KR20230166288A - 화분증 진단용 조성물 - Google Patents
화분증 진단용 조성물 Download PDFInfo
- Publication number
- KR20230166288A KR20230166288A KR1020220066054A KR20220066054A KR20230166288A KR 20230166288 A KR20230166288 A KR 20230166288A KR 1020220066054 A KR1020220066054 A KR 1020220066054A KR 20220066054 A KR20220066054 A KR 20220066054A KR 20230166288 A KR20230166288 A KR 20230166288A
- Authority
- KR
- South Korea
- Prior art keywords
- hay fever
- pmei
- pollen
- seq
- ige
- Prior art date
Links
- 208000035285 Allergic Seasonal Rhinitis Diseases 0.000 title claims abstract description 29
- 239000000203 mixture Substances 0.000 title claims description 19
- 238000003745 diagnosis Methods 0.000 title abstract description 6
- 206010048908 Seasonal allergy Diseases 0.000 title description 2
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 29
- 229920001184 polypeptide Polymers 0.000 claims abstract description 27
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 27
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 19
- 239000000427 antigen Substances 0.000 claims abstract description 10
- 102000036639 antigens Human genes 0.000 claims abstract description 10
- 108091007433 antigens Proteins 0.000 claims abstract description 10
- 235000008434 ginseng Nutrition 0.000 claims description 17
- 238000000034 method Methods 0.000 claims description 15
- 235000005035 Panax pseudoginseng ssp. pseudoginseng Nutrition 0.000 claims description 13
- 235000003140 Panax quinquefolius Nutrition 0.000 claims description 13
- 239000012472 biological sample Substances 0.000 claims description 7
- 239000008194 pharmaceutical composition Substances 0.000 claims description 7
- 230000000172 allergic effect Effects 0.000 claims description 4
- 208000010668 atopic eczema Diseases 0.000 claims description 4
- 241000208340 Araliaceae Species 0.000 claims 2
- 230000002265 prevention Effects 0.000 abstract description 2
- 108020004410 pectinesterase Proteins 0.000 description 54
- 102000004169 proteins and genes Human genes 0.000 description 26
- 108090000623 proteins and genes Proteins 0.000 description 26
- 239000013566 allergen Substances 0.000 description 25
- 240000004371 Panax ginseng Species 0.000 description 20
- 208000026935 allergic disease Diseases 0.000 description 16
- 206010020751 Hypersensitivity Diseases 0.000 description 14
- 230000009257 reactivity Effects 0.000 description 13
- 230000007815 allergy Effects 0.000 description 12
- 238000006243 chemical reaction Methods 0.000 description 11
- 102000004190 Enzymes Human genes 0.000 description 10
- 108090000790 Enzymes Proteins 0.000 description 10
- 229940088598 enzyme Drugs 0.000 description 10
- 238000009169 immunotherapy Methods 0.000 description 10
- 238000002965 ELISA Methods 0.000 description 9
- 238000004458 analytical method Methods 0.000 description 9
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 8
- 210000002966 serum Anatomy 0.000 description 8
- 239000000758 substrate Substances 0.000 description 8
- 241000894006 Bacteria Species 0.000 description 6
- 241000588724 Escherichia coli Species 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 6
- 241000218229 Humulus japonicus Species 0.000 description 6
- 244000131316 Panax pseudoginseng Species 0.000 description 6
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 6
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 229960004784 allergens Drugs 0.000 description 6
- 150000001413 amino acids Chemical class 0.000 description 6
- 108091033319 polynucleotide Proteins 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 239000002157 polynucleotide Substances 0.000 description 6
- 235000010469 Glycine max Nutrition 0.000 description 5
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 5
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 5
- 241000235648 Pichia Species 0.000 description 5
- 239000000284 extract Substances 0.000 description 5
- 238000003018 immunoassay Methods 0.000 description 5
- 238000003119 immunoblot Methods 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 230000004481 post-translational protein modification Effects 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 239000013598 vector Substances 0.000 description 5
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 4
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 4
- 102000003886 Glycoproteins Human genes 0.000 description 4
- 108090000288 Glycoproteins Proteins 0.000 description 4
- 241000282414 Homo sapiens Species 0.000 description 4
- 239000002033 PVDF binder Substances 0.000 description 4
- 235000002789 Panax ginseng Nutrition 0.000 description 4
- 102000001708 Protein Isoforms Human genes 0.000 description 4
- 108010029485 Protein Isoforms Proteins 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- -1 glycerol and ethanol Chemical class 0.000 description 4
- 230000013595 glycosylation Effects 0.000 description 4
- 238000006206 glycosylation reaction Methods 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 238000009629 microbiological culture Methods 0.000 description 4
- 239000013642 negative control Substances 0.000 description 4
- 229910052757 nitrogen Inorganic materials 0.000 description 4
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- 238000010186 staining Methods 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 238000004885 tandem mass spectrometry Methods 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 244000068988 Glycine max Species 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 241000532841 Platanus orientalis Species 0.000 description 3
- 241001231452 Platanus x hispanica Species 0.000 description 3
- 101710162629 Trypsin inhibitor Proteins 0.000 description 3
- 229940122618 Trypsin inhibitor Drugs 0.000 description 3
- 229910052799 carbon Inorganic materials 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 230000026731 phosphorylation Effects 0.000 description 3
- 238000006366 phosphorylation reaction Methods 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 239000002753 trypsin inhibitor Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- PKYCWFICOKSIHZ-UHFFFAOYSA-N 1-(3,7-dihydroxyphenoxazin-10-yl)ethanone Chemical compound OC1=CC=C2N(C(=O)C)C3=CC=C(O)C=C3OC2=C1 PKYCWFICOKSIHZ-UHFFFAOYSA-N 0.000 description 2
- 241000208140 Acer Species 0.000 description 2
- 235000009051 Ambrosia paniculata var. peruviana Nutrition 0.000 description 2
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 2
- 235000003261 Artemisia vulgaris Nutrition 0.000 description 2
- 240000006891 Artemisia vulgaris Species 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 108010015742 Cytochrome P-450 Enzyme System Proteins 0.000 description 2
- 102000003849 Cytochrome P450 Human genes 0.000 description 2
- 229940122601 Esterase inhibitor Drugs 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 244000025221 Humulus lupulus Species 0.000 description 2
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 241000219492 Quercus Species 0.000 description 2
- 244000082988 Secale cereale Species 0.000 description 2
- 235000007238 Secale cereale Nutrition 0.000 description 2
- 241000282898 Sus scrofa Species 0.000 description 2
- 235000021307 Triticum Nutrition 0.000 description 2
- 244000098338 Triticum aestivum Species 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 108010051210 beta-Fructofuranosidase Proteins 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 102000005936 beta-Galactosidase Human genes 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- YCIMNLLNPGFGHC-UHFFFAOYSA-N catechol Chemical compound OC1=CC=CC=C1O YCIMNLLNPGFGHC-UHFFFAOYSA-N 0.000 description 2
- 210000004027 cell Anatomy 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 235000010980 cellulose Nutrition 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 238000000354 decomposition reaction Methods 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 231100000676 disease causative agent Toxicity 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 210000000981 epithelium Anatomy 0.000 description 2
- 239000002329 esterase inhibitor Substances 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 2
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 2
- 230000009610 hypersensitivity Effects 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 238000010253 intravenous injection Methods 0.000 description 2
- 239000001573 invertase Substances 0.000 description 2
- 235000011073 invertase Nutrition 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- KNJDBYZZKAZQNG-UHFFFAOYSA-N lucigenin Chemical compound [O-][N+]([O-])=O.[O-][N+]([O-])=O.C12=CC=CC=C2[N+](C)=C(C=CC=C2)C2=C1C1=C(C=CC=C2)C2=[N+](C)C2=CC=CC=C12 KNJDBYZZKAZQNG-UHFFFAOYSA-N 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- JPXMTWWFLBLUCD-UHFFFAOYSA-N nitro blue tetrazolium(2+) Chemical compound COC1=CC(C=2C=C(OC)C(=CC=2)[N+]=2N(N=C(N=2)C=2C=CC=CC=2)C=2C=CC(=CC=2)[N+]([O-])=O)=CC=C1[N+]1=NC(C=2C=CC=CC=2)=NN1C1=CC=C([N+]([O-])=O)C=C1 JPXMTWWFLBLUCD-UHFFFAOYSA-N 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 238000011222 transcriptome analysis Methods 0.000 description 2
- QRXMUCSWCMTJGU-UHFFFAOYSA-L (5-bromo-4-chloro-1h-indol-3-yl) phosphate Chemical compound C1=C(Br)C(Cl)=C2C(OP([O-])(=O)[O-])=CNC2=C1 QRXMUCSWCMTJGU-UHFFFAOYSA-L 0.000 description 1
- GEYOCULIXLDCMW-UHFFFAOYSA-N 1,2-phenylenediamine Chemical compound NC1=CC=CC=C1N GEYOCULIXLDCMW-UHFFFAOYSA-N 0.000 description 1
- KJCVRFUGPWSIIH-UHFFFAOYSA-N 1-naphthol Chemical compound C1=CC=C2C(O)=CC=CC2=C1 KJCVRFUGPWSIIH-UHFFFAOYSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- PAWQVTBBRAZDMG-UHFFFAOYSA-N 2-(3-bromo-2-fluorophenyl)acetic acid Chemical compound OC(=O)CC1=CC=CC(Br)=C1F PAWQVTBBRAZDMG-UHFFFAOYSA-N 0.000 description 1
- HWTAKVLMACWHLD-UHFFFAOYSA-N 2-(9h-carbazol-1-yl)ethanamine Chemical compound C12=CC=CC=C2NC2=C1C=CC=C2CCN HWTAKVLMACWHLD-UHFFFAOYSA-N 0.000 description 1
- WONRDHPFOHAWOG-UHFFFAOYSA-N 2-chloronaphthalen-1-ol Chemical compound C1=CC=C2C(O)=C(Cl)C=CC2=C1 WONRDHPFOHAWOG-UHFFFAOYSA-N 0.000 description 1
- IITIZHOBOIBGBW-UHFFFAOYSA-N 3-ethyl-2h-1,3-benzothiazole Chemical compound C1=CC=C2N(CC)CSC2=C1 IITIZHOBOIBGBW-UHFFFAOYSA-N 0.000 description 1
- VMXLZAVIEYWCLQ-UHFFFAOYSA-N 4-(4-aminophenyl)-3-methylaniline Chemical compound CC1=CC(N)=CC=C1C1=CC=C(N)C=C1 VMXLZAVIEYWCLQ-UHFFFAOYSA-N 0.000 description 1
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 1
- YRNWIFYIFSBPAU-UHFFFAOYSA-N 4-[4-(dimethylamino)phenyl]-n,n-dimethylaniline Chemical compound C1=CC(N(C)C)=CC=C1C1=CC=C(N(C)C)C=C1 YRNWIFYIFSBPAU-UHFFFAOYSA-N 0.000 description 1
- QRXMUCSWCMTJGU-UHFFFAOYSA-N 5-bromo-4-chloro-3-indolyl phosphate Chemical compound C1=C(Br)C(Cl)=C2C(OP(O)(=O)O)=CNC2=C1 QRXMUCSWCMTJGU-UHFFFAOYSA-N 0.000 description 1
- 235000006760 Acer pensylvanicum Nutrition 0.000 description 1
- 240000002245 Acer pensylvanicum Species 0.000 description 1
- 244000291564 Allium cepa Species 0.000 description 1
- 235000002732 Allium cepa var. cepa Nutrition 0.000 description 1
- 240000002234 Allium sativum Species 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000223600 Alternaria Species 0.000 description 1
- 235000013479 Amaranthus retroflexus Nutrition 0.000 description 1
- 235000004135 Amaranthus viridis Nutrition 0.000 description 1
- 244000036975 Ambrosia artemisiifolia Species 0.000 description 1
- 235000003129 Ambrosia artemisiifolia var elatior Nutrition 0.000 description 1
- ATRRKUHOCOJYRX-UHFFFAOYSA-N Ammonium bicarbonate Chemical compound [NH4+].OC([O-])=O ATRRKUHOCOJYRX-UHFFFAOYSA-N 0.000 description 1
- 239000004254 Ammonium phosphate Substances 0.000 description 1
- 206010002198 Anaphylactic reaction Diseases 0.000 description 1
- 240000004178 Anthoxanthum odoratum Species 0.000 description 1
- 235000017060 Arachis glabrata Nutrition 0.000 description 1
- 235000010777 Arachis hypogaea Nutrition 0.000 description 1
- 244000105624 Arachis hypogaea Species 0.000 description 1
- 235000018262 Arachis monticola Nutrition 0.000 description 1
- 235000003097 Artemisia absinthium Nutrition 0.000 description 1
- 235000017731 Artemisia dracunculus ssp. dracunculus Nutrition 0.000 description 1
- 241001225321 Aspergillus fumigatus Species 0.000 description 1
- 235000018185 Betula X alpestris Nutrition 0.000 description 1
- 235000018212 Betula X uliginosa Nutrition 0.000 description 1
- 241000219495 Betulaceae Species 0.000 description 1
- 241000238657 Blattella germanica Species 0.000 description 1
- 240000004183 Bongardia chrysogonum Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 235000009344 Chenopodium album Nutrition 0.000 description 1
- 240000000005 Chenopodium berlandieri Species 0.000 description 1
- 235000005484 Chenopodium berlandieri Nutrition 0.000 description 1
- 235000009332 Chenopodium rubrum Nutrition 0.000 description 1
- 235000007516 Chrysanthemum Nutrition 0.000 description 1
- 240000005250 Chrysanthemum indicum Species 0.000 description 1
- 241001149956 Cladosporium herbarum Species 0.000 description 1
- 206010010744 Conjunctivitis allergic Diseases 0.000 description 1
- 235000001543 Corylus americana Nutrition 0.000 description 1
- 235000007466 Corylus avellana Nutrition 0.000 description 1
- 240000007582 Corylus avellana Species 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 244000052363 Cynodon dactylon Species 0.000 description 1
- 102100028717 Cytosolic 5'-nucleotidase 3A Human genes 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 235000018783 Dacrycarpus dacrydioides Nutrition 0.000 description 1
- 240000004585 Dactylis glomerata Species 0.000 description 1
- 206010012438 Dermatitis atopic Diseases 0.000 description 1
- 241000238713 Dermatophagoides farinae Species 0.000 description 1
- 241000238740 Dermatophagoides pteronyssinus Species 0.000 description 1
- 206010065563 Eosinophilic bronchitis Diseases 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 206010051841 Exposure to allergen Diseases 0.000 description 1
- 240000008620 Fagopyrum esculentum Species 0.000 description 1
- 235000009419 Fagopyrum esculentum Nutrition 0.000 description 1
- 235000010099 Fagus sylvatica Nutrition 0.000 description 1
- 240000000731 Fagus sylvatica Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 241001536352 Fraxinus americana Species 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 235000007340 Hordeum vulgare Nutrition 0.000 description 1
- 240000005979 Hordeum vulgare Species 0.000 description 1
- 235000006878 Humulus lupulus var neomexicanus Nutrition 0.000 description 1
- 102000028554 IgE binding proteins Human genes 0.000 description 1
- 108091009324 IgE binding proteins Proteins 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 235000009496 Juglans regia Nutrition 0.000 description 1
- 240000007049 Juglans regia Species 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- 241001506991 Komagataella phaffii GS115 Species 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 241000270322 Lepidosauria Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- OYHQOLUKZRVURQ-HZJYTTRNSA-N Linoleic acid Chemical compound CCCCC\C=C/C\C=C/CCCCCCCC(O)=O OYHQOLUKZRVURQ-HZJYTTRNSA-N 0.000 description 1
- 241000209082 Lolium Species 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 241000219745 Lupinus Species 0.000 description 1
- 235000007688 Lycopersicon esculentum Nutrition 0.000 description 1
- 239000005913 Maltodextrin Substances 0.000 description 1
- 229920002774 Maltodextrin Polymers 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 235000008708 Morus alba Nutrition 0.000 description 1
- 240000000249 Morus alba Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 235000003805 Musa ABB Group Nutrition 0.000 description 1
- 240000005561 Musa balbisiana Species 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 101710190786 PI protein Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 235000021314 Palmitic acid Nutrition 0.000 description 1
- 241000228150 Penicillium chrysogenum Species 0.000 description 1
- 239000001888 Peptone Substances 0.000 description 1
- 108010080698 Peptones Proteins 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 244000062780 Petroselinum sativum Species 0.000 description 1
- 241000746983 Phleum pratense Species 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 235000014676 Phragmites communis Nutrition 0.000 description 1
- 244000273256 Phragmites communis Species 0.000 description 1
- 240000007263 Pinus koraiensis Species 0.000 description 1
- 235000008578 Pinus strobus Nutrition 0.000 description 1
- 235000015266 Plantago major Nutrition 0.000 description 1
- 241000209466 Platanus Species 0.000 description 1
- 235000006485 Platanus occidentalis Nutrition 0.000 description 1
- 244000268528 Platanus occidentalis Species 0.000 description 1
- 241000209049 Poa pratensis Species 0.000 description 1
- 108010059820 Polygalacturonase Proteins 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- 102000011195 Profilin Human genes 0.000 description 1
- 108050001408 Profilin Proteins 0.000 description 1
- 240000005809 Prunus persica Species 0.000 description 1
- 235000006040 Prunus persica var persica Nutrition 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 206010039085 Rhinitis allergic Diseases 0.000 description 1
- 241000124033 Salix Species 0.000 description 1
- 244000124765 Salsola kali Species 0.000 description 1
- 235000007658 Salsola kali Nutrition 0.000 description 1
- 206010070834 Sensitisation Diseases 0.000 description 1
- 229920005654 Sephadex Polymers 0.000 description 1
- 239000012507 Sephadex™ Substances 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 240000003768 Solanum lycopersicum Species 0.000 description 1
- 235000000914 Solidago virgaurea Nutrition 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 235000019486 Sunflower oil Nutrition 0.000 description 1
- 240000001949 Taraxacum officinale Species 0.000 description 1
- 235000005187 Taraxacum officinale ssp. officinale Nutrition 0.000 description 1
- 241000611866 Tyrophagus putrescentiae Species 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- SXEHKFHPFVVDIR-UHFFFAOYSA-N [4-(4-hydrazinylphenyl)phenyl]hydrazine Chemical compound C1=CC(NN)=CC=C1C1=CC=C(NN)C=C1 SXEHKFHPFVVDIR-UHFFFAOYSA-N 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 229940074608 allergen extract Drugs 0.000 description 1
- 230000002009 allergenic effect Effects 0.000 description 1
- 201000009961 allergic asthma Diseases 0.000 description 1
- 208000002205 allergic conjunctivitis Diseases 0.000 description 1
- 208000028004 allergic respiratory disease Diseases 0.000 description 1
- 201000010105 allergic rhinitis Diseases 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 239000001099 ammonium carbonate Substances 0.000 description 1
- 235000012501 ammonium carbonate Nutrition 0.000 description 1
- 235000019270 ammonium chloride Nutrition 0.000 description 1
- 229910000148 ammonium phosphate Inorganic materials 0.000 description 1
- 235000019289 ammonium phosphates Nutrition 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 230000036783 anaphylactic response Effects 0.000 description 1
- 208000003455 anaphylaxis Diseases 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 235000003484 annual ragweed Nutrition 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- 239000001138 artemisia absinthium Substances 0.000 description 1
- 229940091771 aspergillus fumigatus Drugs 0.000 description 1
- 208000006673 asthma Diseases 0.000 description 1
- 208000024998 atopic conjunctivitis Diseases 0.000 description 1
- 201000008937 atopic dermatitis Diseases 0.000 description 1
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 1
- 239000000022 bacteriostatic agent Substances 0.000 description 1
- 210000003651 basophil Anatomy 0.000 description 1
- 235000013405 beer Nutrition 0.000 description 1
- IYXMNTLBLQNMLM-UHFFFAOYSA-N benzene-1,4-diamine;hydron;dichloride Chemical compound Cl.Cl.NC1=CC=C(N)C=C1 IYXMNTLBLQNMLM-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 238000010364 biochemical engineering Methods 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- XJMXIWNOKIEIMX-UHFFFAOYSA-N bromo chloro 1h-indol-2-yl phosphate Chemical compound C1=CC=C2NC(OP(=O)(OBr)OCl)=CC2=C1 XJMXIWNOKIEIMX-UHFFFAOYSA-N 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 229940095731 candida albicans Drugs 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 235000013877 carbamide Nutrition 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 239000003240 coconut oil Substances 0.000 description 1
- 235000019864 coconut oil Nutrition 0.000 description 1
- 235000003488 common ragweed Nutrition 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 238000012136 culture method Methods 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 238000000586 desensitisation Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 1
- MNNHAPBLZZVQHP-UHFFFAOYSA-N diammonium hydrogen phosphate Chemical compound [NH4+].[NH4+].OP([O-])([O-])=O MNNHAPBLZZVQHP-UHFFFAOYSA-N 0.000 description 1
- MHDVGSVTJDSBDK-UHFFFAOYSA-N dibenzyl ether Chemical compound C=1C=CC=CC=1COCC1=CC=CC=C1 MHDVGSVTJDSBDK-UHFFFAOYSA-N 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 239000003925 fat Substances 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 235000004611 garlic Nutrition 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000001641 gel filtration chromatography Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000003862 health status Effects 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 238000003125 immunofluorescent labeling Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 210000003000 inclusion body Anatomy 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 108091006086 inhibitor proteins Proteins 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 229910000358 iron sulfate Inorganic materials 0.000 description 1
- BAUYGSIQEAFULO-UHFFFAOYSA-L iron(2+) sulfate (anhydrous) Chemical compound [Fe+2].[O-]S([O-])(=O)=O BAUYGSIQEAFULO-UHFFFAOYSA-L 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 235000020778 linoleic acid Nutrition 0.000 description 1
- OYHQOLUKZRVURQ-IXWMQOLASA-N linoleic acid Natural products CCCCC\C=C/C\C=C\CCCCCCCC(O)=O OYHQOLUKZRVURQ-IXWMQOLASA-N 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 238000001972 liquid chromatography-electrospray ionisation mass spectrometry Methods 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 1
- 235000019341 magnesium sulphate Nutrition 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 238000009115 maintenance therapy Methods 0.000 description 1
- 229940035034 maltodextrin Drugs 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 235000019796 monopotassium phosphate Nutrition 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 125000001477 organic nitrogen group Chemical group 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 235000020232 peanut Nutrition 0.000 description 1
- 239000001814 pectin Substances 0.000 description 1
- 235000010987 pectin Nutrition 0.000 description 1
- 229920001277 pectin Polymers 0.000 description 1
- 235000019319 peptone Nutrition 0.000 description 1
- 235000011197 perejil Nutrition 0.000 description 1
- 235000020030 perry Nutrition 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- PJNZPQUBCPKICU-UHFFFAOYSA-N phosphoric acid;potassium Chemical compound [K].OP(O)(O)=O PJNZPQUBCPKICU-UHFFFAOYSA-N 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 210000002381 plasma Anatomy 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 238000011176 pooling Methods 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000001915 proofreading effect Effects 0.000 description 1
- INCIMLINXXICKS-UHFFFAOYSA-M pyronin Y Chemical compound [Cl-].C1=CC(=[N+](C)C)C=C2OC3=CC(N(C)C)=CC=C3C=C21 INCIMLINXXICKS-UHFFFAOYSA-M 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000012857 radioactive material Substances 0.000 description 1
- 238000003156 radioimmunoprecipitation Methods 0.000 description 1
- 201000004335 respiratory allergy Diseases 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000008313 sensitization Effects 0.000 description 1
- 230000001235 sensitizing effect Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 238000010181 skin prick test Methods 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 238000012437 strong cation exchange chromatography Methods 0.000 description 1
- 238000002305 strong-anion-exchange chromatography Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N succinic acid Chemical compound OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000002600 sunflower oil Substances 0.000 description 1
- 235000020238 sunflower seed Nutrition 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 235000011595 sweet vernalgrass Nutrition 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 239000011573 trace mineral Substances 0.000 description 1
- 235000013619 trace mineral Nutrition 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 229940046536 tree pollen allergenic extract Drugs 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 235000020234 walnut Nutrition 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/35—Allergens
- A61K39/36—Allergens from pollen
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/564—Immunoassay; Biospecific binding assay; Materials therefor for pre-existing immune complex or autoimmune disease, i.e. systemic lupus erythematosus, rheumatoid arthritis, multiple sclerosis, rheumatoid factors or complement components C1-C9
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/415—Assays involving biological materials from specific organisms or of a specific nature from plants
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/24—Immunology or allergic disorders
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- General Chemical & Material Sciences (AREA)
- Rheumatology (AREA)
- Mycology (AREA)
- Pulmonology (AREA)
- Gastroenterology & Hepatology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Botany (AREA)
- Rehabilitation Therapy (AREA)
- Epidemiology (AREA)
- Biophysics (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- Genetics & Genomics (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 발명의 서열번호 1로 표시되는 아미노산 서열을 포함하는 폴리펩타이드는 화분증 항원으로 화분증의 진단, 예방 또는 치료 용도로 유용하게 사용될 수 있다.
Description
본 발명은 환삼덩굴 꽃가루에서 발굴한 신규 항원 및 이를 포함하는 화분증 진단, 예방 또는 치료용 조성물에 관한 것이다.
환삼덩굴(Japanese hop)은 동아시아에서 가을 화분증(pollinosis)의 빈번한 원인이다. 국내에서는 꽃가루 농도(pollen count)와 피부 검사 양성 반응이 지속적으로 증가하고 있다 (Park et al., 2016). 흥미롭게도 환삼덩굴은 밀접하게 관련 있는 종인 맥주제조에 사용하는 일반 홉(common hop)과 실질적인 교차 반응성을 나타내지 않았다 (Jeong et al., 2018). 기존 알레르겐 유사성이 있는 단백질인 PR-1(pathogenesis-related 1), 펙틴 메틸에스테레이스(pectin methylesterase) 및 폴리갈락투로네이스(polygalacturonase)는 낮은 알레르기 항원성을 나타냈다 (Jang et al., 2021). 잘 알려진 식물 범알레르겐(panallergen)인 프로필린은 화분증 환자의 혈청 IgE 항체의 12.9%에서 인식되었다 (Jeong et al., 2013).
알레르겐 분자의 식별 및 특성화는 알레르겐 추출물의 품질을 표준화하고 개선하는 데 중요하다 (Becker & Reese. 2001). 알레르겐 특성을 규명하는 큰 발전은 분자 생물학적 기술로 이루어졌으며 추출물을 재조합 분자로 대체하기 위한 많은 노력이 이루어지고 있다 (Valenta et al., 2016; Valenta et al., 2018). 그러나 환삼덩굴 꽃가루의 주요 알레르겐에 대한 분자 복제 및 알레르겐 특성 규명은 아직 이루어지지 않았다.
상기와 같은 상황에서 본 발명자들은 환삼덩굴 꽃가루를 분석하여 신규 알레르겐으로 펙틴 메틸에스터레이스 저해제(pectin methylesterase inhibitor)를 발굴하였다.
따라서, 본 발명의 목적은 환삼덩굴 꽃가루에서 발굴한 신규 항원 및 이를 포함하는 화분증 진단, 예방 또는 치료용 조성물을 제공하는 것이다.
상기 목적을 달성하기 위하여 본 발명의 일 양상은 서열번호 1로 표시되는 아미노산 서열을 포함하는 폴리펩타이드를 포함하는 화분증 항원 조성물을 제공한다.
상기 "폴리펩타이드"는 "펩타이드" 및 "단백질"이라는 용어와 호환적으로 사용되며 아미노산 잔기의 중합체를 포함한다. 상기 용어들은 천연 아미노산이 중합된 폴리펩타이드뿐만 아니라, 천연 아미노산의 인공적인 화학적 유사체가 중합된 중합체에도 적용된다.
본 발명의 일 구체예에 따르면, 상기 폴리펩타이드는 환삼덩굴의 꽃가루로부터 유래된다. 본 발명자들은 화분증의 주요 원인인 환삼덩굴 꽃가루를 분석하여 펙틴 메틸에스터레이스 저해제(PMEI)가 주요 알레르겐임을 확인하였다.
펙틴 메틸에스테라아제(PME)는 식물 세포벽의 주요 성분인 펙틴의 탈중합 (depolymerization)에 관여하는 중요한 식물 효소이다. PME의 N-말단 프로 펩타이드 (pro-peptide)와 상동인 PMEI는 PME의 조절에 중요하다 (Giovane et al., 2004; Jolie et al., 2010).
본 발명의 일 구체예에 따르면, 환삼덩굴의 PMEI는 서열번호 1의 서열을 포함한다. 환삼덩굴의 PMEI는 서열번호 2의 서열로 발현되나, 발현 후 N-말단에서 25개의 아미노산 서열이 제거되어 서열번호 1의 서열로 성숙된다. 따라서, 상기 서열번호 1로 표시되는 아미노산 서열을 포함하는 폴리펩타이드는 서열번호 1 또는 서열번호 2로 표시되는 아미노산 서열일 수 있다.
[서열번호 1]
DLISSTCSKALYKDLCEKTLRADSSSSGAKVDGLAKIALKAASSSAKSIQGQITTLLKTGKDKAVVAALKDCSENYSGANEQLGDSLKAMVAKRYSDVNTWVTAAMTDGDSCEDGFKSGTSPLTKANTNFSQLCSNVLAITNQLS
[서열번호 2]
MNPISIFCLVSLLSLGLNQIPQVHGDLISSTCSKALYKDLCEKTLRADSSSSGAKVDGLAKIALKAASSSAKSIQGQITTLLKTGKDKAVVAALKDCSENYSGANEQLGDSLKAMVAKRYSDVNTWVTAAMTDGDSCEDGFKSGTSPLTKANTNFSQLCSNVLAITNQLS
상기 "알레르겐(allergen)"은 알레르기를 유발하는 항원, 또는 알레르기성 질환의 원인이 되는 항원을 의미하는 것일 수 있다. 알레르겐 물질을 포함하는 어떠한 종류의 물질의 섭취 또는 접촉으로 인하여 생체 내에서 항체가 만들어지면, 같은 물질의 재섭취 또는 재접촉이 일어날 경우에 항원-항체 반응이 일어날 수 있다.
본 발명의 다른 양상은 서열번호 1의 폴리펩타이드를 포함하는 화분증 진단용 조성물을 제공한다.
상기 폴리펩타이드에 대하여는 전술한 바와 같다. 상기 화분증은 환삼덩굴 꽃가루에 대한 것일 수 있다.
상기 조성물에 있어서, 상기 서열번호 1의 폴리펩타이드는 동물세포, 박테리아를 이용하여 재조합적으로 제조될 수 있으며, N-말단 및/또는 C-말단에 추가적인 아미노산 서열을 포함하는 것일 수 있다.
재조합적으로 생산된 서열번호 1의 폴리펩타이드는 본 발명이 속하는 기술 분야에서 통상적으로 적용되는 정제 방법으로 분리될 수 있다.
상기 박테리아는 에스케리키아(Escherichia) 속 미생물인 것일 수 있으며, 대장균(E. coli) 또는 Pichia일 수 있다.
상기 폴리뉴클레오티드를 박테리아에 도입하는 것은 발현 카세트 (expression cassette) 형태로의 도입, 또는 상기 폴리뉴클레오티드 자체의 도입인 것일 수 있다. 상기 발현 카세트는 상기 폴리뉴클레오티드가 자체적으로 발현되는데 필요한 모든 요소를 포함하는 것일 수 있다. 상기 발현 카세트는 상기 폴리뉴클레오티드에, 작동 가능하게 연결된 프로모터, 전사 종결 신호, 리보좀 결합 부위 및 번역 종결신호 등을 포함하는 것일 수 있다. 상기 발현 카세트는 자체 복제가 가능한 발현 벡터의 형태인 것일 수 있다. 상기 벡터는 당업계에 공지된 발현 벡터를 이용할 수 있다. 상기 폴리뉴클레오티드 자체의 도입은 도입된 숙주 세포에서 발현에 필요한 서열과 작동 가능하게 연결되어 있는 것일 수 있다. 상기 폴리뉴클레오티드가 도입된 박테리아는 형질도입된 박테리아인 것일 수 있다.
상기 재조합 단백질을 생산하기 위한 박테리아의 배양은 당업계에 알려진 적당한 배지와 배양 조건에 따라 이루어질 수 있다. 이러한 배양 과정은 통상의 기술자라면 선택되는 미생물에 따라 용이하게 조정하여 사용할 수 있다. 배양 방법은 회분식, 연속식 및 유가식 배양을 포함하는 것일 수 있으나, 이에 한정되지 않는다. 미생물의 다양한 배양 방법이 예를 들면 Biochemical Engineering, James M. Lee, Prentice-Hall International Editions에 개시되어 있다.
상기 배지는 다양한 탄소원, 질소원 및 미량원소 성분을 포함한다. 미생물 배양용 배지에 이용 가능한 탄소원은, 포도당, 자당, 유당, 과당, 말토오스, 전분, 셀룰로오스와 같은 탄수화물, 대두유, 해바라기유, 피마자유, 코코넛유와 같은 지방, 팔미트산, 스테아린산, 리놀레산과 같은 지방산, 글리세롤 및 에탄올과 같은 알코올, 아세트산과 같은 유기산을 포함하는 것일 수 있으나, 이에 한정되지 않는다. 탄소원은 단독으로 또는 조합되어 사용될 수 있다. 미생물 배양용 배지에 이용 가능한 질소원은 펩톤, 효모 추출물, 육즙, 맥아 추출물, 옥수수 침지액, 및 대두밀과 같은 유기 질소원 및 요소, 황산암모늄, 염화암모늄, 인산암모늄, 탄산암모늄 및 질산암모늄과 같은 무기 질소원을 포함하는 것일 수 있으나, 이에 한정되지 않는다. 질소원은 단독으로 또는 조합되어 사용될 수 있다. 미생물 배양용 배지는 인의 공급원으로서 인산이수소칼륨, 인산수소이칼륨 및 상응하는 소듐-함유 염을 포함하는 것일 수 있다. 또한, 황산마그네슘 또는 황산철과 같은 금속염을 포함하는 것일 수 있다. 이외에, 아미노산, 비타민, 및 적절한 전구체 등이 배지에 포함될 수 있다. 미생물 배양용 배지 또는 개별 성분은 배양액에 회분식 또는 연속식으로 첨가될 수 있다.
상기 조성물에 있어서, 상기 폴리펩타이드는 환삼덩굴의 꽃가루에 대한 알레르기(화분증)를 유발하는 원인인 알레르겐이므로, 개체로부터 분리된 생물학적 시료에서, IgE 항체와 상기 단백질 사이의 항원-항체 반응을 확인함으로써 환삼덩굴 화분증에 대한 알레르기를 진단할 수 있다.
상기 "진단(diagnosis)"은 병리 상태의 존재 또는 특징을 확인하는 것을 의미한다. 따라서, 상기 환삼덩굴 화분증 진단이란, 환삼덩굴의 꽃가루에 대한 알레르기를 가지는지 여부 또는 환삼덩굴의 꽃가루에 대한 알레르기를 가질 가능성을 확인하거나 그를 예측하는 것을 의미하는 것일 수 있다.
상기 "항체(antibody)"란 당해 분야에서 공지된 용어로서 항원성 부위에 대해서 지시되는 특이적인 폴리펩타이드 또는 그의 단편을 의미한다. 상기 IgE 항체는 감작 항체로서, 알레르겐에 의해 생성되며, 형질세포에 의해 만들어지고, 비만세포 또는 호염기구 표면에 있는 수용체에 부착될 수 있다. IgE 항체는 아나필락시스 (anaphylaxis, 과민증, 항원-항체 반응으로 생기는 특이적인 증상)를 일으키는 것일 수 있다.
본 발명의 또 다른 양상은 서열번호 1로 표시되는 아미노산 서열을 포함하는 폴리펩타이드를 포함하는 화분증 진단용 키트를 제공한다.
상기 폴리펩타이드에 대하여는 전술한 바와 같다.
상기 키트는 공지된 다양한 종류의 키트로 제작될 수 있다. 예를 들면, 상기 키트는 상기 단백질과 개체로부터 분리된 생물학적 시료 내의 IgE 항체 사이의 반응성을 정성적 또는 정량적으로 분석할 수 있는 면역분석(immunoassay)용 키트이다.
상기 키트는 상기 단백질이 코팅된 고체 기질과, 개체로부터 분리된 생물학적 시료 내의 IgE 항체에 결합할 수 있고 검출 가능한 신호를 발생시키는 표지가 결합되어 있는 항-IgE 항체 및 기타 항원 (알레르겐)-항체 (IgE) 반응을 검출하는데 필요한 시약을 포함하는 것일 수 있다. 상기 고체 기질은 탄화수소 폴리머(예를 들면, 폴리스티렌 및 폴리프로필렌 등), 유리, 금속 또는 겔인 것일 수 있고, 마이크로타이터 플레이트일 수 있다. 상기 검출 가능한 신호를 발생시키는 표지는, 화학 물질(예를 들면, 비오틴 등), 효소(예를 들면, 알칼린 포스파타아제, β-갈락토시다아제, 서양고추냉이 페옥시다아제 및 시토크롬 P450 등), 방사능 물질, 형광 물질(예를 들면, 플루오레신 등), 발광 물질, 화학발광 물질 (chemiluminescent) 및 형광 공명 에너지 전이 (fluorescence resonance energy transfer: FRET)를 포함하는 것일 수 있으나, 이에 한정되는 것은 아니다. 다양한 표지 및 표지 방법은 Ed Harlow and David Lane, Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1999에 기재되어 있다. 상기 키트는 상기한 성분들을 포함하는 다수의 별도 패키징 또는 컴파트먼트로 제작된 것일 수 있다.
또 다른 양상은 화분증 진단에 필요한 정보를 제공하기 위하여, 개체로부터 분리된 생물학적 시료에서, IgE 항체와 상기 단백질의 결합을 검출하는 방법을 제공한다.
상기 폴리펩타이드 및 화분증에 대하여는 전술한 바와 같다.
상기 "개체"는 환삼덩굴의 꽃가루에 대한 알레르기를 가지는지 여부 또는 환삼덩굴의 꽃가루에 대한 알레르기를 가질 가능성을 확인하거나 그를 예측하고자 하는 개체를 의미한다. 상기 개체는 척추동물인 것일 수 있고, 구체적으로 포유류, 양서류, 파충류, 조류 등인 것일 수 있으며, 보다 구체적으로 포유동물인 것일 수 있고, 보다 구체적으로 인간(Homo sapiens)일 수 있다. 상기 인간은 한국인일 수 있다.
상기 "생물학적 시료"는 개체로부터 분리된 조직, 세포, 전혈, 혈청, 혈장, 타액, 객담, 뇌척수액 또는 소변과 같은 시료 등을 포함하는 것일 수 있으나, 이에 제한되는 것은 아니다.
상기 방법은 면역분석(항원-항체 반응) 방법에 의해 실시될 수 있다. 상기 면역분석 방법은 방사능 면역분석, 방사능 면역침전, 면역침전, 효소결합 면역 흡착분석(enzyme-linked immunosorbent assay: ELISA), 캡처-ELISA, 억제 또는 경쟁 분석, 샌드위치 분석, 유세포 분석(flow cytometry), 면역형광염색 및 면역친화성 정제를 포함하는 것일 수 있으나, 이에 한정되는 것은 아니다. 상기 면역분석의 방법은 Enzyme Immunoassay, E. T.Maggio, ed., CRC Press, Boca Raton, Florida, 1980; Gaastra, W., Enzyme-linked immunosorbent assay (ELISA), in Methods in Molecular Biology, Vol. 1, Walker, J.M. ed., Humana Press, NJ, 1984; 및 Ed Harlow and David Lane, Using Antibodies:A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1999에 기재되어 있으며, 이를 참조할 수 있다.
예를 들면, 상기 방법이 방사능 면역분석으로 실시되는 경우, 방사능 동위원소(예를 들면, C14, I125, P32 및 S35 등)로 표지된 항체(IgE에 특이적으로 결합하는 항체)가 이용된다. 또한, 상기 방법은 상술한 검출 가능한 신호를 발생시키는 표지가 결합되어 있는 항체를 이용할 수 있다. 또는 예를 들면, 상기 방법이 ELISA로 실시되는 경우, (i) 동정한 상기 단백질을 고체 기질의 표면에 코팅하는 단계; (ii) 개체로부터 분리된 생물학적 시료를 코팅 처리된 상기 고체 기질에 첨가하는 단계; (iii) 상기 단계 (ii)의 결과물을 효소가 결합된 항-IgE 이차 항체와 반응시키는 단계; 및 (iv) 상기 효소의 활성을 측정하는 단계를 포함하는 것일 수 있다. 상기 이차 항체에 결합된 효소는 발색 반응, 형광 반응, 발광 반응 또는 적외선 반응을 촉매하는 효소를 포함하는 것일 수 있으나, 이에 한정되지 않으며, 예를 들면, 알칼린 포스파타아제, β-갈락토시다아제, 서양고추냉이 퍼옥시다아제, 루시퍼라아제 또는 시토크롬 P450을 포함한다. 상기 이차 항체에 결합된 효소로서 알칼린 포스파타아제가 이용되는 경우에는, 기질로서 브로모클로로인돌일 포스페이트, 니트로 블루 테트라졸리움, 나프톨-ASB1-포스페이트 또는 증강된 화학형광(enhanced chemifluorescence: ECF)와 같은 발색 반응 기질이 이용되고, 서양고추냉이 퍼옥시다아제가 이용되는 경우에는 클로로나프톨, 아미노에틸카바졸, 디아미노벤지딘, D-루시페린, 루시게닌 (비스-N-메틸아크리디늄 니트레이트), 레소루핀 벤질 에테르, 루미놀, 암플렉스레드 시약 (10-아세틸-3,7-디하이드록시페녹사진), p-페닐렌디아민-HCl 및 피로카테콜(p-phenylenediamine-HCl and pyrocatechol: HYR), 테트라메틸벤지딘 (tetramethylbenzidine: TMB), 2,2'-아진-디[3-에틸벤조티아졸린 설포네이트] (2,2'-Azine-di[3-ethylbenzthiazoline sulfonate]: ABTS), o-페닐렌디아민, 나프톨/파이로닌, 글루코스 옥시다아제와 t-니트로블루 테트라졸리움(t-nitroblue tetrazolium: t-NBT) 또는 m-펜나진 메토설포네이트(m-phenazine methosulfate: m-PMS)과 같은 기질이 이용될 수 있다.
환삼덩굴의 꽃가루에 대한 알레르기 진단에 필요한 정보를 제공하는 것은 환삼덩굴의 꽃가루에 대한 알레르기의 상대적인 위험을 예측 또는 진단하기 위한 것일 수 있다. 상기 방법에서 최종적인 효소의 활성 측정 또는 신호의 측정은 당업계에 공지된 다양한 방법에 따라 실시될 수 있다. 이러한 신호의 검출은 개체로부터 분리된 생물학적 시료 내의 IgE가 상기 단백질과 결합하였음을 보여주는 것이며, 이러한 정보를 환삼덩굴의 꽃가루에 대한 알레르기 진단에 활용할 수 있다.
또 다른 양상은 상기 서열번호 1로 표시되는 아미노산 서열을 포함하는 폴리펩타이드를 포함하는 환삼덩굴에 대한 화분증의 예방 또는 치료용 약학적 조성물을 제공한다. 상기 조성물은 환삼덩굴의 꽃가루에 대한 알레르기를 예방 또는 치료하기 위한 면역치료용 조성물인 것일 수 있다.
상기 "면역치료(allergen immunotherapy)"란 알레르기 질환을 일으키는 원인 물질인 알레르겐을 소량부터 서서히 증량하여 일정 기간 동안 개체에 주사로 투여함으로써, 특정 알레르겐에 대한 감수성 및 과민성을 저하시키는 치료법을 의미한다. 즉, 원인 알레르겐에 대한 탈감작 요법을 의미한다. 상기 면역치료는 피하 및/또는 설하에 투여되는 것일 수 있다. 이러한 면역치료는 저농도에서 시작하여 알레르겐의 양을 서서히 증가해 유지 용량에 이르게 하는 초기 치료 (initial therapy)와 이후 3 내지 5년간 지속하는 유지 치료(maintenance therapy) 등 두 단계로 이루어진 것, 계절 직전에 1일 내지 1주 동안 고농도의 알레르겐을 투여하는 것, 또는 수년간 저농도로 알레르겐을 투여하는 것일 수 있다. 상기 단백질, 또는 조성물을 투여하는 면역치료를 통하여, 추후 알레르겐에 노출시에 항원-항체 반응에 의한 증상의 발현을 예방 또는 억제하는 효과를 얻을 수 있다. 즉, 상기 폴리펩타이드는 환삼덩굴의 꽃가루에 대한 알레르기의 원인 물질이므로, 이를 환삼덩굴의 꽃가루에 대한 알레르기를 예방 또는 치료하기 위한 면역치료제로서 활용할 수 있다.
또한, 상기 면역치료는 임파선 내 면역치료 (intralymphatic immunotherapy, ILIT), 마이크로니들 패치 면역치료 (microneedle patch immunotherapy, MNIT) 또는 구강 면역치료 (oral immunotherapy, OIT) 방식으로 이루어질 수 있다.
상기 조성물은 약학적 조성물인 것일 수 있다. 상기 약학적 조성물은, 조성물 총 중량에 대하여 상기 유효 성분인, 상기 알레르겐을 0.0001 내지 50 중량%로 포함하는 것일 수 있다. 상기 약학적 조성물은, 투여를 위해서 상기 기재한 유효성분 이외에 추가로 약제학적으로 허용 가능한 담체를 1종 이상 포함하여 제조되는 것일 수 있다. 약제학적으로 허용 가능한 담체는 식염수, 멸균수, 링거액, 완충 식염수, 덱스트로즈 용액, 말토 덱스트린 용액, 글리세롤, 에탄올, 리포좀 및 이들 성분 중 하나 이상을 혼합하여 사용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다. 또한 희석제, 분산제, 계면활성제, 결합제 및 윤활제를 부가적으로 첨가하여 수용액, 현탁액, 유탁액 등과 같은 주사용 제형, 환약, 캡슐, 과립 또는 정제로 제제화할 수 있으며, 표적 기관에 특이적으로 작용할 수 있도록 표적 기관 특이적 항체 또는 기타 리간드를 상기 담체와 결합시켜 사용할 수 있다. 더 나아가 당해 기술분야의 적정한 방법으로 또는 레밍턴의 문헌(Remington's Pharmaceutical Science, Mack Publishing Company, Easton PA)에 기재되어 있는 방법을 이용하여 각 질환에 따라 또는 성분에 따라 바람직하게 제제화할 수 있다.
상기 약학적 조성물은 경구, 국소, 비경구, 비내, 정맥내, 근육내, 피하, 안내, 경피 등의 투여를 목적으로 제조될 수 있다. 상기 약학적 조성물은 임상 투여 시에 경구 또는 비경구로 투여가 가능하며, 비경구 투여시 비내, 설하, 복강내 주사, 직장내 주사, 피하 주사, 정맥 주사, 근육내 주사, 뇌혈관내 주사 또는 흉부내 주사에 의해 투여될 수 있다. 상기 투여 개체는 포유동물, 예를 들면, 인간, 돼지, 소, 말, 개, 고양이, 또는 실험 동물, 예를 들면, 마우스, 래트, 토끼, 기니아피그, 또는 햄스터이다. 사용되는 조성물의 투여량은 다양한 파라미터, 특히 투여 방식 또는 치료 기간에 의해 조절될 수 있다. 또한, 개체의 체중, 연령, 성별, 건강상태, 식이, 배설률 및 참나무목 식물의 꽃가루에 대한 알레르기 증상의 중증도 등에 따라 그 범위가 조절될 수 있다.
일일 투여량은 약 0.0001 내지 100 ㎎/㎏, 약 0.001 내지 10 ㎎/㎏, 약 0.01 내지 10 ㎎/㎏, 약 0.01 내지 5 ㎎/㎏, 약 0.1 내지 5 ㎎/㎏, 약 0.1 내지 3 ㎎/㎏, 약 0.1 내지 1 ㎎/㎏, 약 0.5 내지 1 ㎎/㎏으로 하루 1회 내지 수회로 나누어 투여될 수 있다.
본 발명의 서열번호 1로 표시되는 아미노산 서열을 포함하는 폴리펩타이드는 화분증 항원으로 화분증의 진단, 예방 또는 치료 용도로 유용하게 사용될 수 있다.
도 1은 환삼덩굴 꽃가루의 주요 알레르겐을 확인한 결과이다: A는 2차원 젤 분석 결과, B는 면역블롯팅 결과이고, C는 이온교환으로 환삼덩굴 꽃가루를 정제한 결과이다.
도 2는 알레르기 유발성 인버테이스/펙틴 메틸에스터레이스 저해제의 아미노산 서열을 비교한 결과이다: J hop PMEI (환삼덩굴 (Humulus japonicus, Japanese hop)의 PMEI 서열), Pla a 1 (단풍버즘나무 (Platanus acerifolia, London plane tree), CAD20556) 및 Pla or 1 (버짐나무 (Platanus orientalis, Oriental plane), ABY21305).
도 3은 환삼덩굴 꽃가루에서 분리한 펙틴 메틸에스터레이스 저해제 (PMEI)의 다형성을 분석한 결과로 각 동형의 백분율과 빈도는 괄호 안에 기재하였다.
도 4는 환삼덩굴 PMEI의 IgE 반응성을 확인한 결과이다: A는 정제된 단백질의 SDS-PAGE 분석 결과, B는 ELISA로 정제한 단백질의 IgE 반응성 확인 결과 (점선은 컷오프 값), C는 PMEI의 억제 면역블롯팅 분석 (C) 결과이며, E는 E. coli-발현 재조합 PMEI, O는 억제 없음, I는 천연 PMEI (nPMEI)로 억제한 실험군이다.
도 5는 환삼덩굴 PMEI의 번역후변형 여부를 확인한 결과이다: A는 정제된 재조합 PMEI의 SDS-PAGE 분리 결과, B는 재조합 PMEI에 대해 당단백질 염색을 수행하여 글리코실화를 검출한 결과, C는 IgE 반응성에 대한 PMEI의 인산화 효과를 확인하기 위해, 포스파타제 처리된 PMEI 및 포스파타제 처리되지 않은 PMEI를 SDS-PAGE 수행한 결과이고, D는 IgE 면역블롯팅 수행 결과이다. H, 양고추냉이 퍼옥시다제; S, 대두 트립신 억제제; I, PMEI; P, 포스파타제 처리된 PMEI; N, 포스파타제 처리되지 않은 PMEI.
도 2는 알레르기 유발성 인버테이스/펙틴 메틸에스터레이스 저해제의 아미노산 서열을 비교한 결과이다: J hop PMEI (환삼덩굴 (Humulus japonicus, Japanese hop)의 PMEI 서열), Pla a 1 (단풍버즘나무 (Platanus acerifolia, London plane tree), CAD20556) 및 Pla or 1 (버짐나무 (Platanus orientalis, Oriental plane), ABY21305).
도 3은 환삼덩굴 꽃가루에서 분리한 펙틴 메틸에스터레이스 저해제 (PMEI)의 다형성을 분석한 결과로 각 동형의 백분율과 빈도는 괄호 안에 기재하였다.
도 4는 환삼덩굴 PMEI의 IgE 반응성을 확인한 결과이다: A는 정제된 단백질의 SDS-PAGE 분석 결과, B는 ELISA로 정제한 단백질의 IgE 반응성 확인 결과 (점선은 컷오프 값), C는 PMEI의 억제 면역블롯팅 분석 (C) 결과이며, E는 E. coli-발현 재조합 PMEI, O는 억제 없음, I는 천연 PMEI (nPMEI)로 억제한 실험군이다.
도 5는 환삼덩굴 PMEI의 번역후변형 여부를 확인한 결과이다: A는 정제된 재조합 PMEI의 SDS-PAGE 분리 결과, B는 재조합 PMEI에 대해 당단백질 염색을 수행하여 글리코실화를 검출한 결과, C는 IgE 반응성에 대한 PMEI의 인산화 효과를 확인하기 위해, 포스파타제 처리된 PMEI 및 포스파타제 처리되지 않은 PMEI를 SDS-PAGE 수행한 결과이고, D는 IgE 면역블롯팅 수행 결과이다. H, 양고추냉이 퍼옥시다제; S, 대두 트립신 억제제; I, PMEI; P, 포스파타제 처리된 PMEI; N, 포스파타제 처리되지 않은 PMEI.
이하 하나 이상의 구체예를 실시예를 통하여 보다 상세하게 설명한다. 그러나 이들 실시예는 하나 이상의 구체예를 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
실험 방법
1. 환자 및 혈청 샘플
서울 세브란스병원 알레르기천식센터에 내원한 환자들을 대상으로 피부 단자 검사(skin prick test) 또는 ImmunoCAP(ThermoFisher Scientific, 스웨덴)을 정기적으로 시행하였다. 환삼덩굴(Japanese hop)에 감작된 22명(연령 범위 12-70세, 평균 43.5명, 남자 8명, 여자 14명)을 실험군으로 선택하였다. 환삼덩굴에 음성이고, 호흡기 알레르기 증상이 없는 다른 22명의 건강한 사람(연령 범위 3-25세, 평균 14세, 남성 9명 및 여성 13명)을 음성 대조군으로 설정하였다 (표 1). 실험군 및 음성대조군으로부터 수집된 혈청 샘플은 사용할 때까지 -20°C에서 보관하였다.
No. | Sex | Age | Diagnosis/ symptom* |
Sensitization profile | IgE (kUA/L) to Japanese hop (w22) | Total IgE (kU/L) |
1 | F | 59 | AR | d1, d2, d72, e1, e2, g6, t2, t3, t5, t7, t10, w22 | 4.51 | 181 |
2 | M | 46 | AR | f5, f6, f9, f11, f13, f25, f33, f47, f48, f95, g1, g7, t12, g2, g3, g6, i6, t7, w1, w6, w8, w11, w14, w22, | 5.76 | 56.8 |
3 | M | 23 | AR, AC | m1, t1, t2, t3, t5, t7, t8, t10, t11, t70, w1, w5, w7, w8, w10, w12, w22 | 32 | 83.1 |
4 | M | 56 | AR, AS | f6, f14, t1, t2, t3, t5, t7, t15, t70, w5, w7, w12, w22 | 20.6 | 306 |
5 | F | 45 | AR | d1, d2, f4,t3, t7, w1, w5, w7, w10, w16, w22, | 17.5 | ND** |
6 | F | 64 | AR | e71, i6,w22, | 6.06 | 30 |
7 | M | 58 | AR | w22 | 11.8 | ND |
8 | F | 49 | AR, AC | w1, w6, w10, w22 | >100 | 232 |
9 | F | 41 | AR, AC | w1, w6, w8, w12, w22 | 30.1 | 230 |
10 | M | 32 | AR, EB | d1, d2, d72, e1, e83, f4, f9, f11, g2, g3, g5, g6, g8, g12, m3, m5, t1, t2, t3, t4, t7, t8, t10, t11, t12, t15, t16, t70, w1, w5, w7, w9, w10, w12, w22 | 15.8 | 2070 |
11 | M | 49 | AR, AC | w1, w22 | 31.1 | ND |
12 | F | 64 | AR, AC | d1, d2, f4, f12, f13, f86, k84, w1, w22 | 2.55 | 183 |
13 | M | 18 | AR | t7, w22 | 33.3 | ND |
14 | F | 12 | AR | d2, e5,w22 | 229.7 | ND |
15 | F | 54 | AR | d1, d2,w1, w6, w22 | >100 | 356 |
16 | F | 30 | AR, AD | d1, d2, d72, g5, g6, m1, m2, m3, m5, t10, t19, t70, w5, w10, w12, w22 | >100 | ND |
17 | F | 25 | AR, AC | d2, e2, g5, t1, t8, t19, w1, w5, w7, w8, w12, w22, | 12.7 | ND |
18 | F | 56 | AR | w6, w22 | 34.7 | ND |
19 | M | 58 | AR | f11, t2, t3, t7, t15, w5, w7, w12, w22, | 16.9 | ND |
20 | F | 70 | AR | w22 | 33.1 | 108 |
21 | F | 23 | AS | d1, d2, w1, w9 | 4.56 | 86.5 |
22 | F | 26 | AR | d1, d2, e2, m6, w5, w7, w9, w22 | 13.5 | 165 |
*AC, allergic conjunctivitis; AD, atopic dermatitis; AR, allergic rhinitis; AS, allergic asthma; EB, eosinophilic bronchitis. ** d1, Dermatophagoides pteronyssinus; d2, D. farinae; d72, Tyrophagus putrescentiae; e1, Cat dander; e2, Dog hair; e5, Dog dander; e71, Mouse epithelium; e83, Swine epithelium; f4, Wheat; f5, Rye; f6, Barley; f9, Rice; f11, Buckwheat; f12, Pea; f13, Peanut; f14, Soybean; f25, Tomato; f33, Orange; f47, Garlic; f48, Onion; f86, parsley; f95, Peach; g1, Sweet vernal grass; g2, Bermuda grass; g3, cocksfoot; g5, Rye-grass; g6, Timothy grass; g7, Common reed; g8, Meadow grass; g12 Cultivated Rye; i6, German cockroach;k84, Sunflower seed; m1, Penicillium chrysogenum; m2, Cladosporium herbarum; m3, Aspergillus fumigatus; m5, Candida albicans; m6, Alternaria; t1, Acer; t2, Alder; t3, Birch; t4, Hazel; t5, Beech; t7, Oak; t8, Elm; t10, Walnut; t11, Platanus; t12, Willow; t15, White ash; t16, White pine; t19, Acacia; t70, Mulberry; w1, Common ragweed; w5, Wormwood; w6, Mugwort; w7, Chrysanthemum; w8, Dandelion; w9, Plantain; w10, Goosefoot; w11, Russian thistle; w12, Goldenrod; w14, Common pigweed; w22, Japanese hop. ***ND, Not determined |
2. 주요 알레르겐의 분리
환삼덩굴 꽃가루 추출물은 Prolagen Ltd (서울, 대한민국)에서 구입하였다. 펙틴 메틸에스터레이스 저해제(pectin methylesterase inhibitor; 이하, PMEI로 기재함)는 하기 3단계로 정제하였다.
먼저, CM52 셀룰로오스(GE Healthcare Bioscience, Little Chalfont, UK)를 사용한 양이온 교환 크로마토그래피를 5 mM 아세트산 나트륨, pH 5.2에서 수행하였다. 단백질은 0.5 M NaCl을 사용한 선형 구배로 용출시켰다.
둘째, 1 ㎖ Mono S 컬럼(GE Healthcare Bioscience)을 사용한 강한 양이온 교환 크로마토그래피로 추가 정제하였다. 단백질은 50 mM Tris-Cl, pH 8.0에서 수행되었다. 1 M NaCl의 선형 구배를 사용하여 단백질을 용출시켰다.
세 번째로, Sephadex G75 16/60 컬럼(GE Healthcare Bioscience)을 사용하여 pH 7.4의 인산완충식염수(phosphate-buffered saline)에서 겔 여과 크로마토그래피를 수행하였다. 정제된 단백질은 폴리비닐리덴 플루오라이드(PVDF) 멤브레인(0.45 ㎛, Millipore)으로 이동시킨 후 Procise 491 HT protein sequencer (Applied Biosystems, USA)를 사용하여 Edman 분해를 수행하였다.
3. 번역후변형 여부 분석
PMEI가 번역후변형되는지 여부를 확인하기 위해 Glycoprotein Staining kit (PierceTM)로 당단백질 염색을 수행하였다. 키트에 제공된 서양고추냉이 퍼옥시다제 (Horseradish peroxidase) 및 대두 트립신 억제제(soybean trypsin inhibitor)를 양성 및 음성 대조군으로 사용하였다. 정제된 단백질의 IgE 반응성 변화는 송아지 장 포스파타제(calf intestinal phosphatase; Thermoscientific) 처리 후에 면역블롯팅으로 평가하였다.
ProteomeTech(서울, 대한민국)에서 액체 크로마토그래피 결합 전자분무 이온화-탠덤 질량 분석법(Liquid chromatography coupled electrospray ionization-tandem mass spectrometry, LC ESI MS/MS)을 수행하여 추론된 아미노산 서열(deduced amino acid sequence)에 대한 질량 증가를 조사하고, 이를 통해 인산화 가능 부위를 확인하였다.
4. 클로닝 및 다형성 (polymorphism) 분석
PMEI를 암호화하는 클론은 전사체 분석으로 확인하였다. 환삼덩굴 꽃가루로부터 총 RNA를 추출하여 mRNA 라이브러리를 준비하고, 참고문헌 (Jeong et al., 2021)에 개시된 대로 서열을 분석하였다. Edman 분해에 의해 결정된 PMEI 서열과 상동인 RNA seq contig를 분석하였다.
다형성을 조사하고 주요 동형(isoform)을 식별하기 위해 RT-PCR을 수행하였다. 총 RNA를 주형으로 하여 교정 활성(proofreading activity)이 있는 ExTaq DNA 중합효소를 사용하여 첫 번째 cDNA를 합성하였다. 사용한 프라이머는 다음과 같다: 정방향 프라이머; 5'-ATggatttgatctctagcacatg-3' 및 역방향 프라이머; 5'-TCAACTgAgTTggTTTgTgATgg-3. 이후 PCR-증폭 산물을 pCR4-TOPO 벡터 (Invitrogen)에 클로닝하고 BioFact(대전, 대한민국)에서 DNA 서열을 분석하였다.
5. 재조합 알레르겐 생산
대장균 시스템에서 재조합 단백질을 생산하기 위해, 주요 동형의 성숙한 서열을 인코딩하는 ORF를 PCR로 증폭하였다: 정방향 프라이머 5'-TAAggCCTCTgTCgACgattgatctctagcacatg-3' 및 역방향 프라이머 5'-CAgAATTCgCAAgCTTACTgAgTTggTTTgTgATgg-3'. PCR 산물을 InFusion cloning system (Clontech Laboratories, Inc. A Takara Bio Company, 일본)을 사용하여 pET6xHN-C 벡터(Clontech Laboratories, Inc. A Takara Bio Company)에 라이게이션시켰다. 복제된 플라스미드의 DNA 서열은 양방향으로 확인하였다. 총 54개의 E. coli OrigamiTM 2 (DE3) pLysS (Novagen) 클론 (수용성 분획 및 봉입체 모두)을 분석하였다.
Pichia에서 발현되는 재조합 PMEI는 약간의 수정을 통해 참고문헌 (Jeong et al., 2004)에 설명한 대로 얻었다. DNA는 신호 절단 부위를 포함하는 원래 서열 (GAGGCTGAGCT)의 아미노산 변화 없이 내부 Xho I 제한 부위 (CTCGAG에서 CAGTAG)의 돌연변이 및 Pichia 시스템에서 PMEI의 발현을 위한 Bam HI 및 Not I 부위와 함께 합성되었다 (-5'에서 5'-CTCgAgAAAAgAgAggCT-3' 및 -3'에서 5'-CATCATCATCATCATCATgCggCCgC-3'). His 태그도 C 말단에 추가하였다. 제한효소로 절단한 삽입물을 pPIC9 벡터에 라이게이션시키고, Sal I을 처리하여 선형화시킨 후 선형화된 플라스미드를 P. 파스토리스(P. pastoris) GS115 균주에 형질전환시켰다. 배양 2일 후 배양 상등액으로부터 재조합 PMEI를 정제하였다. 단백질을 50~75% NH4SO4로 침전시키고 정제를 위해 투석하였다. E. coli 및 Pichia에서 발현시킨 각각의 재조합 단백질은 Ni-친화도 크로마토그래피로 정제하였다 (도 1C 삽도). Pichia에서 발현시킨 PMEI의 예상 크기는 155개 잔기, 16.34 kDa 크기이다.
6. ELISA 및 IgE-면역블롯팅 저해 어세이
정제된 재조합 PMEI 단백질의 IgE 반응성을 ELISA로 평가하였다. 0.05 M 탄산 완충액 (pH 9.6)에 희석한 정제된 단백질(2 ㎍/㎖)을 마이크로플레이트에 밤새 코팅하였다. 이후 마이크로플레이트를 0.05% Tween 20을 포함하는 인산염 완충 식염수 (PBST)에 희석한 3% 탈지유로 블록킹하였다. 1% BSA를 포함하는 PBS로 1:4로 희석한 혈청 샘플을 첨가하여 1시간 동안 반응시켰다. IgE 항체는 비오틴화된 염소 항-인간 IgE (1:1000) (Vector) 및 스트렙타비딘-과산화효소 접합체 (1:1000) (Sigma-Aldrich)로 검출하였다. 단백질 밴드는 기질 3.3'5.5'-tetramethyl-benzidine (Kirkegaard&Perry Laboratories)을 추가하여 발색시켰다. 0.5 M H2SO4로 효소 반응을 정지시킨 후 450 ㎚에서 흡광도를 측정하였다. 건강한 대조군에서 얻은 혈청의 평균 흡광도에 2개의 표준 편차를 더한 값을 컷오프 값으로 사용하였다.
정제된 nPMEI(천연 PMEI)와 꽃가루 추출물을 환원 조건에서 SDS-PAGE로 분리한 후 PVDF 막으로 이동시켰다. 이후, nPMEI의 IgE 반응성을 블롯팅으로 확인하거나 꽃가루 추출물을 이동시킨 막은 쿠마시 블루로 염색하였다.
특정 IgE 결합 단백질은 nPMEI에 대해 특이적으로 높은 IgE 역가를 나타내는 5개의 혈청 (혈청 3, 5, 8, 17, 22)을 풀링하여 확인하였다. nPMEI의 억제 어세이를 위해 풀링된 혈청을 억제제로서 nPMEI (20㎍/mL)와 함께 4℃에서 밤새 사전 반응시켰다. 또한, 1% BSA를 음성 대조군으로 사용하였다.
이후 PVDF 막으로 이동시킨 꽃가루 추출물과 사전 반응시킨 혈청의 IgE 반응성을 상기 기재한 바와 같이 분석하였다. 막은 1:1000으로 희석한 알칼리성 포스파타제 결합 염소 항인간 IgE (Sigma-Aldrich) 및 기질 니트로 블루 테트라졸륨 (substrate nitro blue tetrazolium) 및 5-브로모-4-클로로-3-인돌릴-포스페이트 NBT/BCIP (Promega)로 표지하였다.
실험 결과
1. PMEI의 분리 및 동정
IgE 반응성 반점은 프로테오믹스 분석에 의해 높은 pI 단백질 (약 10)로 확인되었다 (도 1AB). 따라서 음이온 교환 크로마토그래피로 추가로 정제하였다 (도 1C). 정제된 단백질은 Edman 분해 및 탠덤 MS 분석을 거쳤다. Edman 분해에 의해 결정된 N-말단 서열은 DLISSTCSKALYKDLCEKTL인 반면, 탠덤 MS 분석에서는 유의미한 일치가 발견되지 않았다. 정제 중에 때때로 부분적으로 분해된 단백질이 관찰되었다. 그러나 N-말단 서열은 Edman 분해에 의해 결정된 온전한 단백질과 동일하여 상기 부분적으로 분해된 단백질은 C-말단에서의 분해를 의미한다. 상기 N-말단 서열은 펙틴 메틸에스터레이스/인버테이스 저해제 단백질 패밀리와 유의한 일치를 보였다.
2. 일차 서열 분석 및 번역후변형의 검출
PMEI와 상동인 단일 서열은 환삼덩굴 꽃가루의 전사체 분석에 의해 얻어졌다 (도 2). 전장 서열은 pI 값이 7.28인 17.789kDa 단백질을 암호화한다. N-말단에 있는 25개의 아미노산이 성숙하는 동안 절단되며, 이는 정제된 단백질의 N-말단 서열에 의해 알 수 있다. 지금까지 플라타너스 (plane tree) 꽃가루에서 2종의 PMEI 알레르겐만 알려졌다. 환삼덩굴의 PMEI 서열은 Pla or 1 (버짐나무 (Oriental plane))과 32.4%, Pla a 1 (단풍버즘나무 (London plane))과 30.7%의 아미노산 서열을 공유한다.
54개의 클론을 분석한 결과 11개의 변이체가 밝혀졌다 (도 3). 그러나 9개 변이체의 산발적인 아미노산 치환 (sporadic amino acid substitutions)이 단 하나의 클론에서만 확인된 것을 고려하면 2개의 변이체만 중요한 것으로 보인다. 서열의 96.3%를 차지하는 두 가지 주요 변이체는 61번째 잔기에서 Gly (59.26%) (GenBank Accession No. ON399181)에서 Ala (24.07%) (ON399182)로의 단 하나의 아미노산 치환을 갖는다. 재조합 단백질은 61번째 잔기에 Gly가 있는 주요 동형으로 생산하였다.
흥미롭게도, 성숙한 단백질의 계산된 등전점은 7.20인 반면 정제된 PMEI의 등전점은 약 10이었다. 번역후변형에 의해 pI 값이 변화하는 것으로 생각된다.
3. PMEI의 IgE 반응성
E. coli 및 Pichia 발현 시스템을 사용하여 재조합 단백질을 생산하였다 (도 3A). 재조합 단백질은 천연 PMEI보다는 약했지만 IgE 반응성을 나타냈다. 천연 PMEI는 테스트한 혈청 샘플에서 IgE 항체의 86.4% (19/22)에서 인식된 반면, E. coli에서 발현된 재조합 PMEI는 45.5% (10/22), Pichia pastoris에서 발현된 재조합 PMEI는 50.0% (11/22)가 각각 인식되었다 (도 3B). PMEI는 10 kDa 성분의 IgE 반응성을 완전히 억제했으나, 50kDa 성분의 IgE 반응성은 불완전하게 억제하였다 (도 3C).
4. PMEI의 번역후변형
PMEI 및 대두 트립신 억제제의 글리코실화는 당단백질 염색에 의해 검출되지 않은 반면, 양고추냉이 퍼옥시다제에서는 글리코실화가 검출되었다 (도 5AB). 탠덤 MS 분석에 의해 최소 15개 아미노산의 인산화가 검출되었다 (도 2). 그러나 인산화는 PMEI의 IgE 반응성에 영향을 미치지 않았다 (도 5CD).
[참고문헌]
1. Becker WM, Reese G. Immunological identification, and characterization of individual food allergens. J Chromatogr B Biomed Sci Appl 2001; 756: 131-140.
2. Jang SW, Jeong KY, Yuk JE, Lee J, Park KH, Park JW. Allergen homologs, pathogenesis-related 1, polygalacturonase, and pectin methylesterase from a Japanese hop. Protein Pept Lett 2021; 28 (4): 362-371.
3. Jeong KY, Han IS, Choi SY, Lee JH, Lee JS, Hong CS, Park JW. Allergenicity of recombinant profilins from Japanese hop, Humulus japonicus. J Investig Allergol Clin Immunol 2013; 23 (5): 345-50.
4. Jeong KY, Lee J, Lee IY, Hong CS, Ree HI, Yong TS. Expression of tropomyosin from Blattella germanica as a recombinant non-fusion protein in Pichia pastoris and comparison of its IgE reactivity with its native counterpart. Protein Expr Purif 2004; 37 (2): 273-8.
5. Jeong KY, Lee J, Mistrello G, Park KH, Park JW. IgE cross-reactivity between Humulus japonicus and Humulus lupulus. Yonsei Med J 2018; 59 (7): 852-856.
6. Jeong KY, Lee J, Sang MK, Lee YS, Park KH, Lee JH, Park JW. Sensitization profile to sawtooth oak component allergens and their clinical implications. J Clin Lab Anal 2021; 35 (7): e23825.
7. Park HJ, Lee JH, Park KH, Kim KR, Han MJ, Choe H, Oh JW, Hong CS. A six-year study on the changes in airborne pollen counts and skin positivity rates in Korea: 2008-2013. Yonsei Med J 2016; 57 (3): 714-20.
8. Park JW, Ko SH, Kim CW, Jeoung BJ, Hong CS. Identification and characterization of the major allergen of the Humulus japonicus pollen. Clin Exp Allergy. (1999) 29:1080-6.
9. Valenta R, Campana R, Focke-Tejkl M, Niederberger V. Vaccine development for allergen-specific immunotherapy based on recombinant allergens and synthetic allergen peptides: Lessons from the past and novel mechanisms of action for the future. J Allergy Clin Immunol 2016; 137 (2): 351-7.
10. Valenta R, Karaulov A, Niederberger V, Zhernov Y, Elisyutina O, Campana R, Focke-Tejkl M, Curin M, Namazova-Baranova L, Wang JY, Pawankar R, Khaitov M. Allergen extracts for in vivo diagnosis and treatment of allergy: Is there a future? J Allergy Clin Immunol Pract 2018; 6 (6): 1845-1855.
<110> UNIVERSITY-INDUSTRY FOUNDATION, YONSEI UNIVERSITY
<120> COMPOSITIONS FOR DIAGNOSIS OF POLLINOSIS
<130> P22U18C0862_DP-2022-0590
<160> 2
<170> KoPatentIn 3.0
<210> 1
<211> 145
<212> PRT
<213> Humulus japonicus
<400> 1
Asp Leu Ile Ser Ser Thr Cys Ser Lys Ala Leu Tyr Lys Asp Leu Cys
1 5 10 15
Glu Lys Thr Leu Arg Ala Asp Ser Ser Ser Ser Gly Ala Lys Val Asp
20 25 30
Gly Leu Ala Lys Ile Ala Leu Lys Ala Ala Ser Ser Ser Ala Lys Ser
35 40 45
Ile Gln Gly Gln Ile Thr Thr Leu Leu Lys Thr Gly Lys Asp Lys Ala
50 55 60
Val Val Ala Ala Leu Lys Asp Cys Ser Glu Asn Tyr Ser Gly Ala Asn
65 70 75 80
Glu Gln Leu Gly Asp Ser Leu Lys Ala Met Val Ala Lys Arg Tyr Ser
85 90 95
Asp Val Asn Thr Trp Val Thr Ala Ala Met Thr Asp Gly Asp Ser Cys
100 105 110
Glu Asp Gly Phe Lys Ser Gly Thr Ser Pro Leu Thr Lys Ala Asn Thr
115 120 125
Asn Phe Ser Gln Leu Cys Ser Asn Val Leu Ala Ile Thr Asn Gln Leu
130 135 140
Ser
145
<210> 2
<211> 170
<212> PRT
<213> Humulus japonicus
<400> 2
Met Asn Pro Ile Ser Ile Phe Cys Leu Val Ser Leu Leu Ser Leu Gly
1 5 10 15
Leu Asn Gln Ile Pro Gln Val His Gly Asp Leu Ile Ser Ser Thr Cys
20 25 30
Ser Lys Ala Leu Tyr Lys Asp Leu Cys Glu Lys Thr Leu Arg Ala Asp
35 40 45
Ser Ser Ser Ser Gly Ala Lys Val Asp Gly Leu Ala Lys Ile Ala Leu
50 55 60
Lys Ala Ala Ser Ser Ser Ala Lys Ser Ile Gln Gly Gln Ile Thr Thr
65 70 75 80
Leu Leu Lys Thr Gly Lys Asp Lys Ala Val Val Ala Ala Leu Lys Asp
85 90 95
Cys Ser Glu Asn Tyr Ser Gly Ala Asn Glu Gln Leu Gly Asp Ser Leu
100 105 110
Lys Ala Met Val Ala Lys Arg Tyr Ser Asp Val Asn Thr Trp Val Thr
115 120 125
Ala Ala Met Thr Asp Gly Asp Ser Cys Glu Asp Gly Phe Lys Ser Gly
130 135 140
Thr Ser Pro Leu Thr Lys Ala Asn Thr Asn Phe Ser Gln Leu Cys Ser
145 150 155 160
Asn Val Leu Ala Ile Thr Asn Gln Leu Ser
165 170
Claims (8)
- 서열번호 1로 표시되는 아미노산 서열을 포함하는 폴리펩타이드를 포함하는 화분증 항원 조성물.
- 제1항에 있어서, 상기 폴리펩타이드는 환삼덩굴의 꽃가루로부터 유래된 것인, 화분증 항원 조성물.
- 서열번호 1로 표시되는 아미노산 서열을 포함하는 폴리펩타이드를 포함하는 화분증 진단용 조성물.
- 제3항에 있어서, 상기 꽃가루는 환삼덩굴에서 유래한 것인, 화분증 진단용 조성물.
- 제3항에 있어서, 상기 폴리펩타이드는 알레르기 환자로부터 분리된 IgE와 결합하는 것인, 화분증 진단용 조성물.
- 서열번호 1로 표시되는 아미노산 서열을 포함하는 폴리펩타이드를 포함하는 화분증 진단용 키트.
- 개체로부터 분리된 생물학적 시료의 IgE 항체와 서열번호 1로 표시되는 아미노산 서열을 포함하는 폴리펩타이드를 결합시키는 단계를 포함하는, 화분증 진단에 필요한 정보를 제공하기 위해 폴리펩타이드를 검출하는 방법.
- 서열번호 1로 표시되는 아미노산 서열을 포함하는 폴리펩타이드를 포함하는, 화분증의 예방 또는 치료용 약학적 조성물.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020220066054A KR20230166288A (ko) | 2022-05-30 | 2022-05-30 | 화분증 진단용 조성물 |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020220066054A KR20230166288A (ko) | 2022-05-30 | 2022-05-30 | 화분증 진단용 조성물 |
Publications (1)
Publication Number | Publication Date |
---|---|
KR20230166288A true KR20230166288A (ko) | 2023-12-07 |
Family
ID=89163421
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020220066054A KR20230166288A (ko) | 2022-05-30 | 2022-05-30 | 화분증 진단용 조성물 |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR20230166288A (ko) |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20220002909A (ko) | 2018-03-23 | 2022-01-07 | 페킹 유니언 메디컬 컬리지 호스피탈, 차이니즈 아카데미 오브 메디컬 사이언스 | 한삼덩굴 화분 알레르겐 추출물, 침출액 및 그 제조방법 |
-
2022
- 2022-05-30 KR KR1020220066054A patent/KR20230166288A/ko unknown
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20220002909A (ko) | 2018-03-23 | 2022-01-07 | 페킹 유니언 메디컬 컬리지 호스피탈, 차이니즈 아카데미 오브 메디컬 사이언스 | 한삼덩굴 화분 알레르겐 추출물, 침출액 및 그 제조방법 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
McDONALD et al. | Properties and distribution of the protein inhibitor (M r 17,000) of protein kinase C | |
Garcia-Campos et al. | Tegument glycoproteins and cathepsins of newly excysted juvenile Fasciola hepatica carry mannosidic and paucimannosidic N-glycans | |
US20150153358A1 (en) | Materials and methods for diagnosing and treating shellfish allergy | |
EP1377604B1 (en) | Methods and means for use of hla-dq restricted t-cell receptors and hla-dq-binding prolamine-derived peptides | |
CZ305786B6 (cs) | Způsob detekce alergenních proteinů a peptidů | |
Yano et al. | Purification and properties of allergenic proteins in buckwheat seeds | |
CN109942689B (zh) | 表位 | |
CA3089802A1 (en) | Method for the diagnosis of hereditary angioedema | |
Jeong et al. | Allergenicity of recombinant profilins from Japanese hop, Humulus japonicus | |
ElRamlawy et al. | Der f 34, a novel major house dust mite allergen belonging to a highly conserved Rid/YjgF/YER057c/UK114 family of imine deaminases | |
EP1975179A1 (en) | Polyclonal antibodies, preparation method thereof and use of same | |
Lorenzo et al. | The immunogenicity of Echinococcus granulosus antigen 5 is determined by its post-translational modifications | |
Stoeva et al. | Primary structure and unusual carbohydrate moiety of functional unit 2-c of keyhole limpet hemocyanin (KLH) | |
KR102363402B1 (ko) | 참나무목 식물의 꽃가루에 대한 알레르기 진단용 조성물, 이를 이용한 진단 방법, 및 참나무목 식물의 꽃가루에 대한 알레르기의 예방 또는 치료용 조성물 | |
KR20230166288A (ko) | 화분증 진단용 조성물 | |
Jeong et al. | Characterization of Hum j 6, a major allergen from Humulus japonicus pollen, the primary cause of weed pollinosis in East Asia | |
CN105646660A (zh) | 人HSP90α抗原表位肽、抗原、抗体、应用及试剂盒 | |
KR20180118485A (ko) | 참나무목 식물의 꽃가루에 대한 알레르기 진단용 조성물, 참나무목 식물의 꽃가루에 대한 알레르기 진단 방법, 및 참나무목 식물의 꽃가루에 대한 알레르기를 예방 또는 치료하기 위한 조성물 | |
CN107446040B (zh) | 人st2抗原表位肽、抗原、抗体、试剂盒及应用 | |
CN110470847B (zh) | 一种定量检测谷胱甘肽还原酶的elisa试剂盒及其检测方法 | |
KR20200129470A (ko) | 누에에 대한 알레르기 질환 진단용 조성물, 누에에 대한 알레르기 진단 방법, 및 누에에 대한 알레르기 질환 면역 치료용 조성물 | |
JP2005503113A (ja) | ブタクサアレルゲン | |
US11759498B2 (en) | Composition for diagnosing allergies to mites, method of diagnosing allergies to mites, and composition for preventing or treating allergies to mites | |
Siddiqui et al. | Involvement of glycans in the immunological cross-reaction between α-macroglobulin and hemocyanin of the gastropod Helix pomatia | |
KR102406593B1 (ko) | 참나무목 식물의 꽃가루에 특이적인 항체 또는 이의 항원 결합 단편, 이를 포함한 조성물, 키트 및 이를 이용한 검출방법 |