 또는 이의 항원 결합 단편을 코딩하기 위한 핵산은 합성 올리고뉴클레오티드의 제한 단편 조작(restriction fragment operation) 또는 SOE PCR의 적용을 포함하지만 이에 제한하지 않고, 당업계에 공지된 다양한 방법에 의해 제조될 수 있다.
또한, 본 발명의 또 다른 양태에 따르면,본 발명은 상기 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드를 포함하는 벡터를 제공한다.
본 발명에서, 용어 "벡터(expression vector)"는 적당한 숙주세포 내에서 목적 유전자가 발현할 수 있도록 프로모터 등의 필수적인 조절 요소를 포함하는 유전자 제조물이다. 벡터는 플라스미드, 레트로바이러스(retroviral) 벡터 및 렌티바이러스(lentiviral) 벡터 중 하나 이상으로부터 선택될 수 있다. 적당한 숙주로 형질전환되면, 벡터는 숙주 게놈과 무관하게 복제하고 기능할 수 있거나, 또는 일부 경우에 게놈 그 자체에 통합될 수 있다.
또한, 벡터는 코딩 영역이 적합한 숙주에서 정확하게 발현될 수 있게 하는 발현 제어 요소를 포함할 수 있다. 이러한 조절 요소는 당업자에게 잘 알려져 있으며, 예를 들어 프로모터, 리보솜 결합 부위(ribosome-binding site), 인핸서(enhancer) 및 유전자 전사(transcription) 또는 mRNA 번역(translation)을 조절하기 위한 다른 조절 요소를 포함할 수 있다. 발현 조절 서열의 특정 구조는 종 또는 세포 유형의 기능에 따라 달라질 수 있으나, 일반적으로 TATA 박스(box), 캡핑된(capped) 서열, CAAT 서열 등과 같은 전사 개시 및 번역 개시에 각각 참여하는 5' 비-전사 서열, 및 5' 또는 3' 비-번역 서열을 함유한다. 예를 들어, 5' 비-전사 발현 조절 서열은 기능적으로 연결된 핵산을 전사 및 조절하기 위한 프로모터 서열을 포함할 수 있는 프로모터 영역을 포함할 수 있다.
본 발명의 구체적인 구현예에서, 상기 벡터는 재조합 바이러스 벡터로, 바람직하게는 렌티바이러스 벡터이며, 작동가능하게 연결된 EF1α 프로모터; 시그널 펩타이드를 코딩하는 폴리뉴클레오타이드; BCMA-결합 도메인을 코딩하는 폴리뉴클레오타이드; 막관통 도메인을 코딩하는 폴리뉴클레오타이드; 세포 내 신호전달 도메인을 코딩하는 폴리뉴클레오타이드를 포함하며, 단백질 발현을 증가시키기 위해 WPRE(woodchuck hepatitis virus post-transcriptional regulatory element)를 추가로 포함할 수 있다.
상기 EF1α 프로모터는 서열번호 16의 염기서열로 표시될 수 있으며, 필요에 따라 상기 서열번호 16의 염기서열과 90% 이상, 93% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 또는 99% 이상 동일한 서열을 포함할 수 있다.
또한, 상기 프로모터는 BCMA-결합 도메인인 항-BCMA 항체(sdAb)의 발현을 유도하도록 작동 가능하게 연결되어 있으며 여기서, "작동 가능하게 연결된(operably linked)"은 일반적 기능을 수행하도록 핵산 발현조절 서열과 목적하는 단백질을 코딩하는 핵산 서열이 기능적으로 연결되어 있는 것을 말한다. 재조합 벡터와의 작동적 연결은 당해 기술분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술분야에서 일반적으로 알려진 효소 등을 사용한다.
유전자를 세포 내로 도입하고 발현시키는 방법은 관련 기술분야에 공지되어 있다. 발현 벡터와 관련하여, 벡터는 관련 기술분야의 임의의 방법에 의해 숙주 세포 내로 용이하게 도입될 수 있다. 예를 들어, 발현 벡터는 물리적, 화학적, 또는 생물학적 수단에 의해 숙주 세포 내로 옮겨질 수 있다.
폴리뉴클레오티드를 숙주 세포 내로 도입하기 위한 물리적 방법은 인산칼슘 침전, 리포펙션, 입자 충격, 미세주사, 전기천공 등을 포함한다. 벡터 및/또는 외인성 핵산을 포함하는 세포를 생산하는 방법은 관련 기술분야에 널리 공지되어 있으며 이를 참조하여 이용할 수 있다. 숙주 세포 내로 폴리뉴클레오티드의 도입을 위한 바람직한 방법은 인산칼슘 형질감염이다.
숙주 세포 내로 폴리뉴클레오티드를 도입하기 위한 생물학적 방법은 DNA 및 RNA 벡터의 사용을 포함한다. 바이러스 벡터, 및 특히 레트로바이러스 벡터는 유전자를 포유동물, 예를 들어 인간 세포 내로 삽입하기 위해 가장 널리 사용되는 방법이 되었다. 다른 바이러스 벡터는 렌티바이러스, 폭스바이러스, 단순 포진 바이러스, 아데노바이러스 및 아데노-연관 바이러스 등으로부터 유래될 수 있다.
숙주 세포 내로 폴리뉴클레오티드를 도입하기 위한 화학적 수단은 콜로이드성 분산액 시스템, 예컨대 거대분자 복합체, 나노캡슐, 마이크로구체, 비드, 및 수중유 에멀젼, 미셀, 혼합된 미셀, 및 리포솜을 비롯한 지질-기반 시스템을 포함한다. 시험관 내 및 생체 내에서 전달 비히클로서 사용하기 위한 예시적인 콜로이드성 시스템은 리포솜 (예를 들어, 인공 막 소포)이다. 핵산의 최신 기술의 표적화된 전달, 예컨대 표적화된 나노입자 또는 다른 적합한 마이크로미터-미만 크기의 전달 시스템을 사용한 폴리뉴클레오티드의 전달을 위한 다른 방법이 이용 가능하다.
비-바이러스 전달 시스템이 이용되는 경우에, 예시적인 전달 비히클은 리포솜이다. 지질 제제의 사용은 숙주세포 내로의 핵산의 도입(시험관 내, 생체 외 또는 생체 내)을 위해 고려된다. 또 다른 측면에서, 핵산은 지질과 회합될 수 있다. 지질과 회합된 핵산은 리포솜의 수성 내부에 캡슐화되거나, 리포솜의 지질 이중층 내에 점재되거나, 리포솜 및 올리고뉴클레오티드 둘 다와 회합된 연결 분자를 통해 리포솜에 부착되거나, 리포솜 내에 포획되거나, 리포솜과 복합체화되거나, 지질 함유 용액 중에 분산되거나, 지질과 혼합되거나, 지질과 조합되거나, 지질 내에 현탁액으로서 함유되거나, 미셀과 함께 함유 또는 복합체화되거나, 또는 지질과 달리 회합될 수 있다. 지질, 지질/DNA 또는 지질/발현 벡터 회합 조성물은 용액 중의 임의의 특정한 구조로 제한되지 않는다.
또한,본 발명의 또 다른 양태에 따르면, 본 발명은 상기 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드 또는 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드를 포함하는 벡터를 포함하고, 상기 키메라 항원 수용체(CAR)를 발현하는, 단리된 면역 세포를 제공한다.
본 발명에 있어서, 상기 면역 세포는 포유동물 유래 세포일 수 있고, T 세포, NK 세포, NKT 세포, B 세포, 수지상 세포, 단핵구, 마크로파지, 호산구, 호염기구 및 호중구로 이루어진 군으로부터 선택된 1 종 이상일 수 있으며, 바람직하게는 T 세포 또는 NK 세포 또는 NKT 세포일 수 있다.
본 발명에 있어서, 상기 키메라 항원 수용체(CAR)를 발현하는 면역 세포는, 본 발명의 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드 또는 이를 포함하는 CAR 벡터를 면역 세포, 예를 들어 T 세포 또는 NK 세포 또는 NKT 세포내로 도입시켜 제조할 수 있다.
구체적으로, CAR 벡터는 전기천공법, 리포펙타민(lipofectamine 2000, Invitrogen) 등과 같은 당업계에 공지된 방법에 의해 세포 내로 도입될 수 있다. 예를 들어, 면역 이펙터 세포는 렌티바이러스 벡터에 의해 형질 감염되어 CAR 분자를 운반하는 바이러스 게놈을 숙주 게놈에 통합시켜 표적 유전자의 장기적이고 안정적인 발현을 보장할 수 있다. 다른 예를 들어, 전이인자(transposon)는 CAR 운반 플라스미드(transposon) 및 전이효소 운반 플라스미드를 표적 세포 내로 도입하는데 이용될 수 있다. 다른 예를 들어, CAR 분자는 유전자 편집방법 (예컨대 CRISPR / Cas9)에 의해 게놈에 첨가될 수 있다.
본 발명의 일 실시예에서는, BCMA-CAR를 코팅하는 폴리뉴클레오타이드가 삽입된 렌티바이러스 벡터를 제조하였으며, 제조된 벡터를 T 세포에 형질전환 시켜 BCMA-CAR-T 세포를 제조하였다. 제조된 hBCMA-CAR-T 세포에서는 본 발명의 BCMA를 표적으로 하는 키메라 항원 수용체를 발현하게 된다.
키메라 항원 수용체(CAR)를 발현하는 면역 이펙터 세포 제조를 위한 면역 이펙터 세포는 대상체로 부터 수득할 수 있으며, 상기 "대상체"는 면역 반응이 도출될 수 있는 살아있는 유기체 (예를 들어, 포유동물)를 포함한다. 대상체의 예는 인간, 개, 고양이, 마우스, 래트, 및 그의 트랜스제닉 종을 포함한다. T 세포는 말초 혈액 단핵 세포, 골수, 림프절 조직, 제대혈, 흉선 조직, 감염 부위로부터의 조직, 복수, 흉막 삼출, 비장 조직, 및 종양을 비롯한 수많은 공급원으로부터 수득될 수 있다.
상기 T 세포는 통상의 기술자에게 공지된 임의의 많은 기술, 예를 들면, 피콜(Ficoll)™ 분리를 사용하여 대상체로부터 수집된 혈액 단위로부터 수득될 수 있다. 혈액으로부터 세포는 분리반출술에 의해 수득되며, 분리반출술 생성물은 전형적으로 T 세포, 단핵구, 과립구, B 세포를 비롯한 림프구, 다른 유핵 백혈구, 적혈구, 및 혈소판을 함유한다.
분리반출술에 의해 수집된 세포는 혈장 분획을 제거하고 세포를 후속 프로세싱 단계를 위해 적절한 완충제 또는 배지에 두기 위해 세척될 수 있다. T 세포는 적혈구를 용해시키고, 예를 들어 퍼콜(PERCOLL)™ 구배를 통한 원심분리에 의해 또는 역류 원심 분리에 의해 단핵구를 고갈시킴으로써 말초 혈액 림프구로부터 단리된다.
본 발명의 일 실시예에서, 말초 혈액 단핵세포(peripheral blood mononuclear cell, PBMC)로 부터 활성화된 T 세포를 분리한 다음, BCMA-CAR 렌티바이러스를 T 세포에 형질도입시켜 BCMA-CAR-T 세포를 제조하였다. 제조된 BCMA-CAR-T 세포의 BCMA 펩타이드 결합능을 확인한 결과, BCMA 펩타이드 증가에 따라, BCMA와 결합하는 CD4 또는 CD8를 발현하는 BCMA-CAR-T 세포가 증가하는 것을 확인하였다. 이는 본 발명에서 제조한 BCMA-CAR-T 세포가 효과적으로 BCMA와 결합하는 것을 의미한다.
본 발명의 일 실시예에서, hBCMA-CAR-T 세포에 의한 표적 세포의 사멸효과를 확인한 결과, BCMA-CAR-T 세포는 BCMA를 발현하는 세포-특이적으로 사멸 효과를 보이는 것을 확인하였다.
즉, 본 발명의 BCMA를 표적으로 하는 키메라 항원 수용체 및 CAR-T 세포는 B 세포 또는 BCMA 발현과 관련된 질환 예방 또는 치료용 조성물로 유용하게 활용할 수 있다.
또한, 본 발명의 또 다른 양태에 따르면, 본 발명은 상술한 BCMA를 표적하는 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드; 또는 BCMA를 표적하는 키메라 항원 수용체(CAR)를 표면에 발현하는 단리된 면역 세포를 포함하는 BCMA 발현과 관련된 질환 예방 또는 치료용 약학적 조성물을 제공한다.
또한, 본 발명은 BCMA를 표적으로 하는 항체를 포함하는 BCMA 발현과 관련된 질환 예방 또는 치료용 약학적 조성물을 제공한다.
BCMA(야생형 또는 돌연변이체 BCMA) 발현과 관련된 질환은 암, 악성종양 또는 자가면역 질환일 수 있다. 바람직하게 다발성골수종(multiple myeloma), 혈액암, 비-호지킨 림프종(non-Hodgkin's lymphoma), 자가항체-의존성 자가면역 질환(autoantibody-dependent autoimmune disease), 전신홍반루프스(systemic lupus erythematosus, SLE) 및 류마티스 관절염(rheumatoid arthritis)으로 이루어진 군으로부터 선택된 1 종 이상일 수 있다.
상기 약학적 조성물은 약학적으로 허용되는 담체를 추가로 포함할 수 있다. 경구 투여 시에는 결합제, 활탁제, 붕해제, 부형제, 가용화제, 분산제, 안정화제, 현탁화제, 색소, 향료 등을 사용할 수 있고, 주사제의 경우에는 완충제, 보존제, 무통화제, 가용화제, 등장제, 안정화제 등을 혼합하여 사용할 수 있으며, 국소 투여용의 경우 에는 기제, 부형제, 윤활제, 보존제 등을 사용할 수 있다.
상기 약학적 조성물의 제형은 상술한 약제학적으로 허용되는 담체와 혼합하여 다양하게 제조될 수 있다. 예를들어, 경구 투여 시에는 정제, 트로키, 캡슐, 엘릴시르, 서스펜션, 시럽, 웨이퍼 등의 형태로 제조될 수 있으며, 주사제의 경우에는 단위 투약 앰플 또는 다수회 투약 형태로 제조될 수 있다.
또한, 상기 약학적 조성물은 막 투과성을 향상시킬 수 있는 계면활성제를 포함할 수 있다. 이러한 계면활성제는 스테로이드에서 유도된 것이거나 N-[1-(2,3-디올레오일)프로필-N,N,N-트리메틸암모늄클로라이드(DOTMA) 등의 양이온성 지질, 또는 콜레스테롤 헤미숙시네이트, 포스파티딜 글리세롤 등의 각종 화합물일 수 있으나, 이에 한정되는 것은 아니다.
또한, 본 발명은 본 발명에 따른 약학적 조성물을 개체에 투여하는 단계를 포함하는 BCMA 발현과 관련된 질환을 예방하거나 치료하는 방법을 제공한다. 상기 BCMA를 표적하는 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드; 또는 BCMA를 표적하는 키메라 항원 수용체(CAR)를 표면에 발현하는 단리된 면역 세포; 또는 BCMA를 표적으로 하는 항체를 포함하는 약학적 조성물은 BCMA 발현과 관련된 질환을 예방 또는 치료하기 위해 약학적으로 효과적인 양으로 투여될 수 있다. 질환 종류, 환자의 연령, 체중, 증상의 특성 및 정도, 현재 치료법의 종류, 치료 회수, 투여 형태 및 경로 등 다양한 요인에 따라 달라질 수 있으며, 해당분야의 전문가들에 의해 용이하게 결정될 수 있다.
상기 약학적 조성물은 상기한 약리학적 또는 생리학적 성분과 함께 투여되거나 순차적으로 투여될 수 있으며, 또한 추가의 종래의 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있다. 이러한 투여는 단일 또는 다중 투여일 수 있다. 상기 요소를 모두 고려하여 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하며, 이는 당업자에 의해 용이하게 결정될 수 있다.
본 명세서에서 사용된 용어 "개체"는 상기 약학적 조성물을 투여하여 경감, 억제 또는 치료될 수 있는 상태 또는 질환을 앓고 있거나 그러한 위험이 있는 포유동물을 의미하며, 바람직하게 사람을 의미한다.
본 발명에서 사용되는 용어 '투여'는 임의의 적절한 방법으로 개체에게 본 발명의 약학 조성물을 제공하는 것을 의미한다. 본 발명은 약학 조성물은 연구자, 수의사, 의사 또는 기타 임상에 의해 생각되는 조직계, 동물 또는 인간에서 생물학적 또는 의학적 반응을 유도하는 유효 성분 또는 약학적 조성물의 양, 즉 치료되는 질환 또는 장애의 증상의 완화를 유도하는 양인 치료상 유효량으로 투여할 수 있다. 본 발명의 약학 조성물에 대한 치료상 유효 투여량 및 투여횟수는 원하는 효과에 따라 변화될 것임은 당업자에게 자명하다. 그러므로, 투여될 최적의 투여량은 당업자에 의해 쉽게 결정될 수 있으며, 질환의 종류, 질환의 중증도, 조성물에 함유된 유효성분 및 다른 성분의 함량, 제형의 종류, 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여시간, 투여 경로 및 조성물의 분비율, 치료기간, 동시 사용되는 약물을 비롯한 다양한 인자 등에 따라 조절될 수 있다. 본 발명의 약학 조성물은 1~10,000㎎/㎏/일의 양으로 투여할 수 있으며, 하루에 한번 투여할 수도 있고, 수 회에 나누어 투여할 수도 있다.
또한, 본 발명의 또 다른 양태에 따르면, 본 발명은 상술한 BCMA를 표적하는 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드; 또는 BCMA를 표적하는 키메라 항원 수용체(CAR)를 표면에 발현하는 단리된 면역 세포를 포함하는 BCMA 발현과 관련된 질환 예방 또는 개선용 식품 조성물을 제공한다.
본 발명의 식품 조성물은 건강기능식품, 식품 첨가제 또는 식이보조제로 사용될 수 있다.
식품 첨가제로 사용할 경우, 본 발명의 유효성분을 그대로 첨가하거나, 다른 식품 또는 식품 성분과 함께 혼합하여 사용되는 등 통상적인 방법에 따라 적절하게 사용될 수 있다.
상기 건강기능식품이란, 본 발명의 유효 성분을 음료, 차류, 향신료, 껌, 과자류 등의 식품소재에 첨가하거나, 캡슐화, 분말화, 현탁액 등으로 제조한 식품으로, 이를 섭취할 경우 건강상 특정한 효과를 가져오는 것을 의미하나, 일반 약품과는 달리 식품을 원료로 하여 약품의 장기 복용시 발생할 수 있는 부작용 등이 없는 장점이 있다. 이와 같이 하여 얻어지는 본 발명의 건강기능식품은, 일상적으로 섭취하는 것이 가능하기 때문에 매우 유용하다. 이와 같은 건강식품에 있어서의 유효 성분의 첨가량은, 대상인 건강식품의 종류에 따라 달라 일률적으로 규정할 수 없지만, 식품 본래의 맛을 손상시키지 않는 범위에서 첨가하면 되며, 대상 식품에 대하여 통상 0.01 내지 50 중량%, 바람직하기로는 0.1 내지 20 중량%의 범위이다. 또한, 과립, 정제 또는 캡슐형태의 식품의 경우에는 통상 0.1 내지 100 중량% 바람직하기로는 0.5 내지 80 중량%의 범위에서 첨가하면 된다. 한 구체예에서, 본 발명의 건강기능식품은 음료의 형태일 수 있다.
또한, 상기 유효 성분의 혼합양은 사용 목적(예방, 건강 또는 치료적 처치)에 따라 적합하게 변경될 수 있음은 물론이며, 식품 조성물 총 중량에 대하여 0.01~95중량%로 포함되는 것이 바람직하며, 더욱 바람직하게는 1~80중량%로 포함되는 것이다. 그 함량이 0.01중량% 미만일 경우에는 복용의 효율성이 떨어질 수 있으며, 95중량%를 초과할 경우에는 사용량 대비 효과 상승률이 낮아 비경제적일 수 있다.
구체적인 예로, 식품 또는 음료의 제조 시에는 본 발명의 유효 성분은 원료에 대하여 15중량% 이하, 바람직하게는 10중량% 이하의 양으로 첨가된다. 그러나 건강 및 위생을 목적으로 하거나 또는 건강 조절을 목적으로 하여 장기간 섭취할 경우에는 상기 범위 이하의 양으로 첨가될 수 있으며, 안전성 면에서 아무런 문제가 없기 때문에 유효성분은 상기 범위 이상의 양으로도 사용될 수 있다.
상기 식품의 종류에는 특별한 제한은 없으나, 본 발명의 유효 성분을 첨가할 수 있는 식품의 예로는 육류, 소시지, 빵, 초콜릿, 캔디류, 스낵류, 과자류, 피자, 라면, 기타 면류, 껌류, 아이스크림류를 포함한 낙농제품, 각종 수프, 음료수, 차, 드링크제, 알코올 음료, 비타민 복합제 등이 있으며, 통상적인 의미에서의 건강식품을 모두 포함한다.
본 발명의 식품 조성물이 음료로 제조될 경우 통상의 음료와 같이 여러 가지 향미제 또는 천연 탄수화물 등의 추가 성분을 포함할 수 있다. 상기 천연 탄수화물로는 포도당, 과당 등의 모노사카라이드; 말토오스, 수크로오스 등의 디사카라이드; 덱스트린, 사이클로덱스트린 등의 천연 감미제; 사카린, 아스파르탐 등의 합성 감미제 등이 사용될 수 있다. 상기 천연 탄수화물은 본 발명의 식품 조성물 총 중량에 대하여 0.01~10중량%, 바람직하게는 0.01~0.1중량%로 포함된다.
본 발명의 식품 조성물은 여러 가지 영양제, 비타민, 전해질, 풍미제, 착색제, 펙트산 및 그의 염, 알긴산 및 그의 염, 유기산, 보호성 콜로이드 증점제, pH 조절제, 안정화제, 방부제, 글리세린, 알코올, 탄산음료에 사용되는 탄산화제 등을 포함할 수 있으며, 천연 과일주스, 과일주스 음료 및 야채 음료의 제조를 위한 과육을 포함할 수 있으나 이에 제한되지 않는다. 이러한 성분은 독립적으로 또는 조합하여 사용할 수 있다. 상기의 첨가제 비율은 크게 제한되지는 않으나, 본 발명의 식품 조성물 총 중량에 대하여 0.01~0.1중량% 범위내로 포함되는 것이 바람직하다.
건강 및 위생을 목적으로 하거나 건강 조절을 목적으로 하는 장기간의 섭취인 경우, 본 발명의 식품 조성물은 안전성 면에서 세포 독성이 거의 없기 때문에 장기간 복용이 가능하다.
본 명세서에서 식품이란 함은 영양소를 한 가지 또는 그 이상 함유하고 있는 천연물 또는 가공품을 의미하며, 바람직하게는 어느 정도의 가공 공정을 거쳐 직접 먹을 수 있는 상태가 된 것을 의미하며, 통상적인 의미로서의 식품, 식품 첨가제, 건강 기능성 식품, 음료 및 음료 첨가제 등을 모두 포함하는 의도이다.
또한, 본 발명의 또 다른 양태에 따르면, 본 발명은 상술한 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드; 키메라 항원 수용체(CAR)를 표면에 발현하는 단리된 면역 세포를, 약학적 유효량으로 대상(subject)에게 투여하는 단계를 포함하는, BCMA 발현과 관련된 질환 예방 또는 치료 방법을 제공한다.
본 발명의 치료는 BCMA 발현과 관련된 질환은 앞서 설명한 질환과 동일하며, 예컨대, 암으로 진단받은 환자를 치료하는데 사용될 수 있다. 본 발명의 CAR 및 CAR-T 세포로 치료될 암의 유형은 다발성골수종을 포함하나 이에 제한되지는 않는다.
본 발명의 치료 방법은 항체 요법, 화학요법, 사이토카인 요법, 수지상 세포 요법, 유전자 요법, 호르몬 요법, 레이저 광 요법 및 방사선 요법의 군으로부터 선택된 암에 대한 1종 이상의 요법과 조합될 수 있다.
본 발명의 방법은 상술한 바를 이용하므로, 이와 중복된 내용은 본 명세서의 과도한 복잡성을 피하기 위하여 그 기재를 생략한다.
본 발명에서 제조된 BCMA를 표적으로 하는 키메라 항원 수용체 및 CAR-면역 세포는 BCMA와 효과적으로 결합할 뿐만 아니라, BCMA와 결합한 CAR-면역 세포의 활성화가 이루어진 것을 확인하였다. 또한, 본 발명의 CAR-면역 세포는 BCMA를 발현하는 세포를 효과적으로 사멸시키는 것을 확인하였으므로, 본 발명의 BCMA를 표적으로 하는 키메라 항원 수용체 및 CAR-면역 세포는 B 세포 또는 BCMA 발현과 관련된 질환 예방 또는 치료용 조성물로 유용하게 활용할 수 있다.
도 1은 본 발명의 항-BCMA sdAb No.7, No.11 및 No.19의 BCMA 결합능을 확인한 데이터이다.
도 2는 본 발명의 BCMA를 표적으로 하는 키메라 항원 수용체(CAR)를 나타낸 모식도이다.
도 3은 본 발명의 BCMA를 표적으로 하는 키메라 항원 수용체(BCMA-CAR)를 발현하는 렌티바이러스 벡터 및 T 세포에서 발현된 키메라 항원 수용체를 나타낸 모식도이다.
도 4는 본 발명의 BCMA-CAR를 발현하는 렌티바이러스를 이용한 BCMA-CAR-T 세포 제조방법을 나타낸 모식도이다.
도 5는 본 발명의 BCMA-CAR-T 세포의 BCMA 결합능을 확인한 데이터이다.
도 6은 본 발명의 BCMA-CAR-T 세포에 의한 표적 세포의 사멸 효과를 확인한 데이터이다.
도 2는 본 발명의 BCMA를 표적으로 하는 키메라 항원 수용체(CAR)를 나타낸 모식도이다.
도 3은 본 발명의 BCMA를 표적으로 하는 키메라 항원 수용체(BCMA-CAR)를 발현하는 렌티바이러스 벡터 및 T 세포에서 발현된 키메라 항원 수용체를 나타낸 모식도이다.
도 4는 본 발명의 BCMA-CAR를 발현하는 렌티바이러스를 이용한 BCMA-CAR-T 세포 제조방법을 나타낸 모식도이다.
도 5는 본 발명의 BCMA-CAR-T 세포의 BCMA 결합능을 확인한 데이터이다.
도 6은 본 발명의 BCMA-CAR-T 세포에 의한 표적 세포의 사멸 효과를 확인한 데이터이다.
이하, 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로서, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 본 발명이 속하는 기술분야에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.
실시예 1. BCMA를 표적으로 하는 단일 도메인 항체 제조 및 선별
본 발명자들은 BCMA 펩타이드 특이적인 단일 도메인 항체를 제조하기 위해, 낙타에서 유래된 단일-도메인 항체(single-domain antibody)의 라이브러리로부터 스크리닝하였다.
보다 구체적으로, 낙타의 항체 라이브러리를 갖는 대장균 세포를 VCSM13 헬퍼파아지 (helper phage)로 감염시켜 배양한 후 배양액으로부터 항체 단백질이 표면에 발현된 (surface displayed) 파아지 파티클을 회수하였다. BCMA와 결합하는 항체를 스크리닝하기 위하여 파아지 패닝 기술을 이용하였다. 패닝은 대상 표적에 더 높은 친화성 결합을 보유한 모집단 내의 파지를 농축하기 위한 반복 공정이다.
먼저, 라이브러리를 선택한 항원에 노출시킨 뒤 가장 높은 결합 친화력(binding affinity)을 가진 항원만 용리 및 증폭시켜 파지의 집단(population)을 축적하였다. 다음으로, 콜로니 피킹 단계로 각 고유 단백질 결합체를 분리하기 위해 이전 단계에서 선택한 박테리오 파지를 클로닝하여 선택하였다. 마지막으로 패닝 과정 동안 결합 친화력(binding affinity)이 더 낮았던 단백질을 표시하는 파지 클론에 비해 결합 친화력이 더 높은 단백질을 표시하는 파지 클론들을 선택하였다.
이 선택 과정은 정성적이므로 항체-항원 상호작용을 평가하는 보다 정량적인 ELISA 검출을 진행하여 BCMA에 결합하는 단일-도메인(single-domain) 항체를 선별하였고, 상기 선별된 BCMA 단일 도메인 항체 3 종을 각각 항-BCMA sdAb No.7, 항-BCMA sdAb No.11 및 항-BCMA sdAb No.19로 명명하였다. 또한, 이들의 VHH(variable heavy chain domains of heavy chain antibody)를 시퀀싱하여 프레임 영역 FR과 상보성 결정 영역 CDR을 확인하였다.
상술한 서열분석 결과에 따른 항체의 중쇄 가변 도메인(VHH)에 대한 서열정보는 하기 표 1에 정렬하였으며, 하기 표 1에서 밑줄친 부분은 상보성 결정 영역(complementarity determining region; CDR)를 의미한다.
표 1에 나타낸 바와 같이, 항-BCMA sdAb No.7은 서열번호 7의 아미노산 서열로 표시되는 CDR1, 서열번호 10의 아미노산 서열로 표시되는 CDR2 및 서열번호 13의 아미노산 서열로 표시되는 CDR3를 포함하는 중쇄 가변 도메인(VHH); 항-BCMA sdAb No.11은 서열번호 8의 아미노산 서열로 표시되는 CDR1, 서열번호 11의 아미노산 서열로 표시되는 CDR2 및 서열번호 14의 아미노산 서열로 표시되는 CDR3를 포함하는 중쇄 가변 도메인(VHH); 및 항-BCMA sdAb No.19는 서열번호 9의 아미노산 서열로 표시되는 CDR1, 서열번호 12의 아미노산 서열로 표시되는 CDR2 및 서열번호 15의 아미노산 서열로 표시되는 CDR3를 포함하는 중쇄 가변 도메인(VHH)으로 구성되는 것을 확인하였다.
구체적으로, 상기 항-BCMA sdAb No.7, No.11 및 No.19는, 각각 서열번호 1, 2 및 3의 아미노산 서열로 표시되는 중쇄가변 도메인으로 구성되며, 또한, 상기 항-BCMA sdAb들은 각각 서열번호 4, 5 및 6의 염기서열로 코딩되는 것을 확인하였다.
| 서열 명 | 서열번호 | 서열 | |
| 항-BCMA sdAb, No.7 | 아미노산 서열 |
서열번호 1 | KLEESGGGSVQTGGSLRLTCAASGSIFSSGFMAWFRQAPGKEREFVSGISWRGDSTGYADSVKGRFTISRDNAKNTVDLQMNSLKPEDTAIYYCAARGTDTAYWGQGTQVTVSS |
| 염기서열 | 서열번호 4 | AAGCTGGAGGAGAGCGGTGGTGGCTCCGTGCAGACAGGAGGAAGCTTGCGCCTGACCTGCGCCGCTTCCGGCTCCATTTTTTCATCTGGCTTCATGGCGTGGTTCCGCCAGGCCCCCGGGAAGGAGAGGGAGTTCGTCTCGGGCATCAGTTGGCGTGGTGATTCTACTGGCTACGCGGACAGCGTGAAGGGCCGCTTCACCATCTCTCGGGACAACGCCAAGAACACGGTGGACCTGCAGATGAACTCCCTCAAACCTGAAGATACTGCTATCTACTACTGTGCTGCACGCGGGACCGACACCGCCTATTGGGGCCAGGGCACCCAGGTCACCGTGTCGTCC | |
| CDR1 | 서열번호 7 | SIFSSGFMA | |
| CDR2 | 서열번호 10 | FVSGISWRGDSTG | |
| CDR3 | 서열번호 13 | AARGTDTA | |
| 항-BCMA sdAb, No.11 | 아미노산 서열 |
서열번호 2 | KLEESGGGSVQTGGSLRLTCAASGSISRLDNMGWFRQAPGKERELVAAINSKSNKTNYADSVKGRFTISRDNAKNTVDLQMNSLKPEDTAIYYCANWSFDKHRAYWGQGTQVTVSS |
| 염기서열 |
서열번호 5 | AAGCTGGAGGAGAGCGGTGGGGGCTCCGTGCAGACAGGAGGCTCCCTCCGCCTGACTTGCGCCGCTTCCGGTTCTATCTCTCGTTTGGATAATATGGGCTGGTTCCGCCAGGCCCCCGGGAAGGAGAGGGAGCTGGTGGCTGCAATTAATTCCAAGAGCAACAAGACCAACTACGCGGACAGTGTGAAGGGCCGCTTCACCATCTCGCGGGACAACGCGAAAAACACGGTTGACCTGCAGATGAACAGCCTTAAACCTGAAGACACCGCCATCTACTACTGTGCCAACTGGTCTTTTGATAAGCACCGCGCTTATTGGGGCCAGGGCACCCAGGTCACCGTGTCCTCC | |
| CDR1 | 서열번호 8 | SISRLDNMG | |
| CDR2 | 서열번호 11 | LVAAINSKSNKTN | |
| CDR3 | 서열번호 14 | ANWSFDKHRA | |
| 항-BCMA sdAb, No.19 | 아미노산 서열 |
서열번호 3 | KLEESGGGSVQTGGSLRLTCAASGIIFSDDAIGWFRQAPGKERELVSLIDSKSSTYYADSVKGRFTISRDNAKNTVDLQMNSLKPEDTAIYYCNDHKRRQAMEYWGQGTQVTVSS |
| 염기서열 |
서열번호 6 | AAGCTGGAGGAGAGCGGAGGAGGCTCCGTGCAGACTGGGGGCTCCCTTCGCCTGACCTGTGCCGCTTCCGGTTCGATTTTTTCAAGCGATGTGATGGCATGGTTCCGCCAGGCCCCCGGGAAGGAGCGCGAGTTCGTCTCTGGCATCAGTTGGCGTGGTGATTCTACCGGCTACGCGGACAGCGTGAAGGGCCGCTTCACCATCTCTCGGGACAACGCGAAGAACACGGTTGACCTGCAGATGAACTCCCTCAAACCTGAAGACACCGCCATCTACTACTGCACTACATTGAGGGAGGCTCAGTCCGCCCCCCACAACCTGCAAGCCGCCTATTGGGGCCAGGGCACCCAGGTCACCGTGTCGTCC | |
| CDR1 | 서열번호 9 | IIFSDDAIG | |
| CDR2 | 서열번호 12 | LVSLIDSKSSTY | |
| CDR3 | 서열번호 15 | NDHKRRQAME |
실시예 2. 항-BCMA sdAb의 결합능 확인
본 발명자들은 상기 실시예 1에서 확립한 본 발명의 항-BCMA sdAb들이 BCMA를 특이적으로 표적화할 수 있는지 BCMA에 대한 특이성을 확인하기 위해, 유세포분석을 실시하였다.
간략하게는, BCMA를 발현하는 다발성골수종 H929 세포 5x105 개와 항-BCMA No.7, No.11 및 No.19 1 ㎍ 각각을 30 분간 반응시킨 다음, 2차 항체로 표면(surface)을 염색한 후, 유세포분석기로 측정하였다.
이때, 양성대조군으로 PE-컨쥬게이션된 항-BCMA 항체(PE-conjugated anti-BCMA antibody; Biolegend Inc., cat# 357503, 미국) 5㎍를 사용하였으며, 2차 항체로는 PE-컨쥬게이션된 항-마우스 IgG 항체(PE-conjugated goat anti-mouse IgG; Biolegend Inc., cat# 405307, 미국) 5㎍를 사용하였다.
그 결과, 도 1에 나타낸 바와 같이, 본 발명의 항-BCMA sdAb No.7, No.11, No.19 모두 BCMA를 발현하는 세포와 특이적으로 결합하는 것을 확인하였다.
이는, 본 발명에서 선별한 항체들이 BCMA를 발현하는 세포를 특이적으로 인식하였으므로, BCMA를 발현하는 세포에 의해 매개되는 질환의 치료뿐만 아니라 진단 등 다양한 분야에 유용하게 활용할 수 있음을 입증한다.
실시예 3. BCMA를 표적으로 하는 키메라 항원 수용체(CAR) 발현 벡터 제작
본 발명자들은, 도 2의 모식도에 나타낸 것과 같은 BCMA를 표적으로 하는 키메라 항원 수용체(CAR)를 제작하기 위하여, 상기 실시예 1에서 BCMA에 대한 특이성이 높은 것으로 선별된 항-BCMA sdAb No.7, No.11, No.19를 이용하여, BCMA를 표적으로 하는 키메라 항원수용체(CAR)를 발현하는 렌티바이러스 벡터(BCMA-CAR 렌티바이러스)를 각각 제작하였다.
도 3의 모식도에 나타낸 바와 같이, EF1α 프로모터(서열번호 16); 시그널 펩타이드를 코딩하는 폴리뉴클레오타이드(서열번호 17); BCMA-결합 도메인을 코딩하는 폴리뉴클레오타이드(서열번호 4, 5 또는 6); CD8 힌지 부위를 코딩하는 폴리뉴클레오타이드(서열번호 18); 막관통 도메인을 코딩하는 폴리뉴클레오타이드(서열번호 19); 4-1BB(공동자극 도메인)을 코딩하는 폴리뉴클레오타이드(서열번호 20); CD3ζ(세포내 신호전달도메인)을 코딩하는 폴리뉴클레오타이드(서열번호 21); 및 WPRE를 코딩하는 폴리뉴클레오타이드(서열번호 22)로 구성된 CAR DNA를 생체외(in vitro)에서 합성하여 3세대 렌티바이러스 벡터에 삽입하였다. 상기 서열정보는 하기 표 2에 정렬하였다.
렌티바이러스 벡터는 pMDLg/pRRE(Addgene, cat# #12251) pMD2.G(Addgene, cat##12259), pRSV-Rev(Addgene, cat##12253)의 세 가지 벡터 함께 Lenti-X 293T 세포로 공동 감염(co-transfection)시킨 다음, BCMA-CAR 렌티바이러스를 생산하였다. 공동 감염을 위해 Lipofectamine 3000 transfection kit(Invitrogen, cat# L3000-015)와 Opti-MEM+GlutaMAX(gibco, cat# 51985-034) 배지를 사용하여 세 가지 벡터와 Lenti-X 293T 세포를 6시간 배양하였다.
| 서열 명 | 서열번호 | 서열 | |
| EF1 프로모터 | 염기서열 | 서열번호 16 | GCTCCGGTGCCCGTCAGTGGGCAGAGCGCACATCGCCCACAGTCCCCGAGAAGTTGGGGGGAGGGGTCGGCAATTGAACCGGTGCCTAGAGAAGGTGGCGCGGGGTAAACTGGGAAAGTGATGTCGTGTACTGGCTCCGCCTTTTTCCCGAGGGTGGGGGAGAACCGTATATAAGTGCAGTAGTCGCCGTGAACGTTCTTTTTCGCAACGGGTTTGCCGCCAGAACACAGGTAAGTGCCGTGTGTGGTTCCCGCGGGCCTGGCCTCTTTACGGGTTATGGCCCTTGCGTGCCTTGAATTACTTCCACCTGGCTGCAGTACGTGATTCTTGATCCCGAGCTTCGGGTTGGAAGTGGGTGGGAGAGTTCGAGGCCTTGCGCTTAAGGAGCCCCTTCGCCTCGTGCTTGAGTTGAGGCCTGGCCTGGGCGCTGGGGCCGCCGCGTGCGAATCTGGTGGCACCTTCGCGCCTGTCTCGCTGCTTTCGATAAGTCTCTAGCCATTTAAAATTTTTGATGACCTGCTGCGACGCTTTTTTTCTGGCAAGATAGTCTTGTAAATGCGGGCCAAGATCTGCACACTGGTATTTCGGTTTTTGGGGCCGCGGGCGGCGACGGGGCCCGTGCGTCCCAGCGCACATGTTCGGCGAGGCGGGGCCTGCGAGCGCGGCCACCGAGAATCGGACGGGGGTAGTCTCAAGCTGGCCGGCCTGCTCTGGTGCCTGGCCTCGCGCCGCCGTGTATCGCCCCGCCCTGGGCGGCAAGGCTGGCCCGGTCGGCACCAGTTGCGTGAGCGGAAAGATGGCCGCTTCCCGGCCCTGCTGCAGGGAGCTCAAAATGGAGGACGCGGCGCTCGGGAGAGCGGGCGGGTGAGTCACCCACACAAAGGAAAAGGGCCTTTCCGTCCTCAGCCGTCGCTTCATGTGACTCCACTGAGTACCGGGCGCCGTCCAGGCACCTCGATTAGTTCTCGAGCTTTTGGAGTACGTCGTCTTTAGGTTGGGGGGAGGGGTTTTATGCGATGGAGTTTCCCCACACTGAGTGGGTGGAGACTGAAGTTAGGCCAGCTTGGCACTTGATGTAATTCTCCTTGGAATTTGCCCTTTTTGAGTTTGGATCTTGGTTCATTCTCAAGCCTCAGACAGTGGTTCAAAGTTTTTTTCTTCCATTTCAGGTGTCGTGA |
| 시그널 펩타이드 | 염기서열 | 서열번호 17 | ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCCAGGCCG |
| 아미노산서열 | 서열번호 23 | MALPVTALLLPLALLLHAARP | |
| CD8 힌지 | 염기서열 | 서열번호 18 | ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGAT |
| 아미노산서열 | 서열번호 24 | TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD | |
| 막관통 도메인 | 염기서열 | 서열번호 19 | ATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGC |
| 아미노산서열 | 서열번호 25 | IYIWAPLAGTCGVLLLSLVITLYC | |
| 4-1BB | 염기서열 | 서열번호 20 | AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTG |
| 아미노산서열 | 서열번호 26 | KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL | |
| CD3ξ | 염기서열 | 서열번호 21 | AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC |
| 아미노산서열 | 서열번호 27 | RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR | |
| WPRE | 염기서열 | 서열번호 22 | ATCAACCTCTGGATTACAAAATTTGTGAAAGATTGACTGGTATTCTTAACTATGTTGCTCCTTTTACGCTATGTGGATACGCTGCTTTAATGCCTTTGTATCATGCTATTGCTTCCCGTATGGCTTTCATTTTCTCCTCCTTGTATAAATCCTGGTTGCTGTCTCTTTATGAGGAGTTGTGGCCCGTTGTCAGGCAACGTGGCGTGGTGTGCACTGTGTTTGCTGACGCAACCCCCACTGGTTGGGGCATTGCCACCACCTGTCAGCTCCTTTCCGGGACTTTCGCTTTCCCCCTCCCTATTGCCACGGCGGAACTCATCGCCGCCTGCCTTGCCCGCTGCTGGACAGGGGCTCGGCTGTTGGGCACTGACAATTCCGTGGTGTTGTCGGGGAAGCTGACGTCCTTTCCATGGCTGCTCGCCTGTGTTGCCACCTGGATTCTGCGCGGGACGTCCTTCTGCTACGTCCCTTCGGCCCTCAATCCAGCGGACCTTCCTTCCCGCGGCCTGCTGCCGGCTCTGCGGCCTCTTCCGCGTCTTCGCCTTCGCCCTCAGACGAGTCGGATCTCCCTTTGGGCCGCCTCCCCGCCTG |
실시예 4. hBCMA-CAR-T 세포 제조
본 발명자들은 상기 실시예 3에서 제작한 3종의 BCMA-CAR 렌티바이러스 벡터를 T 세포에 형질 전환시켜 BCMA-CAR-T 세포(각각 No.7 CAR-T, No.11 CAR-T, No.19 CAR-T)를 제조하였다.
보다 구체적으로, 도 4에 나타낸 바와 같이, 혈액에서 말초혈액단핵세포(peripheral blood mononuclear cell, PBMC)를 분리한 다음, T 세포 활성화 비드(T cell activation bead; MiltenylBiotec, cat# 130-091-441)를 사용해 T 세포를 활성화시켰다. 활성화된 T 세포에 상기 실시예 3에서 제조한 BCMA-CAR 렌티바이러스를 T 세포에 형질 도입시켜 BCMA-CAR-T 세포를 제조하였으며, Lenti-boost-p를 사용하여 형질 도입 효율을 증가시켰다.
또한, 본 발명자들은 상기 BCMA-CAR-T 세포의 BCMA 펩타이드 결합능을 확인하기 위하여, 유세포분석(Flow Cytometry)을 실시하였다.
간략하게는, 상기에서 제조한 BCMA-CAR-T세포를 FITC-BCMA 단백질(Acrobiosystems, cat#BCA-HF2H3)과 anti-CD3, anti-CD4, anti-CD8 항체와 반응시킨 후 FACS 기계를 이용해 형광 세기를 측정하였다. 분석과정에서 CD3를 발현하는 세포를 T 세포로 하여 T 세포안에서 FITC 발현 정도를 확인하였다.
그 결과, 도 5에 나타낸 바와 같이, BCMA 펩타이드 증가에 따라, BCMA와 결합하는 CD4 또는 CD8를 발현하는 BCMA-CAR-T 세포가 증가하는 것을 확인하였다.
이는 본 발명에서 제조한 BCMA-CAR-T 세포가 효과적으로 BCMA와 결합하는 것을 입증한다.
실시예 5. BCMA 발현 세포에 대한 BCMA-CAR-T 세포의 사멸 효과 확인
본 발명자들은 본 발명의 BCMA-CAR-T 세포에 의한 표적세포의 사멸효과를 확인하고자 하였다.
간략하게는, 표적세포로 BCMA를 발현하지 않는 K562 세포와 BCMA를 발현하는 H929 세포를 이용하였으며, BCMA-CAR-T 세포와 1:4, 1:2, 1:1, 1:0.5 및 1:0.25 비율이 되도록 혼합한 다음, 루미네센스(CytoTox-Glo Cytotoxicity Assay, Promega, cat# G9291)를 측정하였다. 측정한 값으로 하기 수학식 1을 이용하여 세포 사멸 정도를 계산하였다:
[수학식 1]
%Cytotoxicity = [(Experimental - Effctor Spontaneous - Target Spontaneous) / (Target Maximum - Target Spontaneous)] X 100
[Experimental: 표적세포 및 T 세포 복합 배양의 배지로 부터 도출된 발광(Luminescence)값, Effctor Spontaneous: T 세포 배지로부터 도출된 발광값, Target Spontaneous: 표적세포 배지로부터 도출된 발광값, Target Maximum: 표적세포의 100% 용해(용해시약(Lysis Reagent) 이용)로부터 도출된 발광값].
그 결과, 도 6에 나타낸 바와 같이, BCMA-CAR-T 세포는 BCMA를 발현하는 H929 세포를 보다 특이적으로 사멸시키는 것을 확인하였다.
이는, 본 발명의 BCMA를 표적으로 하는 키메라 항원 수용체 및 CAR-T 세포가 B세포 또는 BCMA 발현과 관련된 질환 예방 또는 치료용 조성물로 유용하게 활용할 수 있음을 입증한다.
서열목록 전자파일 첨부
Claims (24)
- 서열번호 7 내지 9 중 어느 하나의 아미노산 서열로 표시되는 CDR1(complementary determining region 1); 서열번호 10 내지 12 중 어느 하나의 아미노산 서열로 표시되는 CDR2(complementary determining region 2); 및 서열번호 13 내지 15 중 어느 하나의 아미노산 서열로 표시되는 CDR3(complementary determining region 3);를 포함하며,
BCMA(B-cell maturation antigen)에 특이적으로 결합하는 단일 도메인 항체(single domain antibody, sdAb) 또는 이의 항원-결합 단편.
- 제1항에 있어서,
상기 단일 도메인 항체는,
(i) 서열번호 7의 아미노산 서열로 표시되는 CDR1, 서열번호 10의 아미노산 서열로 표시되는 CDR2 및 서열번호 13의 아미노산 서열로 표시되는 CDR3를 포함하는 중쇄 가변 도메인(VHH);
(ii) 서열번호 8의 아미노산 서열로 표시되는 CDR1, 서열번호 11의 아미노산 서열로 표시되는 CDR2 및 서열번호 14의 아미노산 서열로 표시되는 CDR3를 포함하는 중쇄 가변 도메인(VHH);또는
(iii) 서열번호 9의 아미노산 서열로 표시되는 CDR1, 서열번호 12의 아미노산 서열로 표시되는 CDR2 및 서열번호 15의 아미노산 서열로 표시되는 CDR3를 포함하는 중쇄 가변 도메인(VHH);을 포함하는 것을 특징으로 하는,
BCMA(B-cell maturation antigen)에 특이적으로 결합하는 단일 도메인 항체(single domain antibody, sdAb) 또는 이의 항원-결합 단편.
- 제2항에 있어서,
상기 (i) 중쇄 가변 도메인(VHH)은 서열번호 1로 표시되는 아미노산 서열로 이루어진 것을 특징으로 하는,
BCMA(B-cell maturation antigen)에 특이적으로 결합하는 단일 도메인 항체(single domain antibody, sdAb) 또는 이의 항원-결합 단편.
- 제3항에 있어서,
상기 (i) 중쇄 가변 도메인(VHH)은 서열번호 4로 표시되는 염기서열에 의해 코딩되는 것을 특징으로 하는,
BCMA(B-cell maturation antigen)에 특이적으로 결합하는 단일 도메인 항체(single domain antibody, sdAb) 또는 이의 항원-결합 단편.
- 제2항에 있어서,
상기 (ii)중쇄 가변 도메인(VHH)은 서열번호 2로 표시되는 아미노산 서열로 이루어진 것을 특징으로 하는,
BCMA(B-cell maturation antigen)에 특이적으로 결합하는 단일 도메인 항체(single domain antibody, sdAb) 또는 이의 항원-결합 단편.
- 제5항에 있어서,
상기 (ii) 중쇄 가변 도메인(VHH)은 서열번호 5로 표시되는 염기서열에 의해 코딩되는 것을 특징으로 하는,
BCMA(B-cell maturation antigen)에 특이적으로 결합하는 단일 도메인 항체(single domain antibody, sdAb) 또는 이의 항원-결합 단편.
- 제2항에 있어서,
상기 (iii) 중쇄 가변 도메인(VHH)은 서열번호 3으로 표시되는 아미노산 서열로 이루어진 것을 특징으로 하는,
BCMA(B-cell maturation antigen)에 특이적으로 결합하는 단일 도메인 항체(single domain antibody, sdAb) 또는 이의 항원-결합 단편.
- 제7항에 있어서,
상기 (iii) 중쇄 가변 도메인(VHH)은 서열번호 6으로 표시되는 염기서열에 의해 코딩되는 것을 특징으로 하는,
BCMA(B-cell maturation antigen)에 특이적으로 결합하는 단일 도메인 항체(single domain antibody, sdAb) 또는 이의 항원-결합 단편.
- BCMA-결합 도메인, 막관통 도메인(transmembrane domain), 공동자극 도메인(costimulatory domain) 및 세포 내 신호전달 도메인(intracellular signal transduction domain)을 포함하는 키메라 항원 수용체(chimeric antigen receptor: CAR)로서,
상기 BCMA-결합 도메인은 BCMA와 특이적으로 결합할 수 있는 단일 도메인 항체(single domain antibody, sdAb) 또는 이의 항원-결합 단편을 포함하며,
상기 단일 도메인 항체(single domain antibody, sdAb)는, 서열번호 7 내지 9 중 어느 하나의 아미노산 서열로 표시되는 CDR1(complementary determining region 1); 서열번호 10 내지 12 중 어느 하나의 아미노산 서열로 표시되는 CDR2(complementary determining region 2); 및 서열번호 13 내지 15 중 어느 하나의 아미노산 서열로 표시되는 CDR3(complementary determining region 3);를 포함하는 것을 특징으로 하는, 키메라 항원 수용체(chimeric antigen receptors, CAR).
- 제9항에 있어서,
상기 막관통 도메인은 CD8,FcγR, ICOS(CD278), 4-1BB(CD137), OX40(CD134), CD27, CD28, IL-2Rβ, CD40, DAP10, MHC class I 분자, TNF 수용체 단백질, Immunoglobulin-유사 단백질, 사이토카인 수용체, 인테그린, SLAM 단백질, 활성화 NK 세포 수용체, BTLA, Toll 리간드 수용체, CD2, CD7, CD30, CDS, ICAM-1, B7-H3, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8α, CD8β, ITGA4, VLA1, CD49a, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, CD19a, CD83 특이적 리간드, CD247, CD3δ, CD3ε, CD3γ, CD3ζ, Ig alpha(CD79a), IL-2Rγ, IL-7Rα, PD-1, TNFSF14, CD45, CD5, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD154, T 세포 수용체의 알파 쇄, T 세포 수용체의 베타 쇄 및 T 세포 수용체의 제타 쇄로 이루어진 군으로부터 선택된 1 종 이상인 것을 특징으로 하는,
키메라 항원 수용체(chimeric antigen receptors, CAR).
- 제9항에 있어서,
상기 공동자극 도메인은 CD27, CD28,CD8, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, 림프구 기능-연관 항원-1 (LFA-1), CD2, CD7, LIGHT,NKG2C, B7-H3 및 CD83로 이루어진 군으로부터 선택된 1종 이상인 것을 특징으로 하는,
키메라 항원 수용체(chimeric antigen receptors, CAR).
- 제9항에 있어서,
상기 세포 내 신호전달 도메인은 CD3ζ, FcγR, ICOS(CD278), 4-1BB(CD137), OX40(CD134), CD27, CD28, IL-2Rβ, IL-15R-α, MyD88, DAP10, DAP12, MHC class I 분자, TNF 수용체 단백질, Immunoglobulin-유사 단백질, 사이토카인 수용체, 인테그린, SLAM 단백질, 활성화 NK 세포 수용체, BTLA, Toll 리간드 수용체, CD2, CD7, CD30, CD40, CDS, ICAM-1, B7-H3, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8α, CD8β, IL2Rγ, IL7Rα, ITGA4, VLA1, CD49a, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, CD19a, CD83 특이적 리간드, CD247, CD3δ, CD3ε, CD3γ, CD8, Ig alpha(CD79a), IL-2Rγ, IL-7Rα, PD-1 및 TNFSF14로 이루어진 군으로부터 선택된 1종 이상인 것을 특징으로 하는,
키메라 항원 수용체(chimeric antigen receptors, CAR).
- 제9항에 있어서,
상기 BCMA-결합 도메인의 C 말단 및 막관통 도메인의 N 말단 사이에 힌지 부위(hinge region)가 추가로 포함되는 것을 특징으로 하는,
키메라 항원 수용체(chimeric antigen receptors, CAR).
- 제13항에 있어서,
상기 힌지는 CD8α 힌지, IgG1 힌지 및 FcγRIIIα 힌지로 이루어진 군으로부터 선택된 1 종 이상인 것을 특징으로 하는,
키메라 항원 수용체(chimeric antigen receptors, CAR).
- 제9항에 있어서,
상기 키메라 항원 수용체는 추가로 시그널(signal) 펩타이드에 연결되는 것을 특징으로 하는,
키메라 항원 수용체(chimeric antigen receptors, CAR).
- 제9항 내지 제15항 중 어느 한 항의 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드.
- 제9항 내지 제15항 중 어느 한 항의 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드를 포함하는 벡터.
- 제17항에 있어서,
상기 벡터는 플라스미드(plasmid), 레트로바이러스(retroviral) 벡터 및 렌티바이러스(lentiviral) 벡터로 이루어진 군으로부터 선택된 1 종 이상인 것을 특징으로 하는,
벡터.
- 제9항 내지 제15항 중 어느 한 항의 키메라 항원 수용체(CAR)를 표면에 발현하는, 단리된 면역 세포.
- 제19항에 있어서,
상기 단리된 면역 세포는, T 세포, NK 세포, NKT 세포, B 세포, 수지상 세포, 단핵구, 마크로파지, 호산구, 호염기구 및 호중구로 이루어진 군으로부터 선택된 1 종 이상인 것을 특징으로 하는,
단리된 면역 세포.
- 제9항 내지 제15항 중 어느 한 항의 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드; 또는 제9항 내지 제15항 중 어느 한 항의 키메라 항원 수용체(CAR)를 표면에 발현하는 단리된 면역 세포를 유효성분으로 포함하는, BCMA 발현과 관련된 질환 예방 또는 치료용 약학적 조성물.
- 제21항에 있어서,
상기 BCMA 발현과 관련된 질환은 다발성골수종(multiple myeloma), 혈액암, 비-호지킨 림프종(non-Hodgkin'symphoma), 자가항체-의존성 자가면역 질환(autoantibody-dependent autoimmune disease), 전신홍반루프스(systemic lupus erythematosus, SLE) 및 류마티스 관절염(rheumatoid arthritis)으로 이루어진 군으로부터 선택된 1 종 이상인 것을 특징으로 하는,
BCMA 발현과 관련된 질환 예방 또는 치료용 약학적 조성물.
- 제9항 내지 제15항 중 어느 한 항의 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드; 또는 제9항 내지 제15항 중 어느 한 항의 키메라 항원 수용체(CAR)를 표면에 발현하는 단리된 면역 세포를 유효성분으로 포함하는, BCMA 발현과 관련된 질환 예방 또는 개선용 식품 조성물.
- 제9항 내지 제15항 중 어느 한 항의 키메라 항원 수용체(CAR)를 코딩하는 폴리뉴클레오타이드 또는 이를 포함하는 벡터를, 단리된 면역 세포에 도입시키는 단계를 포함하는, 면역세포의 제조 방법.
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020220174221A KR20240094169A (ko) | 2022-12-13 | 2022-12-13 | B-세포 성숙 항원을 표적화하는 신규한 키메라 항원 수용체 및 이의 용도 |
| PCT/KR2022/020365 WO2024128345A1 (ko) | 2022-12-13 | 2022-12-14 | B-세포 성숙 항원을 표적화하는 신규한 키메라 항원 수용체 및 이의 용도 |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020220174221A KR20240094169A (ko) | 2022-12-13 | 2022-12-13 | B-세포 성숙 항원을 표적화하는 신규한 키메라 항원 수용체 및 이의 용도 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| KR20240094169A true KR20240094169A (ko) | 2024-06-25 |
Family
ID=91485925
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| KR1020220174221A KR20240094169A (ko) | 2022-12-13 | 2022-12-13 | B-세포 성숙 항원을 표적화하는 신규한 키메라 항원 수용체 및 이의 용도 |
Country Status (2)
| Country | Link |
|---|---|
| KR (1) | KR20240094169A (ko) |
| WO (1) | WO2024128345A1 (ko) |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2747457C2 (ru) * | 2014-07-24 | 2021-05-05 | Блубёрд Био, Инк. | Химерные антигенные рецепторы к bcma |
| PT3628687T (pt) * | 2014-12-12 | 2021-10-20 | Bluebird Bio Inc | Recetores do antigénio quimérico bcma |
| CN105384825B (zh) * | 2015-08-11 | 2018-06-01 | 南京传奇生物科技有限公司 | 一种基于单域抗体的双特异性嵌合抗原受体及其应用 |
| KR102626782B1 (ko) * | 2020-02-14 | 2024-01-19 | 주식회사 셀젠텍 | B세포 성숙화 항원을 표적으로 하는 키메라 항원 수용체 및 이의 용도 |
-
2022
- 2022-12-13 KR KR1020220174221A patent/KR20240094169A/ko unknown
- 2022-12-14 WO PCT/KR2022/020365 patent/WO2024128345A1/ko unknown
Also Published As
| Publication number | Publication date |
|---|---|
| WO2024128345A1 (ko) | 2024-06-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3674328B1 (en) | Chimeric antigen receptor (car) binding to bcma, and uses thereof | |
| AU2017250304B2 (en) | Compositions and methods for selective protein expression | |
| EP3564266A1 (en) | Novel chimeric antigen receptor and use thereof | |
| JP2023052446A (ja) | 融合タンパク質を用いてｔ細胞受容体をリプログラミングするための組成物及び方法 | |
| EP2884999B1 (en) | Method and compositions for cellular immunotherapy | |
| JP2021534762A (ja) | 抗メソテリンキメラ抗原受容体（ｃａｒ）構築物及びその使用 | |
| JP2022188163A (ja) | がん治療用に操作されたｔ細胞 | |
| EP3875484A1 (en) | Cll1-targeting antibody and application thereof | |
| US11439665B2 (en) | Combined chimeric antigen receptor targeting CD19 and CD20 and application thereof | |
| KR20230129983A (ko) | 조작된 세포 요법을 위한 표적화된 사이토카인 구축물 | |
| US20230346835A1 (en) | Chimeric antigen receptor targeting bcma and use thereof | |
| CN113039209A (zh) | 用于使用融合蛋白进行tcr重编程的组合物和方法 | |
| WO2022218402A1 (en) | Fusion proteins and uses thereof | |
| CN117024598A (zh) | 长效的Meso-B7H3双靶点嵌合抗原受体及其应用 | |
| WO2022047417A1 (en) | Anti-idiotype compositions and methods of use thereof | |
| CN116396389B (zh) | 一种靶向bcma的单域抗体、嵌合抗原受体及其应用 | |
| EP3964568A1 (en) | Immune cell containing tumor antigen recognition receptor and application thereof | |
| KR20240094169A (ko) | B-세포 성숙 항원을 표적화하는 신규한 키메라 항원 수용체 및 이의 용도 | |
| KR20230109138A (ko) | 키메라 수용체 및 이의 사용 방법 | |
| JP2023552724A (ja) | キメラ受容体及びその使用方法 | |
| JP2023540022A (ja) | チェックポイント阻害分子及び免疫刺激性サイトカインをコードするキメラ抗原受容体構築物、並びにＣＤ４４ｖ６を認識するＣＡＲ発現細胞 | |
| JP2023540023A (ja) | Ｃｅａを認識するキメラ抗原受容体（ｃａｒ）発現細胞 | |
| US20230151113A1 (en) | Gpc3 car- t cells secreting il-18 and methods of making and using the same | |
| WO2023185256A1 (zh) | 特异性结合cd7的抗体及其在制备嵌合抗原受体中的应用 | |
| KR20230143108A (ko) | Cd30 유래의 세포내 신호전달 도메인을 포함하는 키메라 항원 수용체, 이를 발현하는 면역세포 및 이들의 용도 |