KR20210056184A - H5N8 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same - Google Patents

H5N8 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same Download PDF

Info

Publication number
KR20210056184A
KR20210056184A KR1020190143003A KR20190143003A KR20210056184A KR 20210056184 A KR20210056184 A KR 20210056184A KR 1020190143003 A KR1020190143003 A KR 1020190143003A KR 20190143003 A KR20190143003 A KR 20190143003A KR 20210056184 A KR20210056184 A KR 20210056184A
Authority
KR
South Korea
Prior art keywords
influenza virus
leu
val
gly
ser
Prior art date
Application number
KR1020190143003A
Other languages
Korean (ko)
Other versions
KR102259392B1 (en
Inventor
권혁준
김재홍
안세희
이충용
Original Assignee
서울대학교산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 서울대학교산학협력단 filed Critical 서울대학교산학협력단
Priority to KR1020190143003A priority Critical patent/KR102259392B1/en
Priority to PCT/KR2020/015451 priority patent/WO2021091279A1/en
Publication of KR20210056184A publication Critical patent/KR20210056184A/en
Application granted granted Critical
Publication of KR102259392B1 publication Critical patent/KR102259392B1/en

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • A61K39/145—Orthomyxoviridae, e.g. influenza virus
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011—Details
    • C12N2760/16011—Orthomyxoviridae
    • C12N2760/16034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • General Health & Medical Sciences (AREA)
  • Wood Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Microbiology (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Public Health (AREA)
  • Pulmonology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Mycology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

Provided are: mammalian pathogen-free, embryonic egg hyperproliferative, heat-resistant, attenuated clade 2.3.4.4a H5N8 recombinant influenza A virus; a composition for preparation thereof; cells transfected thereby; vaccine compositions; and a method for preventing influenza or avian influenza.

Description

Ｈ５Ｎ８ 재조합 인플루엔자 바이러스, 이의 제조용 조성물, 및 이를 포함하는 백신 조성물{H5N8 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same}{H5N8 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same}

H5N8 재조합 인플루엔자 바이러스, 이의 제조용 조성물, 및 이를 포함하는 백신 조성물에 관한 것이다.It relates to a H5N8 recombinant influenza virus, a composition for its preparation, and a vaccine composition comprising the same.

인플루엔자 바이러스는 오소믹소바이러스(Orthomyxoviridae)에 속하며, 음성의 단일가닥 RNA 절편 8개를 게놈으로 갖는 바이러스이다. 8개의 RNA 절편으로부터 혈구응집 단백질(hemagglutinin: HA), 뉴라미니다제(neuraminidase: NA), 뉴클레오캡시드 단백질(nucleoprotein: NP), 매트릭스 단백질 1 및 2(matrix 1 & 2: 각각 M1 및 M2), 중합효소 단위체 A, B1 및 B2(polymerase subunit A, B1 & B2: 각각 PA, PB1, 및 PB2), 및 비구조 단백질 1 및 2(nonstructural protein 1 & 2; 각각 NS1, NS2)가 만들어진다. 또한, 최근 PA와 PB1 유전자로부터 각각 PA-X와 PB1-F2 단백질이 만들어져 바이러스 병원성에 중요한 역할을 하는 것으로 알려져 있다.The influenza virus belongs to Orthomyxoviridae and is a virus having 8 negative single-stranded RNA segments as its genome. Hemagglutinin (HA), neuraminidase (NA), nucleoprotein (NP), matrix proteins 1 and 2 (matrix 1 & 2: M1 and M2, respectively) from 8 RNA fragments , Polymerase units A, B1 and B2 (polymerase subunits A, B1 & B2: PA, PB1, and PB2, respectively), and nonstructural proteins 1 & 2 (nonstructural proteins 1 &2; NS1 and NS2, respectively) are made. In addition, recently, PA-X and PB1-F2 proteins have been made from PA and PB1 genes, respectively, and are known to play an important role in viral pathogenicity.

역 유전학 기술을 사용한 재조합 A형 인플루엔자 백신은 계태아 증식성이 탁월하다. 특성이 잘 알려진 PR8 바이러스나 A/WSN/33(H1N1) 바이러스의 저온 적응 약독주인 A/Ann Arbor/6/60(H2N2) 바이러스 등의 8개 게놈을 조합하여 만든 재조합 바이러스를 백신주로 이용하고 있다(한국 특허 제0908757호 및 한국 특허 제0862758호). 통상적으로, HA와 NA 유전자는 최근 유행하는 바이러스로부터 RT-PCR 법으로 증폭하여 역 유전학 벡터에 클로닝 하고, PR8의 나머지 유전자 6개와 함께 transfection 하여 백신주를 작출하며 바이러스를 불활화하여 사독백신을 제조하고 있다.Recombinant influenza A vaccine using reverse genetics technology has excellent fetal proliferation. Recombinant virus made by combining 8 genomes such as PR8 virus with well-known characteristics or A/Ann Arbor/6/60 (H2N2) virus, which is a cold-adapted weak poison of A/WSN/33 (H1N1) virus, is used as a vaccine line. (Korean Patent No. 00908757 and Korean Patent No. 0862758). Typically, HA and NA genes are amplified from a recent virus by RT-PCR and cloned into a reverse genetic vector, transfected with the remaining six genes of PR8 to create a vaccine strain, and inactivated the virus to prepare a deadox vaccine. have.

PR8 바이러스의 유전자를 사용하여 제작한 재조합 고병원성 조류인플루엔자 바이러스 중 일부 아형은 발육란에서의 증식성이 좋지 않은 경우가 있고, PR8이 인체 인플루엔자 A 바이러스이기에 조류와 사람간의 교차감염의 위험성이 존재한다. 저병원성 H9N2 조류인플루엔자 바이러스인 A/chicken/Korea/01310/2001(H9N2) (01310)의 PB2 유전자를 PR8 바이러스에 재조합하여 마우스에 접종하면, 포유류에서의 병원성이 없어지고(Kim et al., 2014, Veterinary microbiology vol.168, p.41-49), 발육란 고증식성, 포유류 무병원성 재조합 바이러스가 제작 가능하다(한국 특허 제1423695호).Some subtypes of recombinant highly pathogenic avian influenza viruses produced using the PR8 virus gene may have poor proliferation in embryonated eggs, and since PR8 is a human influenza A virus, there is a risk of cross-infection between birds and humans. When the PB2 gene of the low pathogenic H9N2 avian influenza virus A/chicken/Korea/01310/2001(H9N2) is recombined with PR8 virus and inoculated into mice, the pathogenicity in mammals disappears (Kim et al., 2014, Veterinary microbiology vol.168, p.41-49), embryonated egg highly proliferative, mammalian pathogenic recombinant virus can be produced (Korean Patent No. 1423695).

최근 전세계적으로 유행하고 있는 고병원성 클레이드 2.3.4.4a H5N8 인플루엔자 A 바이러스는 국내에서도 큰 경제적 피해를 초래하였다. 이에, 농림검역검사본부에서는 H5N8 인플루엔자 A 바이러스를 비상시 예방용 백신주로 선정하였고, 국내 동물백신회사에서 백신 제조용 바이러스를 원료를 생산하여 냉동보관하고 있다. 그러나 기존의 역유전학 기술을 이용하여 작출된 클레이드 2.3.4.4a H5N8 백신주의 계태아 증식성과 내열성이 낮아 백신 효능과 보존성에 영향을 주어 백신 품질의 저하가 문제된다.The highly pathogenic clade 2.3.4.4a H5N8 influenza A virus, which is recently prevalent worldwide, caused great economic damage in Korea. Therefore, the Ministry of Agriculture, Forestry and Quarantine and Inspection has selected H5N8 influenza A virus as a vaccine for emergency prevention, and domestic animal vaccine companies produce and store the virus for vaccine production in a frozen state. However, the low fetal proliferation and heat resistance of the Clade 2.3.4.4a H5N8 vaccine strain constructed using the existing reverse genetics technique affects the efficacy and preservation of the vaccine, resulting in a problem of deterioration of the quality of the vaccine.

H5N8 재조합 인플루엔자 바이러스를 제공한다.H5N8 recombinant influenza virus is provided.

H5N8 재조합 인플루엔자 바이러스 제조용 조성물 또는 이를 이용한 제조 방법을 제공한다.It provides a composition for the production of H5N8 recombinant influenza virus or a production method using the same.

H5N8 재조합 인플루엔자 바이러스 제조용 조성물로 형질전환된 세포를 제공한다.It provides a cell transformed with a composition for producing H5N8 recombinant influenza virus.

H5N8 재조합 인플루엔자 바이러스를 포함하는 백신 조성물을 제공한다.It provides a vaccine composition comprising the H5N8 recombinant influenza virus.

일 양상은 인플루엔자 바이러스 H5N8 스트레인의 헤마글루티닌(hemagglutinin: HA) 단백질;One aspect is the hemagglutinin (HA) protein of the influenza virus H5N8 strain;

H5N8 스트레인의 뉴라미니다제(neuraminidase: NA);Neuraminidase (NA) of the H5N8 strain;

저병원성 인플루엔자 바이러스의 중합효소 B2(polymerase subunit B2: PB2); 및Polymerase subunit B2 (PB2) of hypopathogenic influenza virus; And

인플루엔자 바이러스 H1N1 스트레인의 중합효소 B1(polymerase subunit B1: PB1), 중합효소 A(polymerase subunit A: PA), 뉴클레오캡시드(nucleoprotein: NP), 매트릭스 단백질(matrix: M) 및 비구조적 단백질(nonstructural protein: NS)로 이루어진 군으로부터 선택된 하나 이상의 단백질을 포함하는 H5N8 재조합 인플루엔자 바이러스를 제공한다.Influenza virus H1N1 strain of polymerase B1 (polymerase subunit B1: PB1), polymerase A (polymerase subunit A: PA), nucleoprotein (NP), matrix protein (M), and nonstructural protein : It provides a recombinant H5N8 influenza virus comprising at least one protein selected from the group consisting of NS).

인플루엔자 바이러스는 오소믹소바이러스과(Orthomyxoviridae)의 바이러스로서, 독감 또는 유행성 감기를 유발할 수 있다. 상기 인플루엔자 바이러스는 클레이드(clade) 2.3.4.4a H5N8 바이러스일 수 있다. 상기 인플루엔자 바이러스 H5N8 스트레인은 인플루엔자 A 바이러스 서브타입 H5N8이라고도 불린다.Influenza virus is a virus of the Orthomyxoviridae family and can cause flu or a flu. The influenza virus may be a clade 2.3.4.4a H5N8 virus. The influenza virus H5N8 strain is also called influenza A virus subtype H5N8.

헤마글루티닌(hemagglutinin: HA) 단백질은 적혈구응집 단백질 또는 혈구응집소라고도 불린다. 상기 헤마글루티닌 단백질은 서열번호 1 또는 2의 아미노산 서열을 포함하는 폴리펩티드일 수 있다. 상기 헤마글루티닌 단백질은 서열번호 1의 아미노산 서열에서 N 말단으로부터 103번째 아미노산이 돌연변이된 것일 수 있다. 상기 헤마글루티닌 단백질은 서열번호 1의 아미노산 서열에서 N 말단으로부터 103번째 아미노산인 히스티딘(H)이 티로신(Y)로 돌연변이된 것일 수 있다.Hemagglutinin (HA) protein is also called hemagglutination protein or hemagglutinin. The hemagglutinin protein may be a polypeptide comprising the amino acid sequence of SEQ ID NO: 1 or 2. The hemagglutinin protein may be obtained by mutating the 103rd amino acid from the N-terminus in the amino acid sequence of SEQ ID NO: 1. The hemagglutinin protein may be obtained by mutating histidine (H), which is the 103rd amino acid from the N terminal, to tyrosine (Y) in the amino acid sequence of SEQ ID NO: 1.

상기 헤마글루티닌 단백질의 절단 부위(cleavage site)는 돌연변이된 것일 수 있다. 상기 돌연변이는 삽입, 절단, 결실, 치환, 점 돌연변이, 또는 격자이동 돌연변이일 수 있다. 상기 돌연변이에 의해 헤마글루티닌 단백질의 절단 부위는 제거될 수 있다. 상기 헤마글루티닌 단백질의 절단 부위는 N 말단으로부터 339번째 내지 345번째 아미노산 서열일 수 있다. 상기 절단 부위는 N-RERRRK-C(서열번호 5), N-REKRRK-C(서열번호 6), 또는 N-RKRKK-C(서열번호 7)일 수 있다. 상기 절단 부위는 임의의 아미노산 서열로 돌연변이될 수 있다. 예를 들어, 상기 절단 부위는 아미노산 서열 N-ASGR-C로 돌연변이된다.The cleavage site of the hemagglutinin protein may be mutated. The mutation may be an insertion, truncation, deletion, substitution, point mutation, or lattice shift mutation. By the mutation, the cleavage site of the hemagglutinin protein may be removed. The cleavage site of the hemagglutinin protein may be an amino acid sequence from the 339th to the 345th from the N terminal. The cleavage site may be N-RERRRK-C (SEQ ID NO: 5), N-REKRRK-C (SEQ ID NO: 6), or N-RKRKK-C (SEQ ID NO: 7). The cleavage site can be mutated to any amino acid sequence. For example, the cleavage site is mutated to the amino acid sequence N-ASGR-C.

상기 헤마글루티닌 단백질은 헤마글루티닌 전구체로 발현되어, 헤마글루티닌 HA1 및 HA2로 절단될 수 있다. 상기 헤마글루티닌 단백질의 HA2 도메인은 서열번호 1의 아미노산 서열에서 N 말단으로부터 498번째 아미노산 또는 서열번호 2의 아미노산 서열에서 N 말단으로부터 496번째인 아스파라긴(N)이 트레오닌(T)로 돌연변이될 수 있다.The hemagglutinin protein is expressed as a hemagglutinin precursor and can be cleaved into hemagglutinin HA1 and HA2. In the HA2 domain of the hemagglutinin protein, asparagine (N), which is the 498th amino acid from the N-terminus in the amino acid sequence of SEQ ID NO: 1 or the 496th from the N-terminus in the amino acid sequence of SEQ ID NO: 2, can be mutated to threonine (T). have.

뉴라미니다제(neuraminidase: NA)는 뉴라민산(neuraminic acid)을 가수분해하여 시알산을 분리하는 효소를 말한다. 상기 뉴라미니다제는 바이러스가 숙주의 세포에 침입하거나 빠져나올때 필요할 수 있다. 상기 뉴라미니다제는 인플루엔자 바이러스 H5N8 스트레인 유래의 뉴라미니다제일 수 있다. 상기 뉴라미니다제는 서열번호 3의 아미노산 서열을 포함하는 폴리펩티드일 수 있다.Neuraminidase (NA) refers to an enzyme that hydrolyzes neuraminic acid to separate sialic acid. The neuraminidase may be required when the virus enters or exits the host's cells. The neuraminidase may be neuraminidase derived from influenza virus H5N8 strain. The neuraminidase may be a polypeptide comprising the amino acid sequence of SEQ ID NO: 3.

상기 저병원성 인플루엔자 바이러스는 국내 저병원성 조류 인플루엔자 바이러스인 A/chicken/Korea/01310/2001(H9N2)(이하, '01310'라고 함)(한국 특허 제0790801호)일 수 있다. 상기 01310 균주는 한국 특허 제0790801호의 실시예1에서와 같이 분리된 국내 분리주로서 저병원성이다. 그러나, 상기 01310 균주는 저병원성이긴 하지만 병원성 바이러스이기 때문에 기탁기관에 기탁이 불가능하며, 현재 농림수산검역검사본부 조류질병과에 보관중이다.The low pathogenic influenza virus may be a domestic low pathogenic avian influenza virus, A/chicken/Korea/01310/2001 (H9N2) (hereinafter referred to as '01310') (Korean Patent No. 0790801). The 01310 strain is a domestic isolate isolated as in Example 1 of Korean Patent No. 0790801 and has low pathogenicity. However, the 01310 strain, although low pathogenic, is a pathogenic virus, so it cannot be deposited with a depository institution, and is currently being stored in the Bird Disease Division of the Agriculture, Forestry and Fisheries Quarantine and Inspection Headquarters.

중합효소 B2는 인플루엔자 바이러스의 RNA-의존성 RNA 중합효소의 서브유닛 중 하나이다. 상기 중합효소 B2(polymerase subunit B2: PB2) 단백질은 서열번호 4의 아미노산 서열을 포함하는 폴리펩티드일 수 있다.Polymerase B2 is one of the subunits of the RNA-dependent RNA polymerase of the influenza virus. The polymerase subunit B2 (PB2) protein may be a polypeptide including the amino acid sequence of SEQ ID NO: 4.

상기 인플루엔자 바이러스 H1N1 스트레인은 A/Puerto Rico/8/34(이하, 'PR8'이라고 함)일 수 있다.The influenza virus H1N1 strain may be A/Puerto Rico/8/34 (hereinafter referred to as'PR8').

중합효소 B1(polymerase subunit B1: PB1)은 인플루엔자 바이러스의 RNA-의존성 RNA 중합효소의 서브유닛 중 하나이다. 상기 중합효소 B1은 GenBank accession number NC_002021의 핵산 서열로 코딩되는 폴리펩티드 또는 Uniprot P03431의 아미노산 서열을 포함하는 폴리펩티드일 수 있다. Polymerase B1 (polymerase subunit B1: PB1) is one of the subunits of the RNA-dependent RNA polymerase of influenza virus. The polymerase B1 may be a polypeptide encoded by the nucleic acid sequence of GenBank accession number NC_002021 or a polypeptide including the amino acid sequence of Uniprot P03431.

중합효소 A(polymerase subunit A: PA)는 인플루엔자 바이러스의 RNA-의존성 RNA 중합효소의 서브유닛 중 하나이다. 상기 중합효소 A는 GenBank accession number NC_002022의 핵산 서열로 코딩되는 폴리펩티드 또는 Uniprot P03433의 아미노산 서열을 포함하는 폴리펩티드일 수 있다. Polymerase A (polymerase subunit A: PA) is one of the subunits of the RNA-dependent RNA polymerase of the influenza virus. The polymerase A may be a polypeptide encoded by the nucleic acid sequence of GenBank accession number NC_002022 or a polypeptide comprising the amino acid sequence of Uniprot P03433.

뉴클레오캡시드(nucleoprotein: NP)는 음성(negative) 가닥 바이러스 RNAfmf 캡슐화하는 구조 단백질이다. 상기 뉴클레오캡시드는 GenBank accession number NC_002019의 핵산 서열로 코딩되는 폴리펩티드 또는 Uniprot P03466의 아미노산 서열을 포함하는 폴리펩티드일 수 있다. Nucleoprotein (NP) is a structural protein that encapsulates the negative strand virus RNAfmf. The nucleocapsid may be a polypeptide encoded by the nucleic acid sequence of GenBank accession number NC_002019 or a polypeptide including the amino acid sequence of Uniprot P03466.

매트릭스 단백질(matrix: M)은 바이러스 코어와 바이러스 외피를 연결시켜주는 구조 단백질이다. 상기 매트릭스 단백질은 GenBank accession number NC_002016의 핵산 서열로 코딩되는 폴리펩티드 또는 Uniprot P06821 또는 P03485의 아미노산 서열을 포함하는 폴리펩티드일 수 있다. Matrix protein (M) is a structural protein that connects the viral core and the viral envelope. The matrix protein may be a polypeptide encoded by the nucleic acid sequence of GenBank accession number NC_002016 or a polypeptide including the amino acid sequence of Uniprot P06821 or P03485.

비구조적 단백질(nonstructural protein: NS)은 바이러스 복제에 필요한 동종이량체(homodimeric) RNA-결합 단백질이다. 상기 비구조적 단백질은 GenBank accession number NC_002020의 핵산 서열로 코딩되는 폴리펩티드 또는 Uniprot P03496의 아미노산 서열을 포함하는 폴리펩티드일 수 있다. Nonstructural proteins (NS) are homodimeric RNA-binding proteins required for viral replication. The non-structural protein may be a polypeptide encoded by the nucleic acid sequence of GenBank accession number NC_002020 or a polypeptide comprising the amino acid sequence of Uniprot P03496.

상기 H5N8 재조합 인플루엔자 바이러스는 인플루엔자 바이러스 H1N1 스트레인의 중합효소 B1, 중합효소 A, 뉴클레오캡시드, 매트릭스 단백질 및 비구조적 단백질로 이루어진 군으로부터 선택된 하나 이상의 단백질을 포함할 수 있다. 상기 H5N8 재조합 인플루엔자 바이러스는 인플루엔자 바이러스 H1N1 스트레인의 중합효소 B1, 중합효소 A, 뉴클레오캡시드, 매트릭스 단백질 및 비구조적 단백질 모두를 포함할 수 있다.The H5N8 recombinant influenza virus may include one or more proteins selected from the group consisting of polymerase B1, polymerase A, nucleocapsid, matrix protein, and non-structural protein of the influenza virus H1N1 strain. The H5N8 recombinant influenza virus may include all of the polymerase B1, polymerase A, nucleocapsid, matrix protein, and non-structural protein of the influenza virus H1N1 strain.

상기 H5N8 재조합 인플루엔자 바이러스는 기탁번호 KCTC14012BP(2019.10.30)으로 기탁된 것일 수 있다.The H5N8 recombinant influenza virus may be deposited under the accession number KCTC14012BP (2019.10.30).

상기 H5N8 재조합 인플루엔자 바이러스는 H5N8 스트레인 유래 단백질, 저병원성 인플루엔자 바이러스 유래 단백질, 및 H1N1 스트레인 유래 단백질 중 2 이상을 포함한 재조합 바이러스일 수 있다.The H5N8 recombinant influenza virus may be a recombinant virus including two or more of H5N8 strain-derived proteins, low pathogenic influenza virus-derived proteins, and H1N1 strain-derived proteins.

상기 H5N8 재조합 인플루엔자 바이러스는 포유류 무병원성, 발육란 고증식성, 또는 내열성 바이러스일 수 있다. 상기 H5N8 재조합 인플루엔자 바이러스는 포유류무병원성, 발육란고증식성, 내열성 클레이드 2.3.4.4a H5N8 약독화 재조합 바이러스일 수 있다. 상기 H5N8 재조합 인플루엔자 바이러스는 포유류에 병원성이 없어 안전하고, 발육란에서 고증식성이어서 백신 생산성을 높일 수 있고, 높은 내열성을 갖추고 있어 백신 원료/제품 보관 및 유통 기간 연장에 유용하다.The H5N8 recombinant influenza virus may be a mammalian pathogenic, embryonic hyperproliferative, or heat resistant virus. The H5N8 recombinant influenza virus may be a mammalian-free, high-growth, heat-resistant clade 2.3.4.4a H5N8 attenuated recombinant virus. The H5N8 recombinant influenza virus is safe because it is not pathogenic to mammals, is highly proliferative in embryonated eggs, so it can increase vaccine productivity, and has high heat resistance, so it is useful for storing vaccine raw materials/products and extending the shelf life.

다른 양상은 인플루엔자 바이러스 H5N8 스트레인의 헤마글루티닌 단백질을 코딩하는 폴리뉴클레오티드;Another aspect is a polynucleotide encoding the hemagglutinin protein of the influenza virus H5N8 strain;

H5N8 스트레인의 뉴라미니다제를 코딩하는 폴리뉴클레오티드;Polynucleotides encoding neuraminidase of the H5N8 strain;

저병원성 인플루엔자 바이러스의 중합효소 B2를 코딩하는 폴리뉴클레오티드; 및A polynucleotide encoding the polymerase B2 of the hypopathogenic influenza virus; And

인플루엔자 바이러스 H1N1 스트레인의 중합효소 B1, 중합효소 A, 뉴클레오캡시드, 매트릭스 단백질 및 비구조적 단백질로 이루어진 군으로부터 선택된 하나 이상의 단백질을 코딩하는 폴리뉴클레오티드를 포함하는 H5N8 재조합 인플루엔자 바이러스 제조용 조성물을 제공한다.It provides a composition for producing H5N8 recombinant influenza virus comprising a polynucleotide encoding at least one protein selected from the group consisting of polymerase B1, polymerase A, nucleocapsid, matrix protein, and non-structural protein of the influenza virus H1N1 strain.

인플루엔자 바이러스 H5N8 스트레인, 헤마글루티닌 단백질, 뉴라미니다제, 저병원성 인플루엔자 바이러스, 중합효소 B2, 인플루엔자 바이러스 H1N1 스트레인, 중합효소 B1, 중합효소 A, 뉴클레오캡시드, 매트릭스 단백질 및 비구조적 단백질은 전술한 바와 같다.Influenza virus H5N8 strain, hemagglutinin protein, neuraminidase, hypopathogenic influenza virus, polymerase B2, influenza virus H1N1 strain, polymerase B1, polymerase A, nucleocapsid, matrix protein and non-structural protein are described above. As shown.

상기 폴리뉴클레오티드는 상기 헤마글루티닌 단백질, 뉴라미니다제, 중합효소 B2, 중합효소 B1, 중합효소 A, 뉴클레오캡시드, 매트릭스 단백질, 및 비구조적 단백질 중 어느 하나를 코딩하는 핵산 서열을 포함하는 폴리뉴클레오티드일 수 있다. 상기 폴리뉴클레오티드는 코돈 사용 빈도(codon usage)에 따라 변경될 수 있다. The polynucleotide comprises a nucleic acid sequence encoding any one of the hemagglutinin protein, neuraminidase, polymerase B2, polymerase B1, polymerase A, nucleocapsid, matrix protein, and non-structural protein. It can be a polynucleotide. The polynucleotide may be changed according to codon usage.

상기 폴리뉴클레오티드는 벡터에 포함된 것일 수 있다. 상기 벡터는 발현 벡터일 수 있다. 상기 벡터는 동물세포에서의 발현을 위해 필요한 조절 영역(예, 프로모터, 인핸서, 및 사일런서)를 포함할 수 있다. 상기 폴리뉴클레오티드는 조절 영역과 작동 가능하게 연결된 것일 수 있다. 상기 벡터는 복제원점, 폴리A 서열, 다중 클로닝 부위, 선별 마커 등을 더 포함할 수 있다.The polynucleotide may be included in a vector. The vector may be an expression vector. The vector may include regulatory regions (eg, promoters, enhancers, and silencers) necessary for expression in animal cells. The polynucleotide may be operably linked to a regulatory region. The vector may further include an origin of replication, a polyA sequence, a multiple cloning site, a selection marker, and the like.

상기 벡터는 플라스미드 벡터, 코스미드 벡터, 박테리오파지 벡터, 또는 바이러스 벡터일 수 있다. 상기 바이러스 벡터는 아데너바이러스 벡터, 레트로바이러스 벡터, 또는 아데노연관 바이러스 벡터일 수 있다.The vector may be a plasmid vector, a cosmid vector, a bacteriophage vector, or a viral vector. The viral vector may be an adenovirus vector, a retroviral vector, or an adeno-associated virus vector.

다른 양상은 일 양상에 따른 H5N8 재조합 인플루엔자 바이러스 제조용 조성물과 세포를 인큐베이션하여 세포에 H5N8 재조합 인플루엔자 바이러스를 형질전환시키는 단계를 포함하는 H5N8 재조합 인플루엔자 바이러스 제조 방법을 제공한다.Another aspect provides a method for producing H5N8 recombinant influenza virus comprising the step of incubating the cells with the composition for producing H5N8 recombinant influenza virus according to one aspect to transform the cells with the H5N8 recombinant influenza virus.

상기 세포는 재조합 바이러스를 생산할 수 있는 세포일 수 있다. 예를 들어, 상기 세포는 293T, MDCK, Vero, DF1, PK15, 및 ST1 세포이다. 상시 세포는 조류의 동물 세포일 수 있다. 상기 세포는 병아리의 발육란 또는 계태아 신장세포일 수 있다.The cell may be a cell capable of producing a recombinant virus. For example, the cells are 293T, MDCK, Vero, DF1, PK15, and ST1 cells. The normal cell may be an algal animal cell. The cells may be embryonic eggs of chicks or fetal kidney cells.

상기 H5N8 재조합 인플루엔자 바이러스 제조용 조성물과 세포를 인큐베이션하는 단계는 H5N8 재조합 인플루엔자 바이러스를 발육란의 요막액에 가하고, 요막액을 배양하는 것일 수 있다.The step of incubating the H5N8 recombinant influenza virus preparation composition and cells may include adding the H5N8 recombinant influenza virus to the allantoic fluid of embryonated eggs and culturing the allantoic fluid.

상기 형질전환은 세포에 H5N8 재조합 인플루엔자 바이러스 제조용 조성물의 핵산이 도입되는 것일 수 있다. 형질전환은 당업계에 알려진 방법으로 수행될 수 있다. 예를 들어, 형질전환은 형질도입, 형질감염, 미세 주입법, 리포펙션, 또는 전기천공법으로 수행될 수 있다.The transformation may be a nucleic acid of the composition for producing H5N8 recombinant influenza virus is introduced into the cell. Transformation can be carried out by methods known in the art. For example, transformation can be performed by transduction, transfection, microinjection, lipofection, or electroporation.

상기 방법은 형질전환된 세포로부터 H5N8 재조합 인플루엔자 바이러스를 분리하는 단계를 더 포함할 수 있다.The method may further comprise the step of isolating the H5N8 recombinant influenza virus from the transformed cells.

다른 양상은 일 양상에 따른 H5N8 재조합 인플루엔자 바이러스 제조용 조성물로 형질전환된 세포를 제공한다.Another aspect provides a cell transformed with the composition for producing H5N8 recombinant influenza virus according to one aspect.

H5N8 재조합 인플루엔자 바이러스 제조용 조성물 및 형질전환은 전술한 바와 같다.The composition and transformation for preparing H5N8 recombinant influenza virus are as described above.

상기 세포는 재조합 바이러스를 생산할 수 있는 세포일 수 있다. 예를 들어, 상기 세포는 293T, MDCK, Vero, DF1, PK15, 및 ST1 세포이다. 상시 세포는 조류의 동물 세포일 수 있다. 상기 세포는 병아리의 발육란 또는 계태아 신장세포일 수 있다.The cell may be a cell capable of producing a recombinant virus. For example, the cells are 293T, MDCK, Vero, DF1, PK15, and ST1 cells. The normal cell may be an algal animal cell. The cells may be embryonic eggs of chicks or fetal kidney cells.

다른 양상은 일 양상에 따른 H5N8 재조합 인플루엔자 바이러스를 포함하는 백신 조성물을 제공한다.Another aspect provides a vaccine composition comprising the H5N8 recombinant influenza virus according to one aspect.

상기 H5N8 재조합 인플루엔자 바이러스는 전술한 바와 같다.The H5N8 recombinant influenza virus is as described above.

상기 백신 조성물은 독감 또는 조류 독감을 예방하기 위한 것일 수 있다. 상기 백신 조성물은 조류(예, 닭, 오리) 또는 포유류(예, 사람, 돼지, 개, 고양이, 말, 소, 양, 마우스, 낙타)에 투여하기 위한 것일 수 있다. 상기 예방은 상기 백신 조성물의 투여에 의해 인플루엔자 바이러스에 의해 유발되는 질환(예, 독감, 조류 독삼)의 발생을 억제하거나 그의 발병을 지연시키는 모든 행위를 말한다. The vaccine composition may be for preventing flu or bird flu. The vaccine composition may be for administration to birds (eg, chickens, ducks) or mammals (eg, humans, pigs, dogs, cats, horses, cows, sheep, mice, camels). The prevention refers to any action of inhibiting or delaying the onset of diseases (eg, flu, avian venom) caused by influenza virus by administration of the vaccine composition.

상기 백신 조성물은 H5N8 재조합 인플루엔자 바이러스을 유효한 양으로 포함할 수 있다. 용어 "유효한 양"은 예방 또는 치료를 필요로 하는 개체에게 투여되는 경우 예방 또는 치료의 효과를 나타내기에 충분한 양을 말한다. 상기 유효한 양은 당업자가 선택되는 세포 또는 개체에 따라 적절하게 선택할 수 있다. 질환의 중증도, 환자의 연령, 체중, 건강, 성별, 환자의 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료 기간, 사용된 조성물과 배합 또는 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 상기 백신 조성물은 약 1x107 내지 1x1011, 1x108 내지 5x1010, 5x108 내지 2x1010 개의 바이러스 입자를 포함한 양으로 투여될 수 있다.The vaccine composition may contain an effective amount of H5N8 recombinant influenza virus. The term “effective amount” refers to an amount sufficient to exhibit the effect of prophylaxis or treatment when administered to an individual in need thereof. The effective amount can be appropriately selected by a person skilled in the art according to the cell or individual to be selected. The severity of the disease, the patient's age, weight, health, sex, the patient's sensitivity to the drug, the time of administration, the route of administration and the rate of excretion, the duration of treatment, factors, including drugs used in combination or concurrent with the composition used, and other fields of medicine. It can be determined according to factors well-known in the. The vaccine composition may be administered in an amount including about 1x10 7 to 1x10 11 , 1x10 8 to 5x10 10 , 5x10 8 to 2x10 10 viral particles.

상기 백신 조성물은 사독 백신 또는 생독 백신 조성물일 수 있다.The vaccine composition may be a dead poison vaccine or a live poison vaccine composition.

상기 백신 조성물은 약학적으로 허용가능한 담체를 포함할 수 있다. 상기 담체는 부형제, 희석제 또는 보조제를 포함하는 의미로 사용된다. 상기 담체는 예를 들면, 락토스, 덱스트로스, 수크로스, 소르비톨, 만니톨, 자일리톨, 에리트리톨, 말티톨, 전분, 아카시아 고무, 알기네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로스, 메틸 셀룰로스, 폴리비닐 피롤리돈, 물, 생리식염수, PBS와 같은 완충액, 메틸히드록시 벤조에이트, 프로필히드록시 벤조에이트, 탈크, 마그네슘 스테아레이트, 및 미네랄 오일로 이루어진 군으로부터 선택된 것일 수 있다. 상기 조성물은 충진제, 항응집제, 윤활제, 습윤제, 풍미제, 유화제, 보존제, 또는 이들의 조합을 포함할 수 있다.The vaccine composition may contain a pharmaceutically acceptable carrier. The carrier is used in the sense of including an excipient, diluent or adjuvant. The carrier is, for example, lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, polyvinyl blood. It may be selected from the group consisting of rolidone, water, physiological saline, a buffer such as PBS, methylhydroxy benzoate, propylhydroxy benzoate, talc, magnesium stearate, and mineral oil. The composition may contain a filler, an anti-aggregating agent, a lubricant, a wetting agent, a flavoring agent, an emulsifier, a preservative, or a combination thereof.

상기 백신 조성물은 비경구 경로(예, 혈관내, 정맥내, 동맥내, 근육내 또는 피하 등), 경구, 비강, 직장, 경피 또는 에어로졸을 통한 흡입 경로로 투여될 수 있다. 상기 백신 조성물의 투여량은 예를 들어, 약 1x107 내지 1x1011, 1x108 내지 5x1010, 5x108 내지 2x1010 개의 바이러스 입자일 수 있다. 상기 투여는 1일 1회, 1일 2회 내지 24회, 1주일에 1회 내지 6회, 1개월에 1회 내지 3회, 또는 1년에 1회 내지 12회 투여될 수 있다.The vaccine composition may be administered by a parenteral route (eg, intravascular, intravenous, intraarterial, intramuscular or subcutaneous, etc.), orally, nasal, rectal, transdermal, or by inhalation via aerosol. The dosage of the vaccine composition may be, for example, about 1x10 7 to 1x10 11 , 1x10 8 to 5x10 10 , 5x10 8 to 2x10 10 viral particles. The administration may be administered once a day, 2 to 24 times a day, 1 to 6 times a week, 1 to 3 times a month, or 1 to 12 times a year.

상기 백신 조성물은 경구 투여 제형(예를 들면, 분말, 정제, 캡슐, 시럽, 알약, 또는 과립), 또는 비경구 제형(예를 들면, 주사제)으로 제형화될 수 있다. 또한, 상기 조성물은 전신 제형, 또는 국부 제형으로 제조될 수 있다.The vaccine composition may be formulated as an oral dosage form (eg, powder, tablet, capsule, syrup, pill, or granule), or a parenteral formulation (eg, an injection). In addition, the composition may be prepared in a systemic formulation or a topical formulation.

상기 백신 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있다. 그리고 단일 또는 다중 투여될 수 있다.The vaccine composition may be administered as an individual therapeutic agent or administered in combination with other therapeutic agents, and may be administered sequentially or simultaneously with a conventional therapeutic agent. And can be administered single or multiple.

다른 양상은 일 양상에 따른 백신 조성물을 개체에 투여하는 단계를 포함하는 독감 또는 조류 독감의 예방 방법을 제공한다.Another aspect provides a method of preventing flu or bird flu, comprising administering to an individual a vaccine composition according to one aspect.

상기 개체는 조류(예, 닭, 오리) 또는 포유류(예, 사람, 돼지, 개, 마우스)일 수 있다.The individual may be a bird (eg, chicken, duck) or a mammal (eg, human, pig, dog, mouse).

상기 백신 조성물의 투여량은 환자의 상태 및 체중, 질병의 정도, 약물 형태, 투여 경로 및 기간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있다. 상기 백신 조성물은 약 1x107 내지 1x1011, 1x108 내지 5x1010, 5x108 내지 2x1010 개의 바이러스 입자를 포함한 양으로 투여될 수 있다. 상기 투여는 1일 1회, 1일 2회 내지 24회, 1주일에 1회 내지 6회, 1개월에 1회 내지 3회, 또는 1년에 1회 내지 12회 투여될 수 있다.The dosage of the vaccine composition varies depending on the condition and weight of the patient, the degree of disease, the form of the drug, the route and duration of administration, but may be appropriately selected by those skilled in the art. The vaccine composition may be administered in an amount including about 1x10 7 to 1x10 11 , 1x10 8 to 5x10 10 , 5x10 8 to 2x10 10 viral particles. The administration may be administered once a day, 2 to 24 times a day, 1 to 6 times a week, 1 to 3 times a month, or 1 to 12 times a year.

포유류 무병원성, 발육란 고증식성, 내열성, 약독화 클레이드 2.3.4.4a H5N8 재조합 인플루엔자 A 바이러스는 생산성이 높고 효능이 우수한 백신주로 유용하게 활용될 수 있다. Mammalian pathogenicity, embryonic egg high proliferation, heat resistance, attenuated clade 2.3.4.4a H5N8 recombinant influenza A virus can be usefully used as a vaccine strain with high productivity and excellent efficacy.

도 1은 재조합 바이러스 rH5N8, rH5N8-hmH103Y, 및 rH5N8-hmH103Y-310PB2의 모식도를 나타낸다.
도 2a는 MDCK 세포에서 rH5N8, rH5N8-hmH103Y, 및 rH5N8-hmH103Y-310PB2의 접종 후 시간에 따른 세포 배양 감염 용량(TCID50/0.1ml)을 나타낸 그래프이고(*: 해당 바이러스가 다른 바이러스와 비교 시 통계적으로 유의적인 차이를 보임, 신뢰구간 95%, p<0.05), 도 2b는 A549 세포에서 rH5N8, rH5N8-hmH103Y, 및 rH5N8-hmH103Y-310PB2의 접종 후 시간에 따른 세포 배양 감염 용량(TCID50/0.1ml)을 나타낸 그래프이다(*: 해당 바이러스가 다른 바이러스와 비교 시 통계적으로 유의적인 차이를 보임, 신뢰구간 95%, p<0.05).
도 3a 및 도 3b는 각각 마우스에 rH5N8, rH5N8-hmH103Y, 및 rH5N8-hmH103Y-310PB2의 접종 후 시간에 따른 마우스의 체중(g) 및 생존율(%)을 나타내는 그래프이다(●: rH5N8, ■: rH5N8-hmH103Y, ▼: rH5N8-hmH103Y-310PB2, ○: rPR8, □: mock).
도 4는 rH5N8 및 rH5N8-hmH103Y의 인큐베이션 온도(℃)에 따른 HA 역가(log2)를 나타낸 그래프이다.1 shows a schematic diagram of the recombinant viruses rH5N8, rH5N8-hmH103Y, and rH5N8-hmH103Y-310PB2.
Figure 2a is a graph showing the cell culture infection capacity (TCID 50 /0.1ml) according to time after inoculation of rH5N8, rH5N8-hmH103Y, and rH5N8-hmH103Y-310PB2 in MDCK cells (*: when the virus is compared with other viruses Statistically significant difference was shown, confidence interval 95%, p<0.05), Figure 2b shows the cell culture infection dose (TCID 50 /) after inoculation of rH5N8, rH5N8-hmH103Y, and rH5N8-hmH103Y-310PB2 in A549 cells. 0.1ml) (*: the virus shows a statistically significant difference when compared to other viruses, confidence interval 95%, p<0.05).
3A and 3B are graphs showing the body weight (g) and survival rate (%) of mice according to time after inoculation of rH5N8, rH5N8-hmH103Y, and rH5N8-hmH103Y-310PB2 to mice, respectively (●: rH5N8, ■: rH5N8 -hmH103Y, ▼: rH5N8-hmH103Y-310PB2, ○: rPR8, □: mock).
4 is a graph showing HA titers (log2) according to incubation temperatures (°C) of rH5N8 and rH5N8-hmH103Y.

이하 실시예를 통하여 보다 상세하게 설명한다. 그러나, 이들 실시예는 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.It will be described in more detail through the following examples. However, these examples are for illustrative purposes only, and the scope of the present invention is not limited to these examples.

실시예 1. 고병원성 H5N8 인플루엔자 바이러스의 HA, NA 게놈 및 01310의 PB2 게놈 분절을 갖는 재조합 바이러스 제작 및 특성 분석Example 1. Construction and Characterization of Recombinant Viruses Having HA, NA Genome and PB2 Genome Segment of 01310 of High Pathogenic H5N8 Influenza Virus

1-1. 인플루엔자 바이러스 HA 단백질이 돌연변이된 HA 플라스미드 제작1-1. Construction of HA plasmid with mutated HA protein of influenza virus

국내에서 분리된 고병원성 인플루엔자 바이러스 H5N8, H5N6의 HA와 NA 단백질의 아미노산 서열을 비교 및 분석하여, 가장 일치도가 높은 HA 또는 NA의 영역을 선정하였다. 부위 특이적 돌연변이로, HA의 절단 부위(N 말단으로부터 339번내지 345번 아미노산 서열: N-RERRRKR-C)를 아미노산 서열 N-ASGR-C로 치환하여, 인플루엔자 바이러스의 병원성을 제거하였다.By comparing and analyzing the amino acid sequences of HA and NA proteins of highly pathogenic influenza viruses H5N8 and H5N6 isolated in Korea, the regions of HA or NA with the highest agreement were selected. With a site-specific mutation, the cleavage site of the HA (amino acid sequence 339 to 345 from the N-terminus: N-RERRRKR-C) was replaced with the amino acid sequence N-ASGR-C to remove the pathogenicity of the influenza virus.

HA2 단백질의 154번 아스파라긴(Asparagine, N)을 트레오닌(Threonine, T)로 변경한 HA 유전자와 NA 유전자를 각각 합성하고, 호프만 플라스미드 벡터(한국 특허 제0862758호)에 클로닝하였다.The HA gene and the NA gene in which Asparagine (N) at No. 154 of the HA2 protein was changed to Threonine (T) were synthesized, respectively, and cloned into a Hoffman plasmid vector (Korean Patent No. 0862758).

합성한 H5N8의 HA 단백질의 경우, N 말단으로부터 103번 아미노산을 히스티딘(Histidine: H)에서 티로신(Tyrosine: Y)으로 치환하기 위해 HA 유전자에서 해당하는 아미노산의 코돈을 이루는 뉴클레오티드를 CAC에서 TAC로 치환하고, 그를 중심으로 양 방향으로 동일한 서열을 가지는 약 30bp의 상보적인 프라이머 세트를 제작하였다. 프라이머와 Muta-Direct Site Directed Mutagenesis Kit(iNtRon Co. South Korea)를 사용해 HA 단백질의 103번 아미노산 부분의 게놈이 CAC에서 TAC로 치환된 합성한 H5N8 바이러스의 HA 게놈 클로닝 벡터 플라스미드를 제작하였다. In the case of the synthesized H5N8 HA protein, in order to replace amino acid 103 from the N-terminus from histidine (H) to tyrosine (Y), the nucleotide constituting the codon of the corresponding amino acid in the HA gene is substituted from CAC to TAC. And, a complementary primer set of about 30 bp having the same sequence in both directions was prepared around it. Using primers and Muta-Direct Site Directed Mutagenesis Kit (iNtRon Co. South Korea), the HA genome cloning vector plasmid of the synthesized H5N8 virus in which the genome of amino acid 103 of the HA protein was replaced by TAC in CAC was constructed.

야생형(wild type) 헤마글루티닌(hemagglutinin: HA)의 아미노산 서열(서열번호 1) 및 HA-H103Y의 아미노산 서열(서열번호 2)을 하기에 나타내었다(N 말단->C말단).The amino acid sequence of wild type hemagglutinin (HA) (SEQ ID NO: 1) and the amino acid sequence of HA-H103Y (SEQ ID NO: 2) are shown below (N-terminal -> C-terminal).

HA:HA:

MEKIVLLLAIVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPANDLCYPGTLNDYEELK H LLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGASSFFRNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPNTYVSVGTSTLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKGDSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLRNSPLRERRRKGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVR NGT YDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRICI (서열번호 1)MEKIVLLLAIVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPANDLCYPGTLNDYEELK H LLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGASSFFRNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPNTYVSVGTSTLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKGDSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLRNSPL RERRRK GLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVR NGT YDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRICI (SEQ ID NO: 1)

HA-H103Y:HA-H103Y:

MEKIVLLLAIVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPANDLCYPGTLNDYEELK Y LLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGASSFFRNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPNTYVSVGTSTLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKGDSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLRNSPLASGRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVR NGT YDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRICI (서열번호 2)MEKIVLLLAIVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPANDLCYPGTLNDYEELK Y LLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGASSFFRNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPNTYVSVGTSTLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKGDSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLRNSPL ASGR GLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVR NGT YDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRICI (SEQ ID NO: 2)

서열번호 1 및 2에서, 진한 문자 및 밑줄은 HA의 103번째 아미노산의 돌연변이 위치를 나타내고, 진한 문자는 절단 부위의 돌연변이 위치를 나타내고, 이탤릭 문자 및 밑줄은 아스파라긴(N)이 트레오닌(T)로 돌연변이될 수 있는 위치를 나타낸다.In SEQ ID NOs: 1 and 2, bold letters and underscores indicate the mutation position of the 103rd amino acid of HA, bold letters indicate the mutation position of the cleavage site, and italic letters and underscores indicate the mutation of asparagine (N) to threonine (T). Indicates a possible location.

1-2. 재조합 바이러스 제작1-2. Recombinant virus production

재조합 인플루엔자 바이러스 제작을 위하여, 호프만의 역유전학 벡터시스템(한국 특허 제0862758호)을 이용하였다. For the production of recombinant influenza virus, Hoffmann's reverse genetics vector system (Korean Patent No. 0862758) was used.

구체적으로, 실시예 1-1에서 합성한 고병원성 H5N8 인플루엔자 바이러스의 HA와 NA 핵산 단편이 클로닝된 벡터를 준비하였다. 또한, 저병원성 인플루엔자 바이러스 01310 스트레인의 PB2 핵산 절편이 클로닝된 호프만 플라스미드 벡터, 및 인플루엔자 A 바이러스 PR8 스트레인의 PB1, PA, NP, M, 및 NS 핵산 절편이 클로닝된 호프만 플라스미드 벡터를 준비하였다. Specifically, a vector in which HA and NA nucleic acid fragments of the highly pathogenic H5N8 influenza virus synthesized in Example 1-1 were cloned was prepared. In addition, the Hoffman plasmid vector in which the PB2 nucleic acid fragment of the low pathogenic influenza virus 01310 strain was cloned, and the Hoffman plasmid vector in which the PB1, PA, NP, M, and NS nucleic acid fragments of the influenza A virus PR8 strain were cloned were prepared.

6-웰 세포배양용기에 5%(v/v) FBS를 함유한 DMEM(GIBCO BRL) 배지를 가하고, 1X106개/2 ㎖의 293T 세포(생물자원센터, KCTC)를 각 웰에 첨가한 후 37℃ 및 5% CO2의 조건에서 약 24 시간 동안 인큐베션하여 세포를 부착시켰다. 배지를 제거한 후 Opti-MEM 배지(Invitrogen Co. USA) 0.8 ㎖를 첨가하였다.DMEM (GIBCO BRL) medium containing 5% (v/v) FBS was added to a 6-well cell culture vessel, and 1×10 6 cells/2 ml of 293T cells (Bio Resource Center, KCTC) were added to each well. Cells were attached by incubation at 37° C. and 5% CO 2 for about 24 hours. After removing the medium, 0.8 ml of Opti-MEM medium (Invitrogen Co. USA) was added.

준비된 플라스미드 8개를 모두 하나의 1.5 ㎖ 튜브에 각각 300 ng씩의 양으로 넣고, 최종 25㎕가 되도록 Opti-MEM 배지를 첨가하였다. 또다른 1.5 ㎖의 튜브에 6 ㎕의 Plus reagent(Invitrogen Co. USA)와 69 ㎕의 Opti-MEM 배지를 첨가하여 혼합한 후, 플라스미드가 들어있는 1.5 ㎖의 튜브에 첨가하여 혼합하고, 혼합물을 실온에서 약 15분간 인규베이션하였다. All eight of the prepared plasmids were put in an amount of 300 ng each in one 1.5 ml tube, and Opti-MEM medium was added to a final 25 μl. In another 1.5 ml tube, 6 µl of Plus reagent (Invitrogen Co. USA) and 69 µl of Opti-MEM medium were added and mixed, and then added to a 1.5 ml tube containing the plasmid for mixing, and the mixture was mixed at room temperature. Incubated for about 15 minutes at.

4 ㎕의 lipofectamine(Invitrogen Co)과 96 ㎕의 Opti-MEM을 혼합하고, 상기 플라스미드가 있는 튜브에 첨가한 후 15분간 더 인큐베이션하였다. 반응 생성물을 293T 세포가 들어있는 각 웰에 200 ㎕씩 첨가하였다. 세포를 37℃ 및 5% CO2의 조건에서 20 시간 동안 배양한 후, 웰 당 10 ㎍의 트립신(2.5 ㎍/4 ㎕)과 1 ㎖의 opti-MEM 배지를 첨가하였다. 24시간 후 상층액을 수확하고, 수확된 원액 200 ㎕를 10 내지 11일령 SPF 발육란(Sunrise Co., NY)에 요막강 경로로 접종하였다. 접종된 발육란을 37℃에서 3일간 배양하고, 요막액을 수확하여 혈구응집 여부를 확인하였다. 접종된 발육란은 모두 혈구응집 양성을 보였다. 재조합 바이러스를 rH5N8, rH5N8-hmH103Y, 또는 rH5N8-hmH103Y-310PB2로 명명하고, 바이러스의 모식도를 도 1에 나타내었다.4 µl of lipofectamine (Invitrogen Co) and 96 µl of Opti-MEM were mixed, added to the tube with the plasmid, and incubated for 15 minutes. The reaction product was added 200 µl to each well containing 293T cells. Cells were cultured at 37° C. and 5% CO 2 for 20 hours, and then 10 μg of trypsin (2.5 μg/4 μl) and 1 ml of opti-MEM medium were added per well. After 24 hours, the supernatant was harvested, and 200 µl of the harvested stock solution was inoculated into 10 to 11 day old SPF embryonated eggs (Sunrise Co., NY) by the allantoic route. The inoculated embryonated eggs were cultured at 37° C. for 3 days, and the allantoic fluid was harvested to check whether or not hemagglutination. All inoculated embryos were positive for hemagglutination. The recombinant virus was named rH5N8, rH5N8-hmH103Y, or rH5N8-hmH103Y-310PB2, and a schematic diagram of the virus is shown in FIG. 1.

이 재조합 바이러스의 혈구응집역가를 측정하고, 100배 희석하여 동일한 방법으로 발생란에서 증식시킨 바이러스(E2)를 -70℃에서 보관하였다.The hemagglutination titer of this recombinant virus was measured, diluted 100 times, and the virus (E2) grown in embryonated eggs by the same method was stored at -70°C.

1-3. 바이러스 역가 측정1-3. Virus titer measurement

실시예 1-2의 재조합 바이러스(E2)의 계태아에서의 증식 역가(50% embryo infection dose, EID50/㎖)를 측정하였다. 구체적으로, 각각의 재조합 바이러스들을 인산완충용액으로 10-1 내지 10-9까지 10진 희석하여 각 희석 배수 별로 10 내지 11일령의 SPF 발육란 5개에 요막강 경로로 100 ㎕씩 접종하였다. 그 후 3일간 배양한 후 요막액을 수확하였다. 닭의 적혈구로 혈구응집여부를 확인하고, Spearman-Karber 방법의 계산식에 따라 바이러스 역가(EID50/㎖)를 측정하였다. The proliferation titer (50% embryo infection dose, EID 50 /ml) of the recombinant virus (E2) of Example 1-2 in fetuses was measured. Specifically, each of the recombinant viruses was diluted 10 -1 to 10 -9 with a phosphate buffer solution, and inoculated to 5 SPF embryos of 10 to 11 days old for each dilution factor by 100 µl by the allantoic route. After incubation for 3 days, the allantoic fluid was harvested. Hemagglutination was confirmed with chicken red blood cells, and virus titer (EID 50 / ㎖) was measured according to the calculation formula of the Spearman-Karber method.

1-4. 10일령 발육란에서의 증식성 비교1-4. Comparison of proliferative properties in 10-day-old embryonated eggs

실시예 1-3에서 얻어진 바이러스 역가(EID50/㎖(log10))를 토대로, 100 EID50의 바이러스를 각 5개의 10일령 발육란에 요막강 경로로 100 ㎕씩 접종하였다. 3일간 배양한 후 요막액을 수확하여 실시예 1-3에 기재된 바와 같이 EID50/㎖를 측정하여 발육란에서의 증식성을 비교한 결과를 표 1에 나타내었다.Based on the virus titer (EID 50 /ml (log 10)) obtained in Example 1-3, 100 EID 50 virus was inoculated into each of five 10-day-old embryonated eggs by 100 µl by the allantoic route. After culturing for 3 days, the allantoic solution was harvested, and the results of comparing the proliferative properties in embryonated eggs by measuring EID 50/ml as described in Example 1-3 are shown in Table 1.

재조합 바이러스Recombinant virus EID50/㎖(log10)EID 50 /ml (log10) rH5N8rH5N8 8.3 ± 0.38.3 ± 0.3 rH5N8-hmH103Y rH5N8-hmH103Y 9.3 ± 0.39.3 ± 0.3 rH5N8-hmH103Y-310PB2rH5N8-hmH103Y-310PB2 9.3 ± 0.19.3 ± 0.1

표 1에 나타난 바와 같이, rH5N8의 바이러스 역가는 108.3 EID50/㎖인 것에 반해, rH5N8-hmH103Y의 바이러스 역가는 109.3 EID50/㎖이고, rH5N8-hmH103Y-310PB2의 바이러스 역가는 109.3 EID50/ml이었다. 따라서, rH5N8-hmH103Y 및 rH5N8-hmH103Y-310PB2의 발육란에서의 증식성이 상승한 것을 확인하였다.As shown in Table 1, the viral titer of rH5N8 is 10 8.3 EID 50 / ml, whereas the viral titer of rH5N8-hmH103Y is 10 9.3 EID 50 / ml, and the viral titer of rH5N8-hmH103Y-310PB2 is 10 9.3 EID 50 /ml. Therefore, it was confirmed that the proliferative properties of rH5N8-hmH103Y and rH5N8-hmH103Y-310PB2 were increased in embryonated eggs.

1-5. 재조합 바이러스의 포유류세포에서의 증식성 확인1-5. Confirmation of proliferation of recombinant virus in mammalian cells

실시예 1-2의 재조합 바이러스가 포유류 세포에서 증식하는지 비교하기 위해, Madin-Darby Canine Kidney(MDCK) 세포주와 A549 세포주에서의 성장곡선을 확인하였다.In order to compare whether the recombinant virus of Example 1-2 proliferates in mammalian cells, the growth curves in the Madin-Darby Canine Kidney (MDCK) cell line and the A549 cell line were confirmed.

MDCK 세포주는 10%(v/v) 우태아혈청(FBS)을 함유한 Dulbecco's Modified Eagle Medium(DMEM)(Life technologies Co., CA, USA) 배지에서 유지시켰고, A549 세포주는 10%(v/v) 우태아혈청(FBS)을 함유한 DMEM/F12(Life technologies Co., CA, USA) 배지에서 유지시켰다. 두 세포주를 각각 12-웰 세포배양 플레이트에 접종하여 단일 층을 형성시킨 후, 각 재조합 바이러스를 5X105/0.1 ㎖의 양으로 접종하였다. 접종 후, 0 시간, 24 시간, 48 시간, 및 72 시간 마다 상층액을 100 ㎕씩 수득하였다. 수득한 상층액은 10-1 내지 10-9까지 10진 희석하여 96-웰 세포배양 플레이트에 단일 층이 형성된 MDCK 세포에 접종하여, Tissue Culture Infectious Dose (TCID50/0.1ml)을 측정하고, 그 결과를 도 2a(MDCK 세포) 및 도 2b(A549 세포)에 나타내었다.The MDCK cell line was maintained in Dulbecco's Modified Eagle Medium (DMEM) (Life technologies Co., CA, USA) medium containing 10% (v/v) fetal calf serum (FBS), and the A549 cell line was maintained at 10% (v/v). ) It was maintained in DMEM/F12 (Life technologies Co., CA, USA) medium containing fetal calf serum (FBS). Each of the two cell lines was inoculated into a 12-well cell culture plate to form a single layer, and then each recombinant virus was inoculated in an amount of 5×10 5 /0.1 ml. After inoculation, 100 µl of the supernatant was obtained every 0, 24, 48, and 72 hours. The obtained supernatant was diluted in decimal to 10 -1 to 10 -9 and inoculated into MDCK cells having a single layer in a 96-well cell culture plate, and Tissue Culture Infectious Dose (TCID 50 /0.1 ml) was measured, and the The results are shown in FIGS. 2A (MDCK cells) and 2B (A549 cells).

도 2a 및 도 2b에 나타난 바와 같이, rH5N8과 비교하여, rH5N8-hmH103Y는 MDCK 세포주와 A549 세포주 모두에서 증식성이 높아졌으며, rH5N8-hmH103Y-310PB2는 MDCK 세포주와 A549 세포주 모두에서 증식하지 못하는 것을 확인하였다. 2A and 2B, compared to rH5N8, rH5N8-hmH103Y has increased proliferation in both the MDCK cell line and the A549 cell line, and rH5N8-hmH103Y-310PB2 confirmed that it cannot proliferate in both the MDCK and A549 cell lines I did.

1-6. 마우스에서의 병원성 비교1-6. Comparison of pathogenicity in mice

재조합 바이러스의 포유류 병원성을 확인하기 위해서, 실시예 1-2의 재조합 바이러스를 6주령 암컷 BALB/c 마우스(KOATEC, Pyeongtaek, Korea)에 각각 8마리씩 접종하였다. 접종 후 3일째에 3마리의 마우스의 폐를 샘플링하여 폐에서의 증식성을 비교하였고, 5마리의 2주간 체중변화를 관찰하였다. In order to confirm the mammalian pathogenicity of the recombinant virus, the recombinant virus of Example 1-2 was inoculated into 6-week-old female BALB/c mice (KOATEC, Pyeongtaek, Korea) each of 8 mice. On the 3rd day after inoculation, lungs of 3 mice were sampled to compare the proliferative properties in the lungs, and weight change of 5 mice for 2 weeks was observed.

마우스를 Zoletil50(15mg/kg, Virbac, Carros, France)을 이용하여 진정시킨 후, 각 바이러스를 비강을 통해 106 EID50/0.1 ㎖의 용량으로 접종하였다. 2주간 체중 변화 관찰 기간 중에 20% 이상 체중 변화가 있는 경우 안락사하였다. 2주간 체중 변화와 생존율을 각각 도 3a 및 도 3b에 나타내었다(●: rH5N8, ■: rH5N8-hmH103Y, ▼: rH5N8-hmH103Y-310PB2, ○: rPR8, □: mock).Mice were sedated with Zoletil50 (15mg/kg, Virbac, Carros, France), and each virus was inoculated through the nasal cavity at a dose of 10 6 EID 50 /0.1 ml. Euthanasia was performed when there was a change in body weight of 20% or more during the 2-week body weight change observation period. The body weight change and survival rate for 2 weeks are shown in FIGS. 3A and 3B, respectively (●: rH5N8, ■: rH5N8-hmH103Y, ▼: rH5N8-hmH103Y-310PB2, ○: rPR8, □: mock).

3일째에는 각 그룹에서 3마리의 마우스 폐를 샘플링하여, TissueLyzer 2 (Qiagen, Valencia, CA, USA)로 직경 5 mm의 stainless steel beads와 폐 무게의 1/10만큼의 PBS를 넣고 유제하였다. 유제한 후, 13,000 rpm에 10분간 원심분리한 상층액을 10일령 발육란에 접종하여 바이러스 증식여부를 확인하였다. 3개의 샘플을 풀링한 뒤, 10진 희석하여 접종하여 EID50을 측정하고, 그 결과를 표 2에 나타내었다.On the third day, three mouse lungs were sampled from each group, and stainless steel beads of 5 mm in diameter and PBS of 1/10 of the weight of the lung were put and emulsion with TissueLyzer 2 (Qiagen, Valencia, CA, USA). After emulsification, the supernatant, centrifuged at 13,000 rpm for 10 minutes, was inoculated into 10-day-old embryonated eggs to confirm virus proliferation. Three samples were pooled, diluted in decimal and inoculated to measure EID 50 , and the results are shown in Table 2.

재조합 바이러스Recombinant virus 접종 3일째 마우스 폐에서의 바이러스 재분리율Virus re-isolation rate in mouse lung on day 3 of inoculation 접종 3일째 마우스 폐에서의 EID50/ml(log10) EID 50 /ml (log10) in mouse lungs on day 3 of inoculation rH5N8rH5N8 3/33/3 3.703.70 rH5N8-hmH103Y rH5N8-hmH103Y 3/33/3 4.504.50 rH5N8-hmH103Y-310PB2rH5N8-hmH103Y-310PB2 0/30/3 0.000.00 rPR8rPR8 3/33/3 7.257.25

도 3a 및 도 3b에 나타난 바와 같이, 모든 재조합 바이러스는 마우스에서의 체중변화 및 병원성을 보이지 않았다. 그러나, 표 2에 나타난 바와 같이, rH5N8과 rH5N8-hmH103Y의 폐에서 증식하였고, rH5N8-hmH103Y-310PB2는 폐에서도 증식하지 않아, 재조합 바이러스는 포유류에 대한 병원성이 제거되었음을 확인하였다.As shown in FIGS. 3A and 3B, all recombinant viruses showed no change in body weight and pathogenicity in mice. However, as shown in Table 2, rH5N8 and rH5N8-hmH103Y proliferated in the lungs, and rH5N8-hmH103Y-310PB2 did not proliferate in the lungs, confirming that the recombinant virus had eliminated pathogenicity to mammals.

1-7. 내열성 비교1-7. Heat resistance comparison

H103Y가 실제로 내열성을 높여, 발육란 및 포유류 세포주와 마우스에서의 증식성이 증가하는지 확인하였다.It was confirmed that H103Y actually increased the heat resistance and increased proliferation in embryonated eggs and mammalian cell lines and mice.

구체적으로, rH5N8과 rH5N8-hmH103Y 바이러스를 각각 50℃, 55℃, 및 60℃에서 30분간 처리한 후 HA 검사를 통하여 HA 역가를 측정하고, 그 결과를 도 4에 나타내었다.Specifically, the rH5N8 and rH5N8-hmH103Y viruses were treated at 50° C., 55° C., and 60° C. for 30 minutes, respectively, and then HA titers were measured through the HA test, and the results are shown in FIG. 4.

도 4에 나타난 바와 같이, rH5N8과 달리, rH5N8-hmH103Y의 경우 55℃까지도 HA 단백질이 안정하였다. 따라서, rH5N8-hmH103Y는 내열성을 높이는 것을 확인하였다.As shown in FIG. 4, unlike rH5N8, in the case of rH5N8-hmH103Y, the HA protein was stable up to 55°C. Therefore, it was confirmed that rH5N8-hmH103Y improves heat resistance.

생물자원센터Biological Resource Center KCTC14012BPKCTC14012BP 2019103020191030

<110> SEOUL NATIONAL UNIVERSITY R&DB Foundation <120> H5N8 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same <130> PN129937KR <160> 7 <170> KoPatentIn 3.0 <210> 1 <211> 566 <212> PRT <213> Artificial Sequence <220> <223> Hemagglutinin of influenza virus H5N8 strain <400> 1 Met Glu Lys Ile Val Leu Leu Leu Ala Ile Val Ser Leu Val Lys Ser 1 5 10 15 Asp Gln Ile Cys Ile Gly Tyr His Ala Asn Asn Ser Thr Lys Gln Val 20 25 30 Asp Thr Ile Met Glu Lys Asn Val Thr Val Thr His Ala Gln Asp Ile 35 40 45 Leu Glu Lys Thr His Asn Gly Lys Leu Cys Asp Leu Asn Gly Val Lys 50 55 60 Pro Leu Ile Leu Lys Asp Cys Ser Val Ala Gly Trp Leu Leu Gly Asn 65 70 75 80 Pro Met Cys Asp Glu Phe Ile Arg Val Pro Glu Trp Ser Tyr Ile Val 85 90 95 Glu Arg Ala Asn Pro Ala Asn Asp Leu Cys Tyr Pro Gly Thr Leu Asn 100 105 110 Asp Tyr Glu Glu Leu Lys His Leu Leu Ser Arg Ile Asn His Phe Glu 115 120 125 Lys Ile Leu Ile Ile Pro Lys Ser Ser Trp Pro Asn His Glu Thr Ser 130 135 140 Leu Gly Val Ser Ala Ala Cys Pro Tyr Gln Gly Ala Ser Ser Phe Phe 145 150 155 160 Arg Asn Val Val Trp Leu Ile Lys Lys Asn Asp Ala Tyr Pro Thr Ile 165 170 175 Lys Ile Ser Tyr Asn Asn Thr Asn Arg Glu Asp Leu Leu Ile Leu Trp 180 185 190 Gly Ile His His Ser Asn Asn Ala Ala Glu Gln Thr Asn Leu Tyr Lys 195 200 205 Asn Pro Asn Thr Tyr Val Ser Val Gly Thr Ser Thr Leu Asn Gln Arg 210 215 220 Leu Val Pro Lys Ile Ala Thr Arg Ser Gln Val Asn Gly Gln Arg Gly 225 230 235 240 Arg Met Asp Phe Phe Trp Thr Ile Leu Lys Pro Asn Asp Ala Ile His 245 250 255 Phe Glu Ser Asn Gly Asn Phe Ile Ala Pro Glu Tyr Ala Tyr Lys Ile 260 265 270 Val Lys Lys Gly Asp Ser Thr Ile Met Lys Ser Glu Val Glu Tyr Gly 275 280 285 His Cys Asn Thr Lys Cys Gln Thr Pro Ile Gly Ala Ile Asn Ser Ser 290 295 300 Met Pro Phe His Asn Ile His Pro Leu Thr Ile Gly Glu Cys Pro Lys 305 310 315 320 Tyr Val Lys Ser Asn Lys Leu Val Leu Ala Thr Gly Leu Arg Asn Ser 325 330 335 Pro Leu Arg Glu Arg Arg Arg Lys Gly Leu Phe Gly Ala Ile Ala Gly 340 345 350 Phe Ile Glu Gly Gly Trp Gln Gly Met Val Asp Gly Trp Tyr Gly Tyr 355 360 365 His His Ser Asn Glu Gln Gly Ser Gly Tyr Ala Ala Asp Lys Glu Ser 370 375 380 Thr Gln Lys Ala Ile Asp Gly Val Thr Asn Lys Val Asn Ser Ile Ile 385 390 395 400 Asp Lys Met Asn Thr Gln Phe Glu Ala Val Gly Arg Glu Phe Asn Asn 405 410 415 Leu Glu Arg Arg Ile Glu Asn Leu Asn Lys Lys Met Glu Asp Gly Phe 420 425 430 Leu Asp Val Trp Thr Tyr Asn Ala Glu Leu Leu Val Leu Met Glu Asn 435 440 445 Glu Arg Thr Leu Asp Phe His Asp Ser Asn Val Lys Asn Leu Tyr Asp 450 455 460 Lys Val Arg Leu Gln Leu Arg Asp Asn Ala Lys Glu Leu Gly Asn Gly 465 470 475 480 Cys Phe Glu Phe Tyr His Lys Cys Asp Asn Glu Cys Met Glu Ser Val 485 490 495 Arg Asn Gly Thr Tyr Asp Tyr Pro Gln Tyr Ser Glu Glu Ala Arg Leu 500 505 510 Lys Arg Glu Glu Ile Ser Gly Val Lys Leu Glu Ser Ile Gly Thr Tyr 515 520 525 Gln Ile Leu Ser Ile Tyr Ser Thr Val Ala Ser Ser Leu Ala Leu Ala 530 535 540 Ile Met Val Ala Gly Leu Ser Leu Trp Met Cys Ser Asn Gly Ser Leu 545 550 555 560 Gln Cys Arg Ile Cys Ile 565 <210> 2 <211> 564 <212> PRT <213> Artificial Sequence <220> <223> Mutant HA-H103Y of hemagglutinin of influenza virus H5N8 strain <400> 2 Met Glu Lys Ile Val Leu Leu Leu Ala Ile Val Ser Leu Val Lys Ser 1 5 10 15 Asp Gln Ile Cys Ile Gly Tyr His Ala Asn Asn Ser Thr Lys Gln Val 20 25 30 Asp Thr Ile Met Glu Lys Asn Val Thr Val Thr His Ala Gln Asp Ile 35 40 45 Leu Glu Lys Thr His Asn Gly Lys Leu Cys Asp Leu Asn Gly Val Lys 50 55 60 Pro Leu Ile Leu Lys Asp Cys Ser Val Ala Gly Trp Leu Leu Gly Asn 65 70 75 80 Pro Met Cys Asp Glu Phe Ile Arg Val Pro Glu Trp Ser Tyr Ile Val 85 90 95 Glu Arg Ala Asn Pro Ala Asn Asp Leu Cys Tyr Pro Gly Thr Leu Asn 100 105 110 Asp Tyr Glu Glu Leu Lys Tyr Leu Leu Ser Arg Ile Asn His Phe Glu 115 120 125 Lys Ile Leu Ile Ile Pro Lys Ser Ser Trp Pro Asn His Glu Thr Ser 130 135 140 Leu Gly Val Ser Ala Ala Cys Pro Tyr Gln Gly Ala Ser Ser Phe Phe 145 150 155 160 Arg Asn Val Val Trp Leu Ile Lys Lys Asn Asp Ala Tyr Pro Thr Ile 165 170 175 Lys Ile Ser Tyr Asn Asn Thr Asn Arg Glu Asp Leu Leu Ile Leu Trp 180 185 190 Gly Ile His His Ser Asn Asn Ala Ala Glu Gln Thr Asn Leu Tyr Lys 195 200 205 Asn Pro Asn Thr Tyr Val Ser Val Gly Thr Ser Thr Leu Asn Gln Arg 210 215 220 Leu Val Pro Lys Ile Ala Thr Arg Ser Gln Val Asn Gly Gln Arg Gly 225 230 235 240 Arg Met Asp Phe Phe Trp Thr Ile Leu Lys Pro Asn Asp Ala Ile His 245 250 255 Phe Glu Ser Asn Gly Asn Phe Ile Ala Pro Glu Tyr Ala Tyr Lys Ile 260 265 270 Val Lys Lys Gly Asp Ser Thr Ile Met Lys Ser Glu Val Glu Tyr Gly 275 280 285 His Cys Asn Thr Lys Cys Gln Thr Pro Ile Gly Ala Ile Asn Ser Ser 290 295 300 Met Pro Phe His Asn Ile His Pro Leu Thr Ile Gly Glu Cys Pro Lys 305 310 315 320 Tyr Val Lys Ser Asn Lys Leu Val Leu Ala Thr Gly Leu Arg Asn Ser 325 330 335 Pro Leu Ala Ser Gly Arg Gly Leu Phe Gly Ala Ile Ala Gly Phe Ile 340 345 350 Glu Gly Gly Trp Gln Gly Met Val Asp Gly Trp Tyr Gly Tyr His His 355 360 365 Ser Asn Glu Gln Gly Ser Gly Tyr Ala Ala Asp Lys Glu Ser Thr Gln 370 375 380 Lys Ala Ile Asp Gly Val Thr Asn Lys Val Asn Ser Ile Ile Asp Lys 385 390 395 400 Met Asn Thr Gln Phe Glu Ala Val Gly Arg Glu Phe Asn Asn Leu Glu 405 410 415 Arg Arg Ile Glu Asn Leu Asn Lys Lys Met Glu Asp Gly Phe Leu Asp 420 425 430 Val Trp Thr Tyr Asn Ala Glu Leu Leu Val Leu Met Glu Asn Glu Arg 435 440 445 Thr Leu Asp Phe His Asp Ser Asn Val Lys Asn Leu Tyr Asp Lys Val 450 455 460 Arg Leu Gln Leu Arg Asp Asn Ala Lys Glu Leu Gly Asn Gly Cys Phe 465 470 475 480 Glu Phe Tyr His Lys Cys Asp Asn Glu Cys Met Glu Ser Val Arg Asn 485 490 495 Gly Thr Tyr Asp Tyr Pro Gln Tyr Ser Glu Glu Ala Arg Leu Lys Arg 500 505 510 Glu Glu Ile Ser Gly Val Lys Leu Glu Ser Ile Gly Thr Tyr Gln Ile 515 520 525 Leu Ser Ile Tyr Ser Thr Val Ala Ser Ser Leu Ala Leu Ala Ile Met 530 535 540 Val Ala Gly Leu Ser Leu Trp Met Cys Ser Asn Gly Ser Leu Gln Cys 545 550 555 560 Arg Ile Cys Ile <210> 3 <211> 470 <212> PRT <213> Artificial Sequence <220> <223> Neuraminidase of influenza virus H5N8 strain <400> 3 Met Asn Pro Asn Gln Lys Ile Val Thr Ile Gly Ser Ile Ser Leu Gly 1 5 10 15 Leu Val Val Phe Asn Val Leu Leu His Ala Val Ser Ile Ile Leu Thr 20 25 30 Val Leu Ala Leu Gly Lys Ser Glu Asn Asn Gly Ile Cys Asn Gly Thr 35 40 45 Val Val Arg Glu Tyr Asn Glu Thr Val Arg Ile Glu Lys Val Thr Gln 50 55 60 Trp Tyr Asn Thr Ser Val Val Glu Tyr Val Pro His Trp Asn Glu Gly 65 70 75 80 Thr Tyr Ile Asn Asn Thr Glu Pro Ile Cys Asp Val Lys Gly Phe Ala 85 90 95 Pro Phe Ser Lys Asp Asn Gly Ile Arg Val Gly Ser Arg Gly His Ile 100 105 110 Phe Val Ile Arg Glu Pro Phe Val Ser Cys Ser Pro Val Glu Cys Arg 115 120 125 Thr Phe Phe Leu Thr Gln Gly Ser Leu Leu Asn Asp Lys His Ser Asn 130 135 140 Gly Thr Val Lys Asp Arg Ser Pro Phe Arg Thr Leu Met Ser Val Glu 145 150 155 160 Val Gly Gln Ser Pro Asn Val Tyr Gln Ala Arg Phe Glu Ala Val Ala 165 170 175 Trp Ser Ala Thr Ala Cys His Asp Gly Lys Lys Trp Met Thr Ile Gly 180 185 190 Val Thr Gly Pro Asp Ser Lys Ala Val Ala Val Val His Tyr Gly Gly 195 200 205 Val Pro Thr Asp Val Val Asn Ser Trp Ala Gly Asp Ile Leu Arg Thr 210 215 220 Gln Glu Ser Ser Cys Thr Cys Ile Gln Gly Asn Cys Tyr Trp Val Met 225 230 235 240 Thr Asp Gly Pro Ala Asn Arg Gln Ala Gln Tyr Arg Ile Tyr Lys Ala 245 250 255 Asn Gln Gly Lys Ile Ile Gly Gln Thr Asp Val Ser Phe Ser Gly Gly 260 265 270 His Ile Glu Glu Cys Ser Cys Tyr Pro Asn Asp Gly Lys Val Glu Cys 275 280 285 Val Cys Arg Asp Asn Trp Thr Gly Thr Asn Arg Pro Val Leu Val Ile 290 295 300 Ser Pro Asp Leu Ser Tyr Arg Val Gly Tyr Leu Cys Ala Gly Leu Pro 305 310 315 320 Ser Asp Thr Pro Arg Gly Glu Asp Thr Gln Phe Val Gly Ser Cys Thr 325 330 335 Ser Pro Met Gly Asn Gln Gly Tyr Gly Val Lys Gly Phe Gly Phe Arg 340 345 350 Gln Gly Thr Asp Val Trp Val Gly Arg Thr Ile Ser Arg Thr Ser Arg 355 360 365 Ser Gly Phe Glu Ile Ile Arg Ile Lys Asn Gly Trp Thr Gln Thr Ser 370 375 380 Lys Glu Gln Ile Arg Arg Gln Val Val Val Asp Asn Leu Asn Trp Ser 385 390 395 400 Gly Tyr Ser Gly Ser Phe Thr Leu Pro Val Glu Leu Ser Gly Arg Glu 405 410 415 Cys Leu Val Pro Cys Phe Trp Val Glu Met Ile Arg Gly Arg Pro Glu 420 425 430 Glu Arg Thr Ile Trp Thr Ser Ser Ser Ser Ile Val Met Cys Gly Val 435 440 445 Asp Tyr Glu Ile Ala Asp Trp Ser Trp His Asp Gly Ala Ile Leu Pro 450 455 460 Phe Asp Ile Asp Lys Met 465 470 <210> 4 <211> 759 <212> PRT <213> Artificial Sequence <220> <223> Polymerase subunit B2 of influenza virus 01310 strain <400> 4 Met Glu Arg Ile Lys Glu Leu Arg Asp Leu Met Ser Gln Ser Arg Thr 1 5 10 15 Arg Glu Ile Leu Thr Lys Thr Thr Val Asp His Met Ala Ile Ile Lys 20 25 30 Lys Tyr Thr Ser Gly Arg Gln Glu Lys Asn Pro Ala Leu Arg Met Lys 35 40 45 Trp Met Met Ala Met Lys Tyr Pro Ile Thr Ala Asp Lys Arg Ile Met 50 55 60 Glu Ile Ile Pro Glu Arg Asn Glu Gln Gly Gln Thr Leu Trp Ser Lys 65 70 75 80 Thr Asn Asp Ala Gly Ser Asp Lys Val Met Val Ser Pro Leu Ala Val 85 90 95 Thr Trp Trp Asn Arg Asn Gly Pro Thr Thr Ser Thr Ile His Tyr Pro 100 105 110 Lys Val Tyr Lys Thr Tyr Phe Glu Lys Val Glu Arg Leu Lys His Gly 115 120 125 Thr Phe Gly Pro Ile His Phe Arg Asn Gln Val Lys Ile Arg Arg Arg 130 135 140 Val Asp Ile Asn Pro Gly His Ala Asp Leu Ser Ala Arg Glu Ala Gln 145 150 155 160 Asp Val Ile Met Glu Val Val Phe Pro Asn Glu Val Gly Ala Arg Ile 165 170 175 Leu Thr Ser Glu Ser Gln Leu Thr Ile Thr Lys Glu Lys Lys Glu Glu 180 185 190 Leu Gln Asp Cys Lys Ile Ala Pro Leu Met Val Ala Tyr Met Leu Glu 195 200 205 Arg Glu Leu Val Arg Lys Thr Arg Phe Leu Pro Val Ala Gly Gly Thr 210 215 220 Ser Ser Val Tyr Ile Glu Val Leu His Leu Thr Gln Gly Thr Cys Trp 225 230 235 240 Glu Gln Met Tyr Thr Pro Gly Gly Glu Val Arg Asn Asp Asp Val Asp 245 250 255 Gln Ser Leu Ile Ile Ala Ala Arg Asn Ile Val Arg Arg Ala Thr Val 260 265 270 Ser Ala Asp Pro Leu Ala Ser Leu Leu Glu Met Cys His Gly Thr Gln 275 280 285 Ile Gly Gly Ile Arg Met Val Asp Ile Leu Arg Gln Asn Pro Thr Glu 290 295 300 Glu Gln Ala Val Asp Ile Cys Lys Ala Ala Ile Gly Leu Arg Ile Ser 305 310 315 320 Ser Ser Phe Ser Phe Gly Gly Phe Thr Phe Lys Arg Thr Ser Gly Ser 325 330 335 Ser Val Lys Lys Glu Glu Glu Val Leu Thr Gly Asn Leu Gln Thr Leu 340 345 350 Lys Ile Arg Val His Glu Gly Tyr Glu Glu Phe Thr Met Val Gly Arg 355 360 365 Arg Ala Thr Ala Leu Leu Arg Lys Ala Thr Arg Arg Leu Ile Gln Leu 370 375 380 Ile Val Ser Gly Arg Asp Glu Gln Ser Ile Ala Glu Ala Ile Ile Val 385 390 395 400 Ala Met Val Phe Ser Gln Glu Asp Cys Met Ile Lys Ala Val Arg Gly 405 410 415 Asp Leu Asn Phe Val Asn Arg Ala Asn Gln Arg Leu Asn Pro Met His 420 425 430 Gln Leu Leu Arg His Phe Gln Lys Asp Ala Lys Val Leu Phe Gln Asn 435 440 445 Trp Gly Ile Glu Pro Ile Asp Asn Val Met Gly Met Ile Gly Ile Leu 450 455 460 Pro Asp Met Thr Pro Ser Thr Glu Met Ser Leu Arg Gly Val Arg Val 465 470 475 480 Ser Lys Met Gly Val Asp Glu Tyr Ser Ser Thr Glu Arg Val Val Val 485 490 495 Ser Ile Asp Arg Phe Leu Arg Val Arg Asp Gln Arg Gly Asn Ile Leu 500 505 510 Leu Ser Pro Glu Glu Val Ser Glu Thr Gln Gly Thr Glu Lys Leu Thr 515 520 525 Ile Thr Tyr Ser Ser Ser Met Met Trp Glu Ile Asn Gly Pro Glu Ser 530 535 540 Val Leu Val Asn Thr Tyr Gln Trp Ile Ile Arg Asn Trp Glu Thr Val 545 550 555 560 Lys Ile Gln Trp Ser Gln Asp Pro Thr Met Leu Tyr Asn Lys Val Glu 565 570 575 Phe Glu Pro Phe Gln Ser Leu Val Pro Lys Ala Ala Arg Gly Gln Tyr 580 585 590 Ser Gly Phe Val Arg Thr Leu Phe Gln Gln Met Arg Asp Val Leu Gly 595 600 605 Thr Phe Asp Thr Val Gln Ile Ile Lys Leu Leu Pro Phe Ala Ala Ala 610 615 620 Pro Pro Glu Gln Ser Arg Met Gln Phe Ser Ser Leu Thr Val Asn Val 625 630 635 640 Arg Gly Ser Gly Met Arg Ile Leu Val Arg Gly Asn Ser Pro Val Phe 645 650 655 Asn Tyr Asn Lys Ala Thr Lys Arg Leu Thr Val Leu Gly Lys Asp Ala 660 665 670 Gly Ala Leu Thr Glu Asp Pro Asp Glu Gly Thr Ala Gly Val Glu Ser 675 680 685 Ala Val Leu Arg Gly Phe Leu Ile Leu Gly Lys Glu Asp Lys Arg Tyr 690 695 700 Gly Pro Ala Leu Ser Ile Asn Glu Leu Ser Asn Leu Ala Lys Gly Glu 705 710 715 720 Lys Ala Asn Val Leu Ile Gly Gln Gly Asp Val Val Leu Val Met Lys 725 730 735 Arg Lys Arg Asp Ser Ser Ile Leu Thr Asp Ser Gln Thr Ala Thr Lys 740 745 750 Arg Ile Arg Met Ala Ile Asn 755 <210> 5 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> Cleavage site in hemagglutinin protein of influenza virus H5N8 strain <400> 5 Arg Glu Arg Arg Arg Lys 1 5 <210> 6 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> Cleavage site in hemagglutinin protein of influenza virus H5N8 strain <400> 6 Arg Glu Lys Arg Arg Lys 1 5 <210> 7 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> Cleavage site in hemagglutinin protein of influenza virus H5N8 strain <400> 7 Arg Lys Arg Lys Lys 1 5 <110> SEOUL NATIONAL UNIVERSITY R&DB Foundation <120> H5N8 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same <130> PN129937KR <160> 7 <170> KoPatentIn 3.0 <210> 1 <211> 566 <212> PRT <213> Artificial Sequence <220> <223> Hemagglutinin of influenza virus H5N8 strain <400> 1 Met Glu Lys Ile Val Leu Leu Leu Ala Ile Val Ser Leu Val Lys Ser 1 5 10 15 Asp Gln Ile Cys Ile Gly Tyr His Ala Asn Asn Ser Thr Lys Gln Val 20 25 30 Asp Thr Ile Met Glu Lys Asn Val Thr Val Thr His Ala Gln Asp Ile 35 40 45 Leu Glu Lys Thr His Asn Gly Lys Leu Cys Asp Leu Asn Gly Val Lys 50 55 60 Pro Leu Ile Leu Lys Asp Cys Ser Val Ala Gly Trp Leu Leu Gly Asn 65 70 75 80 Pro Met Cys Asp Glu Phe Ile Arg Val Pro Glu Trp Ser Tyr Ile Val 85 90 95 Glu Arg Ala Asn Pro Ala Asn Asp Leu Cys Tyr Pro Gly Thr Leu Asn 100 105 110 Asp Tyr Glu Glu Leu Lys His Leu Leu Ser Arg Ile Asn His Phe Glu 115 120 125 Lys Ile Leu Ile Ile Pro Lys Ser Ser Trp Pro Asn His Glu Thr Ser 130 135 140 Leu Gly Val Ser Ala Ala Cys Pro Tyr Gln Gly Ala Ser Ser Phe Phe 145 150 155 160 Arg Asn Val Val Trp Leu Ile Lys Lys Asn Asp Ala Tyr Pro Thr Ile 165 170 175 Lys Ile Ser Tyr Asn Asn Thr Asn Arg Glu Asp Leu Leu Ile Leu Trp 180 185 190 Gly Ile His His Ser Asn Asn Ala Ala Glu Gln Thr Asn Leu Tyr Lys 195 200 205 Asn Pro Asn Thr Tyr Val Ser Val Gly Thr Ser Thr Leu Asn Gln Arg 210 215 220 Leu Val Pro Lys Ile Ala Thr Arg Ser Gln Val Asn Gly Gln Arg Gly 225 230 235 240 Arg Met Asp Phe Phe Trp Thr Ile Leu Lys Pro Asn Asp Ala Ile His 245 250 255 Phe Glu Ser Asn Gly Asn Phe Ile Ala Pro Glu Tyr Ala Tyr Lys Ile 260 265 270 Val Lys Lys Gly Asp Ser Thr Ile Met Lys Ser Glu Val Glu Tyr Gly 275 280 285 His Cys Asn Thr Lys Cys Gln Thr Pro Ile Gly Ala Ile Asn Ser Ser 290 295 300 Met Pro Phe His Asn Ile His Pro Leu Thr Ile Gly Glu Cys Pro Lys 305 310 315 320 Tyr Val Lys Ser Asn Lys Leu Val Leu Ala Thr Gly Leu Arg Asn Ser 325 330 335 Pro Leu Arg Glu Arg Arg Arg Lys Gly Leu Phe Gly Ala Ile Ala Gly 340 345 350 Phe Ile Glu Gly Gly Trp Gln Gly Met Val Asp Gly Trp Tyr Gly Tyr 355 360 365 His His Ser Asn Glu Gln Gly Ser Gly Tyr Ala Ala Asp Lys Glu Ser 370 375 380 Thr Gln Lys Ala Ile Asp Gly Val Thr Asn Lys Val Asn Ser Ile Ile 385 390 395 400 Asp Lys Met Asn Thr Gln Phe Glu Ala Val Gly Arg Glu Phe Asn Asn 405 410 415 Leu Glu Arg Arg Ile Glu Asn Leu Asn Lys Lys Met Glu Asp Gly Phe 420 425 430 Leu Asp Val Trp Thr Tyr Asn Ala Glu Leu Leu Val Leu Met Glu Asn 435 440 445 Glu Arg Thr Leu Asp Phe His Asp Ser Asn Val Lys Asn Leu Tyr Asp 450 455 460 Lys Val Arg Leu Gln Leu Arg Asp Asn Ala Lys Glu Leu Gly Asn Gly 465 470 475 480 Cys Phe Glu Phe Tyr His Lys Cys Asp Asn Glu Cys Met Glu Ser Val 485 490 495 Arg Asn Gly Thr Tyr Asp Tyr Pro Gln Tyr Ser Glu Glu Ala Arg Leu 500 505 510 Lys Arg Glu Glu Ile Ser Gly Val Lys Leu Glu Ser Ile Gly Thr Tyr 515 520 525 Gln Ile Leu Ser Ile Tyr Ser Thr Val Ala Ser Ser Leu Ala Leu Ala 530 535 540 Ile Met Val Ala Gly Leu Ser Leu Trp Met Cys Ser Asn Gly Ser Leu 545 550 555 560 Gln Cys Arg Ile Cys Ile 565 <210> 2 <211> 564 <212> PRT <213> Artificial Sequence <220> <223> Mutant HA-H103Y of hemagglutinin of influenza virus H5N8 strain <400> 2 Met Glu Lys Ile Val Leu Leu Leu Ala Ile Val Ser Leu Val Lys Ser 1 5 10 15 Asp Gln Ile Cys Ile Gly Tyr His Ala Asn Asn Ser Thr Lys Gln Val 20 25 30 Asp Thr Ile Met Glu Lys Asn Val Thr Val Thr His Ala Gln Asp Ile 35 40 45 Leu Glu Lys Thr His Asn Gly Lys Leu Cys Asp Leu Asn Gly Val Lys 50 55 60 Pro Leu Ile Leu Lys Asp Cys Ser Val Ala Gly Trp Leu Leu Gly Asn 65 70 75 80 Pro Met Cys Asp Glu Phe Ile Arg Val Pro Glu Trp Ser Tyr Ile Val 85 90 95 Glu Arg Ala Asn Pro Ala Asn Asp Leu Cys Tyr Pro Gly Thr Leu Asn 100 105 110 Asp Tyr Glu Glu Leu Lys Tyr Leu Leu Ser Arg Ile Asn His Phe Glu 115 120 125 Lys Ile Leu Ile Ile Pro Lys Ser Ser Trp Pro Asn His Glu Thr Ser 130 135 140 Leu Gly Val Ser Ala Ala Cys Pro Tyr Gln Gly Ala Ser Ser Phe Phe 145 150 155 160 Arg Asn Val Val Trp Leu Ile Lys Lys Asn Asp Ala Tyr Pro Thr Ile 165 170 175 Lys Ile Ser Tyr Asn Asn Thr Asn Arg Glu Asp Leu Leu Ile Leu Trp 180 185 190 Gly Ile His His Ser Asn Asn Ala Ala Glu Gln Thr Asn Leu Tyr Lys 195 200 205 Asn Pro Asn Thr Tyr Val Ser Val Gly Thr Ser Thr Leu Asn Gln Arg 210 215 220 Leu Val Pro Lys Ile Ala Thr Arg Ser Gln Val Asn Gly Gln Arg Gly 225 230 235 240 Arg Met Asp Phe Phe Trp Thr Ile Leu Lys Pro Asn Asp Ala Ile His 245 250 255 Phe Glu Ser Asn Gly Asn Phe Ile Ala Pro Glu Tyr Ala Tyr Lys Ile 260 265 270 Val Lys Lys Gly Asp Ser Thr Ile Met Lys Ser Glu Val Glu Tyr Gly 275 280 285 His Cys Asn Thr Lys Cys Gln Thr Pro Ile Gly Ala Ile Asn Ser Ser 290 295 300 Met Pro Phe His Asn Ile His Pro Leu Thr Ile Gly Glu Cys Pro Lys 305 310 315 320 Tyr Val Lys Ser Asn Lys Leu Val Leu Ala Thr Gly Leu Arg Asn Ser 325 330 335 Pro Leu Ala Ser Gly Arg Gly Leu Phe Gly Ala Ile Ala Gly Phe Ile 340 345 350 Glu Gly Gly Trp Gln Gly Met Val Asp Gly Trp Tyr Gly Tyr His His 355 360 365 Ser Asn Glu Gln Gly Ser Gly Tyr Ala Ala Asp Lys Glu Ser Thr Gln 370 375 380 Lys Ala Ile Asp Gly Val Thr Asn Lys Val Asn Ser Ile Ile Asp Lys 385 390 395 400 Met Asn Thr Gln Phe Glu Ala Val Gly Arg Glu Phe Asn Asn Leu Glu 405 410 415 Arg Arg Ile Glu Asn Leu Asn Lys Lys Met Glu Asp Gly Phe Leu Asp 420 425 430 Val Trp Thr Tyr Asn Ala Glu Leu Leu Val Leu Met Glu Asn Glu Arg 435 440 445 Thr Leu Asp Phe His Asp Ser Asn Val Lys Asn Leu Tyr Asp Lys Val 450 455 460 Arg Leu Gln Leu Arg Asp Asn Ala Lys Glu Leu Gly Asn Gly Cys Phe 465 470 475 480 Glu Phe Tyr His Lys Cys Asp Asn Glu Cys Met Glu Ser Val Arg Asn 485 490 495 Gly Thr Tyr Asp Tyr Pro Gln Tyr Ser Glu Glu Ala Arg Leu Lys Arg 500 505 510 Glu Glu Ile Ser Gly Val Lys Leu Glu Ser Ile Gly Thr Tyr Gln Ile 515 520 525 Leu Ser Ile Tyr Ser Thr Val Ala Ser Ser Leu Ala Leu Ala Ile Met 530 535 540 Val Ala Gly Leu Ser Leu Trp Met Cys Ser Asn Gly Ser Leu Gln Cys 545 550 555 560 Arg Ile Cys Ile <210> 3 <211> 470 <212> PRT <213> Artificial Sequence <220> <223> Neuraminidase of influenza virus H5N8 strain <400> 3 Met Asn Pro Asn Gln Lys Ile Val Thr Ile Gly Ser Ile Ser Leu Gly 1 5 10 15 Leu Val Val Phe Asn Val Leu Leu His Ala Val Ser Ile Ile Leu Thr 20 25 30 Val Leu Ala Leu Gly Lys Ser Glu Asn Asn Gly Ile Cys Asn Gly Thr 35 40 45 Val Val Arg Glu Tyr Asn Glu Thr Val Arg Ile Glu Lys Val Thr Gln 50 55 60 Trp Tyr Asn Thr Ser Val Val Glu Tyr Val Pro His Trp Asn Glu Gly 65 70 75 80 Thr Tyr Ile Asn Asn Thr Glu Pro Ile Cys Asp Val Lys Gly Phe Ala 85 90 95 Pro Phe Ser Lys Asp Asn Gly Ile Arg Val Gly Ser Arg Gly His Ile 100 105 110 Phe Val Ile Arg Glu Pro Phe Val Ser Cys Ser Pro Val Glu Cys Arg 115 120 125 Thr Phe Phe Leu Thr Gln Gly Ser Leu Leu Asn Asp Lys His Ser Asn 130 135 140 Gly Thr Val Lys Asp Arg Ser Pro Phe Arg Thr Leu Met Ser Val Glu 145 150 155 160 Val Gly Gln Ser Pro Asn Val Tyr Gln Ala Arg Phe Glu Ala Val Ala 165 170 175 Trp Ser Ala Thr Ala Cys His Asp Gly Lys Lys Trp Met Thr Ile Gly 180 185 190 Val Thr Gly Pro Asp Ser Lys Ala Val Ala Val Val His Tyr Gly Gly 195 200 205 Val Pro Thr Asp Val Val Asn Ser Trp Ala Gly Asp Ile Leu Arg Thr 210 215 220 Gln Glu Ser Ser Cys Thr Cys Ile Gln Gly Asn Cys Tyr Trp Val Met 225 230 235 240 Thr Asp Gly Pro Ala Asn Arg Gln Ala Gln Tyr Arg Ile Tyr Lys Ala 245 250 255 Asn Gln Gly Lys Ile Ile Gly Gln Thr Asp Val Ser Phe Ser Gly Gly 260 265 270 His Ile Glu Glu Cys Ser Cys Tyr Pro Asn Asp Gly Lys Val Glu Cys 275 280 285 Val Cys Arg Asp Asn Trp Thr Gly Thr Asn Arg Pro Val Leu Val Ile 290 295 300 Ser Pro Asp Leu Ser Tyr Arg Val Gly Tyr Leu Cys Ala Gly Leu Pro 305 310 315 320 Ser Asp Thr Pro Arg Gly Glu Asp Thr Gln Phe Val Gly Ser Cys Thr 325 330 335 Ser Pro Met Gly Asn Gln Gly Tyr Gly Val Lys Gly Phe Gly Phe Arg 340 345 350 Gln Gly Thr Asp Val Trp Val Gly Arg Thr Ile Ser Arg Thr Ser Arg 355 360 365 Ser Gly Phe Glu Ile Ile Arg Ile Lys Asn Gly Trp Thr Gln Thr Ser 370 375 380 Lys Glu Gln Ile Arg Arg Gln Val Val Val Val Asp Asn Leu Asn Trp Ser 385 390 395 400 Gly Tyr Ser Gly Ser Phe Thr Leu Pro Val Glu Leu Ser Gly Arg Glu 405 410 415 Cys Leu Val Pro Cys Phe Trp Val Glu Met Ile Arg Gly Arg Pro Glu 420 425 430 Glu Arg Thr Ile Trp Thr Ser Ser Ser Ser Ile Val Met Cys Gly Val 435 440 445 Asp Tyr Glu Ile Ala Asp Trp Ser Trp His Asp Gly Ala Ile Leu Pro 450 455 460 Phe Asp Ile Asp Lys Met 465 470 <210> 4 <211> 759 <212> PRT <213> Artificial Sequence <220> <223> Polymerase subunit B2 of influenza virus 01310 strain <400> 4 Met Glu Arg Ile Lys Glu Leu Arg Asp Leu Met Ser Gln Ser Arg Thr 1 5 10 15 Arg Glu Ile Leu Thr Lys Thr Thr Val Asp His Met Ala Ile Ile Lys 20 25 30 Lys Tyr Thr Ser Gly Arg Gln Glu Lys Asn Pro Ala Leu Arg Met Lys 35 40 45 Trp Met Met Ala Met Lys Tyr Pro Ile Thr Ala Asp Lys Arg Ile Met 50 55 60 Glu Ile Ile Pro Glu Arg Asn Glu Gln Gly Gln Thr Leu Trp Ser Lys 65 70 75 80 Thr Asn Asp Ala Gly Ser Asp Lys Val Met Val Ser Pro Leu Ala Val 85 90 95 Thr Trp Trp Asn Arg Asn Gly Pro Thr Thr Ser Thr Ile His Tyr Pro 100 105 110 Lys Val Tyr Lys Thr Tyr Phe Glu Lys Val Glu Arg Leu Lys His Gly 115 120 125 Thr Phe Gly Pro Ile His Phe Arg Asn Gln Val Lys Ile Arg Arg Arg 130 135 140 Val Asp Ile Asn Pro Gly His Ala Asp Leu Ser Ala Arg Glu Ala Gln 145 150 155 160 Asp Val Ile Met Glu Val Val Phe Pro Asn Glu Val Gly Ala Arg Ile 165 170 175 Leu Thr Ser Glu Ser Gln Leu Thr Ile Thr Lys Glu Lys Lys Glu Glu 180 185 190 Leu Gln Asp Cys Lys Ile Ala Pro Leu Met Val Ala Tyr Met Leu Glu 195 200 205 Arg Glu Leu Val Arg Lys Thr Arg Phe Leu Pro Val Ala Gly Gly Thr 210 215 220 Ser Ser Val Tyr Ile Glu Val Leu His Leu Thr Gln Gly Thr Cys Trp 225 230 235 240 Glu Gln Met Tyr Thr Pro Gly Gly Glu Val Arg Asn Asp Asp Val Asp 245 250 255 Gln Ser Leu Ile Ile Ala Ala Arg Asn Ile Val Arg Arg Ala Thr Val 260 265 270 Ser Ala Asp Pro Leu Ala Ser Leu Leu Glu Met Cys His Gly Thr Gln 275 280 285 Ile Gly Gly Ile Arg Met Val Asp Ile Leu Arg Gln Asn Pro Thr Glu 290 295 300 Glu Gln Ala Val Asp Ile Cys Lys Ala Ala Ile Gly Leu Arg Ile Ser 305 310 315 320 Ser Ser Phe Ser Phe Gly Gly Phe Thr Phe Lys Arg Thr Ser Gly Ser 325 330 335 Ser Val Lys Lys Glu Glu Glu Val Leu Thr Gly Asn Leu Gln Thr Leu 340 345 350 Lys Ile Arg Val His Glu Gly Tyr Glu Glu Phe Thr Met Val Gly Arg 355 360 365 Arg Ala Thr Ala Leu Leu Arg Lys Ala Thr Arg Arg Leu Ile Gln Leu 370 375 380 Ile Val Ser Gly Arg Asp Glu Gln Ser Ile Ala Glu Ala Ile Ile Val 385 390 395 400 Ala Met Val Phe Ser Gln Glu Asp Cys Met Ile Lys Ala Val Arg Gly 405 410 415 Asp Leu Asn Phe Val Asn Arg Ala Asn Gln Arg Leu Asn Pro Met His 420 425 430 Gln Leu Leu Arg His Phe Gln Lys Asp Ala Lys Val Leu Phe Gln Asn 435 440 445 Trp Gly Ile Glu Pro Ile Asp Asn Val Met Gly Met Ile Gly Ile Leu 450 455 460 Pro Asp Met Thr Pro Ser Thr Glu Met Ser Leu Arg Gly Val Arg Val 465 470 475 480 Ser Lys Met Gly Val Asp Glu Tyr Ser Ser Thr Glu Arg Val Val Val 485 490 495 Ser Ile Asp Arg Phe Leu Arg Val Arg Asp Gln Arg Gly Asn Ile Leu 500 505 510 Leu Ser Pro Glu Glu Val Ser Glu Thr Gln Gly Thr Glu Lys Leu Thr 515 520 525 Ile Thr Tyr Ser Ser Ser Met Met Trp Glu Ile Asn Gly Pro Glu Ser 530 535 540 Val Leu Val Asn Thr Tyr Gln Trp Ile Ile Arg Asn Trp Glu Thr Val 545 550 555 560 Lys Ile Gln Trp Ser Gln Asp Pro Thr Met Leu Tyr Asn Lys Val Glu 565 570 575 Phe Glu Pro Phe Gln Ser Leu Val Pro Lys Ala Ala Arg Gly Gln Tyr 580 585 590 Ser Gly Phe Val Arg Thr Leu Phe Gln Gln Met Arg Asp Val Leu Gly 595 600 605 Thr Phe Asp Thr Val Gln Ile Ile Lys Leu Leu Pro Phe Ala Ala Ala 610 615 620 Pro Pro Glu Gln Ser Arg Met Gln Phe Ser Ser Leu Thr Val Asn Val 625 630 635 640 Arg Gly Ser Gly Met Arg Ile Leu Val Arg Gly Asn Ser Pro Val Phe 645 650 655 Asn Tyr Asn Lys Ala Thr Lys Arg Leu Thr Val Leu Gly Lys Asp Ala 660 665 670 Gly Ala Leu Thr Glu Asp Pro Asp Glu Gly Thr Ala Gly Val Glu Ser 675 680 685 Ala Val Leu Arg Gly Phe Leu Ile Leu Gly Lys Glu Asp Lys Arg Tyr 690 695 700 Gly Pro Ala Leu Ser Ile Asn Glu Leu Ser Asn Leu Ala Lys Gly Glu 705 710 715 720 Lys Ala Asn Val Leu Ile Gly Gln Gly Asp Val Val Leu Val Met Lys 725 730 735 Arg Lys Arg Asp Ser Ser Ile Leu Thr Asp Ser Gln Thr Ala Thr Lys 740 745 750 Arg Ile Arg Met Ala Ile Asn 755 <210> 5 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> Cleavage site in hemagglutinin protein of influenza virus H5N8 strain <400> 5 Arg Glu Arg Arg Arg Lys 1 5 <210> 6 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> Cleavage site in hemagglutinin protein of influenza virus H5N8 strain <400> 6 Arg Glu Lys Arg Arg Lys 1 5 <210> 7 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> Cleavage site in hemagglutinin protein of influenza virus H5N8 strain <400> 7 Arg Lys Arg Lys Lys 1 5

Claims (14)

인플루엔자 바이러스 H5N8 스트레인의 헤마글루티닌(hemagglutinin: HA) 단백질로서,
상기 헤마글루티닌 단백질은 서열번호 1의 아미노산 서열에서 N 말단으로부터 103번째 아미노산이 돌연변이된 헤마글루티닌 단백질;
H5N8 스트레인의 뉴라미니다제(neuraminidase: NA);
저병원성 인플루엔자 바이러스의 중합효소 B2(polymerase subunit B2: PB2); 및
인플루엔자 바이러스 H1N1 스트레인의 중합효소 B1(polymerase subunit B1: PB1), 중합효소 A(polymerase subunit A: PA), 뉴클레오캡시드(nucleoprotein: NP), 매트릭스 단백질(matrix: M) 및 비구조적 단백질(nonstructural protein: NS)로 이루어진 군으로부터 선택된 하나 이상의 단백질을 포함하는 H5N8 재조합 인플루엔자 바이러스.As a hemagglutinin (HA) protein of the influenza virus H5N8 strain,
The hemagglutinin protein is a hemagglutinin protein in which the 103rd amino acid from the N terminal is mutated in the amino acid sequence of SEQ ID NO: 1;
Neuraminidase (NA) of the H5N8 strain;
Polymerase subunit B2 (PB2) of hypopathogenic influenza virus; And
Influenza virus H1N1 strain of polymerase B1 (polymerase subunit B1: PB1), polymerase A (polymerase subunit A: PA), nucleoprotein (NP), matrix protein (M), and nonstructural protein : NS) H5N8 recombinant influenza virus comprising one or more proteins selected from the group consisting of. 청구항 1에 있어서, 상기 헤마글루티닌 단백질은 서열번호 1의 아미노산 서열에서 N 말단으로부터 103번째 아미노산인 히스티딘(H)이 티로신(Y)로 돌연변이된 것인 H5N8 재조합 인플루엔자 바이러스.The H5N8 recombinant influenza virus according to claim 1, wherein the hemagglutinin protein has histidine (H), which is the 103rd amino acid from the N-terminus in the amino acid sequence of SEQ ID NO: 1, is mutated to tyrosine (Y). 청구항 1에 있어서, 상기 헤마글루티닌 단백질의 절단 부위(cleavage site)는 돌연변이된 것인 H5N8 재조합 인플루엔자 바이러스.The H5N8 recombinant influenza virus according to claim 1, wherein a cleavage site of the hemagglutinin protein is mutated. 청구항 3에 있어서, 상기 헤마글루티닌 단백질의 절단 부위는 N 말단으로부터 339번째 내지 345번째 아미노산 서열인 것인 H5N8 재조합 인플루엔자 바이러스.The H5N8 recombinant influenza virus according to claim 3, wherein the cleavage site of the hemagglutinin protein is an amino acid sequence from the 339th to the 345th from the N-terminal. 청구항 3에 있어서, 상기 헤마글루티닌 단백질의 절단 부위는 아미노산 서열 N-ASGR-C로 돌연변이된 것인 H5N8 재조합 인플루엔자 바이러스.The H5N8 recombinant influenza virus according to claim 3, wherein the cleavage site of the hemagglutinin protein is mutated to the amino acid sequence N-ASGR-C. 청구항 1에 있어서, 상기 헤마글루티닌 단백질의 HA2 도메인은 서열번호 1의 아미노산 서열에서 N 말단으로부터 498번째 아미노산인 아스파라긴(N)이 트레오닌(T)로 돌연변이된 것인 H5N8 재조합 인플루엔자 바이러스. The H5N8 recombinant influenza virus according to claim 1, wherein the HA2 domain of the hemagglutinin protein has asparagine (N), which is the 498th amino acid from the N-terminus in the amino acid sequence of SEQ ID NO: 1, is mutated to threonine (T). 청구항 1에 있어서, 저병원성 인플루엔자 바이러스는 저병원성 인플루엔자 바이러스 01310 스트레인인 것인 H5N8 재조합 인플루엔자 바이러스. The H5N8 recombinant influenza virus of claim 1, wherein the low pathogenic influenza virus is a low pathogenic influenza virus 01310 strain. 청구항 1에 있어서, 인플루엔자 바이러스 H1N1 스트레인은 A/Puerto Rico/8/34(PR8)인 것인 H5N8 재조합 인플루엔자 바이러스. The H5N8 recombinant influenza virus of claim 1, wherein the influenza virus H1N1 strain is A/Puerto Rico/8/34 (PR8). 청구항 1에 있어서, 기탁번호 KCTC14012BP로 기탁된 바이러스인 것인 H5N8 재조합 인플루엔자 바이러스.The H5N8 recombinant influenza virus according to claim 1, which is a virus deposited with accession number KCTC14012BP. 인플루엔자 바이러스 H5N8 스트레인의 헤마글루티닌 단백질을 코딩하는 폴리뉴클레오티드로서,
상기 헤마글루티닌 단백질의 서열번호 1의 아미노산 서열에서 N 말단으로부터 103번째 아미노산이 돌연변이된 폴리뉴클레오티드;
H5N8 스트레인의 뉴라미니다제를 코딩하는 폴리뉴클레오티드;
저병원성 인플루엔자 바이러스의 중합효소 B2를 코딩하는 폴리뉴클레오티드; 및
인플루엔자 바이러스 H1N1 스트레인의 중합효소 B1, 중합효소 A, 뉴클레오캡시드, 매트릭스 단백질 및 비구조적 단백질로 이루어진 군으로부터 선택된 하나 이상의 단백질을 코딩하는 폴리뉴클레오티드를 포함하는 H5N8 재조합 인플루엔자 바이러스 제조용 조성물.As a polynucleotide encoding the hemagglutinin protein of the influenza virus H5N8 strain,
A polynucleotide in which the 103rd amino acid from the N-terminus is mutated in the amino acid sequence of SEQ ID NO: 1 of the hemagglutinin protein;
Polynucleotides encoding neuraminidase of the H5N8 strain;
A polynucleotide encoding the polymerase B2 of the hypopathogenic influenza virus; And
A composition for preparing H5N8 recombinant influenza virus comprising a polynucleotide encoding one or more proteins selected from the group consisting of polymerase B1, polymerase A, nucleocapsid, matrix protein, and non-structural protein of the influenza virus H1N1 strain. 청구항 10에 있어서, 상기 폴리뉴클레오티드는 벡터에 포함된 것인 조성물.The composition of claim 10, wherein the polynucleotide is contained in a vector. 청구항 10의 H5N8 재조합 인플루엔자 바이러스 제조용 조성물로 형질전환된 세포.Cells transformed with the composition for preparing the H5N8 recombinant influenza virus of claim 10. 청구항 12에 있어서, 상기 세포는 293T, MDCK, Vero, DF1, PK15, 및 ST1 세포로 이루어진 군으로부터 선택된 것인 세포. The cell of claim 12, wherein the cell is selected from the group consisting of 293T, MDCK, Vero, DF1, PK15, and ST1 cells. 청구항 1의 H5N8 재조합 인플루엔자 바이러스를 포함하는 백신 조성물.
A vaccine composition comprising the H5N8 recombinant influenza virus of claim 1.
KR1020190143003A 2019-11-08 2019-11-08 H5N8 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same KR102259392B1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
KR1020190143003A KR102259392B1 (en) 2019-11-08 2019-11-08 H5N8 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same
PCT/KR2020/015451 WO2021091279A1 (en) 2019-11-08 2020-11-06 H5n8 recombinant influenza a virus, composition for preparing same, cell transfected by same, and vaccine composition

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020190143003A KR102259392B1 (en) 2019-11-08 2019-11-08 H5N8 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same

Publications (2)

Publication Number Publication Date
KR20210056184A true KR20210056184A (en) 2021-05-18
KR102259392B1 KR102259392B1 (en) 2021-06-01

Family

ID=75848981

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020190143003A KR102259392B1 (en) 2019-11-08 2019-11-08 H5N8 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same

Country Status (2)

Country Link
KR (1) KR102259392B1 (en)
WO (1) WO2021091279A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113913395A (en) * 2021-10-19 2022-01-11 中国农业科学院哈尔滨兽医研究所（中国动物卫生与流行病学中心哈尔滨分中心） Artificial recombinant H5N8 influenza virus and preparation method and application thereof
CN114524862A (en) * 2021-12-16 2022-05-24 中国农业科学院哈尔滨兽医研究所（中国动物卫生与流行病学中心哈尔滨分中心） Construction and application of avian influenza (H5+ H7) trivalent DNA vaccine

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20140010583A (en) * 2012-07-13 2014-01-27 서울대학교산학협력단 A method of preparing ha2 common epitope of influenza virus with improved immunogenicity
KR20160073345A (en) * 2014-12-16 2016-06-24 서울대학교산학협력단 Highly replicative and avirulent recombinant influneza virus, and use thereof
KR20190109876A (en) * 2018-03-19 2019-09-27 한국생명공학연구원 Novel h5n3 avian influenza virus and vaccine compositon comprising same

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101908905B1 (en) * 2016-12-22 2018-10-17 아이디바이오 주식회사 Recombinant influenza virus to form cross-protection against multiple subtypes h9 and h5 of influenza viruses and vaccine comprising the same

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20140010583A (en) * 2012-07-13 2014-01-27 서울대학교산학협력단 A method of preparing ha2 common epitope of influenza virus with improved immunogenicity
KR20160073345A (en) * 2014-12-16 2016-06-24 서울대학교산학협력단 Highly replicative and avirulent recombinant influneza virus, and use thereof
KR20190109876A (en) * 2018-03-19 2019-09-27 한국생명공학연구원 Novel h5n3 avian influenza virus and vaccine compositon comprising same

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
국내 고병원성 AI 백신접종을 위한 프로그램 및 출구전략 개발 최종보고서. 농림축산식품부, 2018.02.* *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113913395A (en) * 2021-10-19 2022-01-11 中国农业科学院哈尔滨兽医研究所（中国动物卫生与流行病学中心哈尔滨分中心） Artificial recombinant H5N8 influenza virus and preparation method and application thereof
CN114524862A (en) * 2021-12-16 2022-05-24 中国农业科学院哈尔滨兽医研究所（中国动物卫生与流行病学中心哈尔滨分中心） Construction and application of avian influenza (H5+ H7) trivalent DNA vaccine
CN114524862B (en) * 2021-12-16 2022-12-27 中国农业科学院哈尔滨兽医研究所（中国动物卫生与流行病学中心哈尔滨分中心） Construction and application of avian influenza (H5 + H7) trivalent DNA vaccine

Also Published As

Publication number Publication date
WO2021091279A1 (en) 2021-05-14
KR102259392B1 (en) 2021-06-01

Similar Documents

Publication Publication Date Title
EP2069484B1 (en) Influenza B viruses having alterations in the hemaglutinin polypeptide
CA2918739C (en) Attenuated influenza vaccines and uses thereof
KR102259392B1 (en) H5N8 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same
KR102076794B1 (en) Recombinant swine influenza virus and uses thereof
KR102614346B1 (en) H5N6 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same
KR102334320B1 (en) H9N2 recombinant influenza virus, a composition for preparing the same, and a vaccine composition containing the same
US10323231B2 (en) Attenuated influenza vaccines and uses thereof
KR101426407B1 (en) Recombinant expression vector for preparing highly productive, highly immunogenic and avirulent influenza virus, and use thereof
KR102182987B1 (en) Recombinant Influenza A virus H5N1 strain and Vaccine Composition for Highly Pathogenic Influenza A virus comprising the same
KR101788234B1 (en) Highly replicative and avirulent recombinant influneza virus, and use thereof
KR101788790B1 (en) Highly replicative and avirulent influenza virus
KR101423695B1 (en) Recombinant expression vector for preparing highly productive and avirulent influenza virus, and use thereof
KR101788789B1 (en) Highly replicative and avirulent influenza virus
KR101582490B1 (en) Novel virus vaccine to form cross-protection against multiple subtypes of influenza viruses
CN112522213B (en) Separated H3N2 influenza virus strain and application thereof
Miao et al. H5N8 Subtype avian influenza virus isolated from migratory birds emerging in Eastern China possessed a high pathogenicity in mammals
KR101788236B1 (en) Avirulent and highly immunogenic influenza virus
KR20230100437A (en) Mammalian avirulent and embryonated egg highly replicative recombinant influenza virus
KR20230101172A (en) Mammalian avirulent and embryonated egg highly replicative recombinant influenza virus
KR101414225B1 (en) Recombinant expression vector for preparing highly productive influenza virus, and use thereof
KR101361774B1 (en) Highly replicative and law pathogenicity recombinant influneza virus
CA2709340A1 (en) Mutations in the influenza a virus ns1 gene and use thereof
KR20130055164A (en) Highly replicative and law pathogenicity recombinant influneza virus

Legal Events

Date Code Title Description
AMND Amendment
E601 Decision to refuse application
X091 Application refused [patent]
AMND Amendment
X701 Decision to grant (after re-examination)
GRNT Written decision to grant