KR20050082512A - Kit for diagnosis of foot-and-mouth disease containing peptide of 2c and 3b nonstructural protein of foot-and-mouth disease virus - Google Patents

Kit for diagnosis of foot-and-mouth disease containing peptide of 2c and 3b nonstructural protein of foot-and-mouth disease virus Download PDF

Info

Publication number
KR20050082512A
KR20050082512A KR1020040010973A KR20040010973A KR20050082512A KR 20050082512 A KR20050082512 A KR 20050082512A KR 1020040010973 A KR1020040010973 A KR 1020040010973A KR 20040010973 A KR20040010973 A KR 20040010973A KR 20050082512 A KR20050082512 A KR 20050082512A
Authority
KR
South Korea
Prior art keywords
leu
ala
val
thr
gly
Prior art date
Application number
KR1020040010973A
Other languages
Korean (ko)
Other versions
KR100536848B1 (en
Inventor
엄재구
박종현
계수정
김용주
이광녕
조남인
Original Assignee
대한민국(관리부서 농림부 국립수의과학검역원)
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 대한민국(관리부서 농림부 국립수의과학검역원) filed Critical 대한민국(관리부서 농림부 국립수의과학검역원)
Priority to KR10-2004-0010973A priority Critical patent/KR100536848B1/en
Publication of KR20050082512A publication Critical patent/KR20050082512A/en
Application granted granted Critical
Publication of KR100536848B1 publication Critical patent/KR100536848B1/en

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/5308Immunoassay; Biospecific binding assay; Materials therefor for analytes not provided for elsewhere, e.g. nucleic acids, uric acid, worms, mites
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/44Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Physics & Mathematics (AREA)
  • General Physics & Mathematics (AREA)
  • Organic Chemistry (AREA)
  • Biotechnology (AREA)
  • Analytical Chemistry (AREA)
  • Microbiology (AREA)
  • Cell Biology (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 구제역 바이러스의 비구조단백질에 대한 펩타이드를 항원으로 포함하는 구제역 진단용 키트 및 이를 이용하여 구제역을 진단하는 방법에 관한 것으로서, 보다 상세하게는 서열번호 17 및 서열번호 18로 기재되는 아미노산 서열을 가지는 구제역 바이러스의 비구조단백질 2C 및 3B에 대한 펩타이드를 항원으로 포함하는 구제역 진단용 키트 및 이를 이용하여 발굽이 둘로 갈라진 모든 유제류에 대하여 구제역을 진단하는 방법에 관한 것이다. 본 발명의 키트에 포함되는 서열번호 17 및 서열번호 18로 기재되는 펩타이드는 종래의 구제역 진단키트에서 사용되는 재조합 단백질보다 백신 접종축과 감염축에 대한 민감도와 특이도가 뛰어나므로, 구제역감염축 및 백신접종축에 대한 감별 진단에 보다 효과적으로 사용될 수 있다.The present invention relates to a foot-and-mouth disease diagnostic kit comprising a peptide for a non-structural protein of foot-and-mouth virus as an antigen and a method for diagnosing foot-and-mouth disease using the same, and more specifically, having an amino acid sequence described in SEQ ID NO: 17 and SEQ ID NO: 18 It relates to a foot-and-mouth disease diagnostic kit comprising a peptide for non-structural proteins 2C and 3B of foot-and-mouth virus as an antigen, and a method for diagnosing foot-and-mouth disease for all the ungulates with two hoofs using the same. Peptides described in SEQ ID NO: 17 and SEQ ID NO: 18 included in the kit of the present invention is superior in sensitivity and specificity to the vaccination axis and infection axis than recombinant proteins used in conventional foot and mouth diagnostic kits, foot-and-mouth disease infection and vaccination It can be used more effectively for differential diagnosis of axes.

Description

구제역 바이러스의 2C 및 3B 비구조단백질에 대한 펩타이드를 포함하는 구제역 진단용 키트{Kit for Diagnosis of Foot-and-Mouth Disease Containing Peptide of 2C and 3B Nonstructural Protein of Foot-and-Mouth Disease Virus} Kit for Diagnosis of Foot-and-Mouth Disease Containing Peptide of 2C and 3B Nonstructural Protein of Foot-and-Mouth Disease Virus}

본 발명은 구제역 바이러스(Foot-and-mouth virus; FMDV)의 비구조단백질에 대한 펩타이드를 항원으로 포함하는 구제역 진단용 키트 및 이를 이용하여 구제역을 진단하는 방법에 관한 것으로서, 보다 상세하게는 서열번호 17 및 서열번호 18로 기재되는 아미노산 서열을 가지는 구제역 바이러스의 비구조단백질 2C 및 3B에 대한 펩타이드를 항원으로 포함하는 구제역 진단용 키트 및 이를 이용하여 발굽이 둘로 갈라진 모든 유제류에 대하여 구제역을 진단하는 방법에 관한 것이다.The present invention relates to a kit for diagnosis of foot-and-mouth disease using a peptide for non-structural proteins of foot-and-mouth virus (FMDV) as an antigen and a method for diagnosing foot-and-mouth disease using the same, more specifically SEQ ID NO: 17 and It relates to a foot-and-mouth disease diagnostic kit comprising a peptide for non-structural proteins 2C and 3B of foot-and-mouth virus having the amino acid sequence set forth in SEQ ID NO: 18 as an antigen, and a method for diagnosing foot-and-mouth disease for all ungulates having two hoofs using the same.

구제역(foot-and-mouth disease)은 가축에게 있어서 매우 치명적인 질병으로 국제수역사무국(Office International des Epizooties)에 A급으로 기록되어 있는 질병이며, 우리나라에서도 제1종 가축전염병으로 지정되어 있다. 소, 돼지, 양, 염소, 사슴 등과 같이 발굽이 둘로 갈라진 모든 동물(유제류)이 감염될 수 있으며, 전염성이 매우 강하고, 감염초기에는 입술, 혀, 잇몸, 코, 발굽 사이 등에 수포가 생기고 체온이 급격히 상승되며 식욕이 저하되는 등의 증상이 나타나다가 급성 폐사에 이르게 된다. 따라서, 구제역 발생국이 되면 축산물의 자유무역 증대로 인해 무역규제 대상국가가 되는 등 경제적으로 큰 피해를 입게 된다.Foot-and-mouth disease is a fatal disease in cattle and is classified as Class A by the Office International des Epizooties. It is also designated as the first type of animal infectious disease in Korea. All hoofed animals (ungulates), such as cattle, pigs, sheep, goats, and deer, can be infected. They are highly contagious, and in the early stages of infection, blisters develop on the lips, tongue, gums, nose, and hoofs, Symptoms, such as a sharp rise in appetite, can lead to acute death. Therefore, if a foot-and-mouth disease-generating country becomes a country that is subject to trade regulation due to the increase in free trade of livestock products, it is economically damaged.

구제역의 원인이 되는 병원체는 피코나비리대 과(Picornaviridae family)의 아프소바이러스(aphthovirus)에 속하는 바이러스이며, 상기 바이러스의 게놈은 약 8,000개의 핵산 염기로 이루어진 단일 RNA 포지티브 가닥(single RNA positive strand)으로 구성되어 있다. 상기 RNA는 초기에 단일폴리펩타이드로 번역된 후 감염된 세포 내에서 바이러스에 의해 암호화된 프로테아제(viral protease)에 의해 연속적으로 절단되어 4개의 캡시드 단백질(VP1∼VP4) 및 비구조 폴리펩타이드(2C, 3A, 3B, 3C 및 3D)를 생성한다. 이러한 구제역 바이러스의 혈청형은 7가지 타입(A, O, C, Asia 1, SAT 1, SAT 2, SAT 3)이 존재하고 80여 가지의 아형(subtype)이 있다고 알려져 있다(Fredric W. Scott, Hagan and Bruner's Microbiology and infectious Diseases of Domestic Animals, Eight Editon, p647-667,1988). 한 종류의 구제역 바이러스의 혈청형은 나머지 6개의 혈청형과는 항원적으로 구별되는데, 혈청형 A 바이러스가 제일 가변적이며 30개 이상의 아형을 갖는다. 또한, 각각의 혈청형은 항원이 다른 다수의 아형으로 세분화될 수 있다.The pathogen responsible for foot and mouth disease is a virus belonging to the aphthovirus of the Picornaviridae family, the genome of which is a single RNA positive strand consisting of about 8,000 nucleic acid bases. It consists of. The RNA is initially translated into a monopolypeptide and subsequently cleaved by viral protease encoded by the virus in infected cells, resulting in four capsid proteins (VP1-VP4) and nonstructural polypeptides (2C, 3A). , 3B, 3C and 3D). There are seven types of foot-and-mouth disease virus (A, O, C, Asia 1, SAT 1, SAT 2, SAT 3) and about 80 subtypes (Fredric W. Scott, Hagan and Bruner's Microbiology and infectious Diseases of Domestic Animals, Eight Editon, p647-667,1988). The serotype of one type of foot and mouth virus is antigenically distinct from the other six serotypes, with serotype A virus being the most variable and having more than 30 subtypes. In addition, each serotype can be subdivided into a number of subtypes with different antigens.

구제역 바이러스의 혈청형들은 본래 동물들에서의 교차-면역 실험(cross-immunity experiment)에 의해 확인되는데, 동물이 하나의 혈청형으로부터 감염에서 회복되었을지라도 또 다른 혈청형에 의해서 재감염될 수 있다. 이런 구제역바이러스의 여러 혈청형은 각기 다른 지질학적 분포를 가지며, 아시아에서는 혈청형 A, O 및 Asia가 가장 일반적이고, 유렵 및 남아프리카에서는 혈청형 A, O 및 C가 발견되며, 아프리카에서는 혈청형 A, O 및 SAT가 우세하다. 아프리카, 아시아 및 남아프리카의 몇몇 국가들은 풍토병적 발생지역이다.Serotypes of foot-and-mouth virus are originally confirmed by cross-immunity experiments in animals, even if the animal has recovered from infection from one serotype, and can be reinfected by another serotype. Several serotypes of these foot-and-mouth disease viruses have different geological distributions, with serotypes A, O and Asia being the most common in Asia, serotypes A, O and C found in Europe and South Africa, and serotype A in Africa. , O and SAT prevail. Some countries in Africa, Asia and South Africa are endemic areas.

한편, 현재 사용중인 구제역 예방백신은 생산과정 중에 바이러스 입자만을 정제하여 사용하고 있기 때문에 백신 내에는 구조단백질만이 포함되어 있으며, 비구조단백질은 포함되어 있지 않기 때문에 백신을 접종한 동물에서는 비구조단백질 (일부단백질 제외, 3D 등)에 대한 항체가 생기지 않는 것으로 알려져 있다(Richard F. Meyer et al., Baculovirus expressed 2C of foot-and-mouth disease virus has the potential for differentiating convalescent from vaccinated animals, Journal of Virological Methods 65 (1997) 33-43). 이러한 비구조단백질은 구조단백질에 비해 훨씬 변이가 적어 여러 혈청형에서 동일한 항원결정기를 가지고 있기 때문에, 구제역 바이러스 비구조단백질을 이용하여 여러 혈청형의 야외감염축 항체 확인은 물론 백신 접종축 항체와의 감별에 대한 연구가 전세계적으로 활발히 진행되고 있다. 이와 관련하여, 대다수의 나라에서는 구제역 예방을 위해 예방백신을 비축하고 있으며 구제역 발생시 조기근절을 위해 많은 검사방법을 연구하고 있다. 그 결과, 비구조단백질을 이용한 효소면역검사법(ELISA) 또는 보체결합반응 방법 등이 개발되었으나, 현재까지는 그 정확성과 민감도 등이 불완전하다. 따라서, 백신축과 감염축을 보다 정확하게 감별하기 위한 연구가 지속적으로 요구되고 있는 실정이다.On the other hand, the foot-and-mouth disease vaccine currently in use is purified only by viral particles during the production process, so the vaccine contains only structural proteins, and non-structural proteins are not included. Antibodies to proteins, 3D, etc., are not known (Richard F. Meyer et al., Baculovirus expressed 2C of foot-and-mouth disease virus has the potential for differentiating convalescent from vaccinated animals, Journal of Virological Methods 65 (1997) 33-43). Since these non-structural proteins are much less mutated than structural proteins, they have the same epitope in several serotypes. Research is actively underway around the world. In this regard, most countries have stockpiled vaccines for the prevention of foot and mouth disease, and many test methods have been studied for early eradication of foot and mouth disease. As a result, enzyme immunoassay (ELISA) or complement binding method using non-structural protein has been developed, but its accuracy and sensitivity are incomplete. Therefore, there is a continuing need for research to more accurately discriminate between vaccine and infection.

이에, 본 발명자들은 보다 정확한 구제역 감별진단을 위해 구제역 항혈청과 특이적으로 반응하는 아미노산 염기서열을 분석하고 이를 토대로 합성 펩타이드를 제작하였으며, 상기 합성 펩타이드를 이용한 진단 방법이 구제역 바이러스의 재조합 단백질을 이용하여 진단하는 종래의 진단방법에 비해 진단 특이도가 높고, 기존의 합성 펩타이드를 이용한 진단 방법보다 펩타이드 길이를 줄여 제조 비용을 절감할 수 있어 구제역의 진단에 유용하게 사용될 수 있음을 밝힘으로써 본 발명을 완성하였다.Thus, the present inventors analyzed the amino acid sequence specifically reacting with foot-and-mouth antiserum for more accurate foot-and-mouth differential diagnosis and produced a synthetic peptide based on this, and the diagnostic method using the synthetic peptide using recombinant protein of foot-and-mouth virus. Completion of the present invention by revealing that the specificity of diagnosis is higher than that of the conventional diagnostic method for diagnosis, and that the manufacturing cost can be reduced by reducing the peptide length than the conventional diagnostic method using synthetic peptides. It was.

본 발명은 상기와 같은 종래 구제역 진단 방법의 문제점을 해결하기 위하여 안출된 것으로서, 구제역 바이러스의 비구조단백질 단일 부위만을 진단 항원으로 사용할 경우 두 부위를 사용하는 것보다 진단 효율이 떨어진다는 것에 착안하여 구제역 바이러스 혈청형과 관계없이 변이가 적고 구제역 예방백신의 생산과정에서 백신내에 포함되지 않는 2C 및 3B 비구조단백질중 일부인 서열번호 17 및 서열번호 18로 기재되는 아미노산 서열을 가지는 펩타이드를 항원으로 포함하는 구제역 진단용 키트 및 이를 이용하여 유제류 동물에서의 구제역을 진단하는 방법을 제공하는 것을 그 목적으로 한다. The present invention has been made to solve the problems of the conventional foot-and-mouth disease diagnosis method, when only the non-structural protein single site of foot-and-mouth virus is used as a diagnostic antigen, focusing on the diagnostic efficiency is lower than using two sites of foot-and-mouth disease virus Foot-and-mouth diagnostic kit comprising as an antigen a peptide having an amino acid sequence set forth in SEQ ID NO: 17 and SEQ ID NO: 18, which is a part of 2C and 3B nonstructural proteins which are small in variation and not included in the vaccine during the production of foot-and-mouth disease vaccines, regardless of serotypes And it aims to provide a method for diagnosing foot-and-mouth disease in ungulate animals using the same.

상기 목적을 달성하기 위하여, 본 발명은 서열번호 17 및 서열번호 18로 기재되는 아미노산 서열을 가지는 구제역 바이러스의 비구조단백질 2C 및 3B에 대한 펩타이드를 항원으로 포함하는 구제역 진단용 키트를 제공한다.In order to achieve the above object, the present invention provides a foot-and-mouth disease diagnostic kit comprising a peptide for non-structural proteins 2C and 3B of foot-and-mouth virus having the amino acid sequence of SEQ ID NO: 17 and SEQ ID NO: 18 as an antigen.

또한, 본 발명은 상기 비구조단백질 2C 및 3B에 대한 펩타이드를 이용하여 유제류 동물에서의 구제역을 진단하는 방법을 제공한다.The present invention also provides a method for diagnosing foot-and-mouth disease in ungulate animals using the peptides for the nonstructural proteins 2C and 3B.

이하, 본 발명을 상세히 설명한다.Hereinafter, the present invention will be described in detail.

본 발명은 서열번호 17 및 서열번호 18로 기재되는 아미노산 서열을 가지는 구제역 바이러스의 비구조단백질 2C 및 3B에 대한 펩타이드를 항원으로 포함하는 구제역 진단용 키트를 제공한다.The present invention provides a kit for foot-and-mouth disease diagnostics comprising a peptide against non-structural proteins 2C and 3B of foot-and-mouth virus having the amino acid sequences set forth in SEQ ID NO: 17 and SEQ ID NO: 18 as an antigen.

본 발명의 구제역 진단용 키트에 포함되는 서열번호 17 및 서열번호 18로 기재되는 항원 펩타이드는 화학적으로 합성할 수도 있고 유전자 재조합 방법을 이용하여 미생물 또는 진핵세포에서 제조될 수도 있으나, 그의 제조방법이 반드시 여기에 한정되는 것은 아니다. 상기 유전자 재조합 방법을 이용하기 위한 벡터로는 인간 및 동물에는 감염성이 없으면서 재조합 단백질을 발현시킬 수 있는 전이벡터를 사용하는 것이 바람직하다. 상기 서열번호 17 및 서열번호 18로 기재되는 펩타이드는 구제역 바이러스 2000년도 분리주인 "O/SKR/2000"와 2002년도 분리주인 "O/SKR/2002"의 전체 유전자를 기본으로 하여 아미노산 및 염기서열을 분석하고, 이를 토대로 비구조단백질 부위에 항원성이 인정되는 부위에 대한 스크리닝을 실시한 결과 선발되었다(도 2 및 표 1 참조).The antigen peptides described in SEQ ID NO: 17 and SEQ ID NO: 18 included in the foot-and-mouth disease diagnostic kit of the present invention may be chemically synthesized or may be prepared in microorganisms or eukaryotic cells using a genetic recombination method, but the preparation method thereof is necessarily It is not limited to. As a vector for using the genetic recombination method, it is preferable to use a transfer vector capable of expressing a recombinant protein without infecting humans and animals. Peptides described in SEQ ID NO: 17 and SEQ ID NO: 18 is based on the amino acid and nucleotide sequence based on the entire gene of foot-and-mouth virus virus isolate "O / SKR / 2000" and 2002 isolate "O / SKR / 2002" Based on the analysis, the screening of the site where the antigenicity was recognized in the non-structural protein site was selected (see FIG. 2 and Table 1).

본 발명의 구제역 진단용 키트는 상기 항원 단백질에 대한 항체를 정량분석 또는 정성분석함으로써 동물에서의 구제역을 진단할 수 있으며, 상기 항체의 분석을 위해 ELISA 방법을 이용할 수 있다. 예를 들어, 상기 재조합 항원 단백질을 표면에 코팅시킨 96-웰 마이크로타이터 플레이트 등을 이용하여 ELISA를 수행하도록 상기 진단키트를 제공할 수 있다. 이와 같은 진단키트는 항원 단백질, 적당한 완충용액, 표준 항체, 발색 효소 또는 형광 물질로 표지된 2차 항체, 발색 기질 등을 포함할 수 있다.The foot-and-mouth disease diagnostic kit of the present invention can diagnose foot-and-mouth disease in an animal by quantitatively or qualitatively analyzing an antibody against the antigenic protein, and may use an ELISA method for analysis of the antibody. For example, the diagnostic kit may be provided to perform an ELISA using a 96-well microtiter plate coated on the surface of the recombinant antigen protein. Such diagnostic kits may include antigenic proteins, appropriate buffers, standard antibodies, secondary antibodies labeled with chromogenic enzymes or fluorescent materials, chromogenic substrates, and the like.

또한, 상기 키트는 구제역의 진단을 위해 생물학적 마이크로칩을 이용한 자동화된 분석 방법을 이용할 수 있다. 예를 들어, 상기 재조합 항원 단백질을 표면에 코팅시킨 글래스 슬라이드 등의 칩을 이용하여 ELISA를 수행하도록 상기 진단키트를 구성할 수 있다. 이와 같은 진단키트는 항원 단백질이 표면에 고정된 생물학적 마이크로칩, 적당한 완충용액, 표준항체, 2차 항체 등을 포함한다.In addition, the kit may use an automated analysis method using a biological microchip for the diagnosis of foot and mouth disease. For example, the diagnostic kit may be configured to perform ELISA using a chip such as a glass slide coated on the surface of the recombinant antigen protein. Such diagnostic kits include biological microchips with antigenic proteins immobilized on the surface, suitable buffers, standard antibodies, secondary antibodies, and the like.

또한, 본 발명은 서열번호 17 및 서열번호 18로 기재되는 아미노산 서열을 가지는 구제역 바이러스의 비구조단백질 2C 및 3B에 대한 펩타이드를 이용하여 동물의 구제역을 진단하는 방법을 제공한다.The present invention also provides a method for diagnosing foot-and-mouth disease in animals using peptides for the nonstructural proteins 2C and 3B of foot-and-mouth virus having the amino acid sequences set forth in SEQ ID NO: 17 and SEQ ID NO: 18.

본 발명의 구제역 진단 방법은Foot-and-mouth disease diagnosis method of the present invention

1) 서열번호 17 및 서열번호 18로 기재되는 아미노산 서열을 가지는 펩타이드를 플레이트에 부착시키는 단계;1) attaching a peptide having an amino acid sequence set forth in SEQ ID NO: 17 and SEQ ID NO: 18 to a plate;

2) 상기 플레이트에 부착되지 않은 펩타이드를 세척하여 제거하는 단계;2) washing and removing peptides not attached to the plate;

3) 상기 펩타이드가 부착된 플레이트에 검사하고자 하는 동물의 가검 혈청을 반응시키는 단계;3) reacting the test serum of the animal to be tested on the plate to which the peptide is attached;

4) 항원 펩타이드에 결합하지 않은 가검 혈청을 세척하여 제거하는 단계;4) washing and removing the test serum that does not bind the antigen peptide;

5) 상기 가검 혈청 중의 구제역 바이러스에 대한 항체에 특이적으로 결합하며, 검출 마커(marker)가 결합된 콘쥬게이트(conjugate)를 반응시키는 단계; 및5) specifically binding to an antibody against foot-and-mouth virus in the test serum, and reacting a conjugate to which a detection marker is bound; And

6) 상기 결합된 콘쥬게이트의 특이도를 측정하는 단계를 포함한다.6) measuring the specificity of the conjugated conjugate.

상기에서, 단계 3의 동물은 발굽이 둘로 갈라진 모든 유제류 동물이 될 수 있으며, 그 중에서도 소, 돼지, 양, 염소 및 사슴으로 구성된 군으로부터 선택될 수 있으나, 반드시 여기에 한정되는 것은 아니다.In the above, the animal of step 3 may be any ungulate animal with two hoofs, and may be selected from the group consisting of cows, pigs, sheep, goats, and deer, but is not necessarily limited thereto.

단계 5에 있어서, 콘쥬게이트로는 항체를 사용하는 것이 바람직하며, 이때에는 "2차항체"라 명명한다. "검출 마커"는 펩타이드에 결합된 구제역 바이러스에 대한 항체의 측정을 용이하게 하기 위하여 콘쥬게이트에 결합된 물질을 의미하는 것으로서, 발색효소, 형광물질 및 방사선물질로 구성된 군으로부터 선택될 수 있으나, 반드시 여기에 한정되는 것은 아니다. 상기에서, 발색효소는 퍼옥시다제(peroxidase), 알칼라인 포스파타제(alkaline phosphatase)가 사용될 수 있고, 형광물질은 FITC, RITC 등이 사용될 수 있으며, 방사성물질로는 32P, 3H, 99m Tc 및 188Re으로 구성된 군으로부터 선택될 수 있으나, 반드시 여기에 한정되는 것은 아니다.In step 5, it is preferred to use an antibody as the conjugate, in which case it is termed a “secondary antibody”. “Detection marker” means a substance bound to a conjugate to facilitate measurement of an antibody against foot-and-mouth virus bound to a peptide, and may be selected from the group consisting of chromophores, fluorescent materials, and radioactive materials, but not necessarily It is not limited to this. In the above, the chromatase may be used peroxidase (peroxidase), alkaline phosphatase (alkaline phosphatase), fluorescent material may be used, such as FITC, RITC, radioactive material 32 P, 3 H, 99m Tc and 188 It may be selected from the group consisting of Re, but is not necessarily limited thereto.

단계 6에 있어서, 콘쥬게이트의 특이도 측정은 효소인 경우에는 효소반응을 통한 기질의 발색반응에 의해 흡광도를 측정하고, 형광물질인 경우에는 형광광도를 측정하고, 방사선 물질인 경우에는 방사선 방출량을 측정함으로써 가검 혈청 중의 구제역 바이러스 항체가를 측정할 수 있다.In step 6, the specificity of the conjugate is measured by measuring the absorbance by the color reaction of the substrate through the enzymatic reaction in the case of an enzyme, the fluorescence intensity in the case of a fluorescent substance, and the radiation emission amount in the case of a radioactive substance. By measuring, foot-and-mouth virus antibody titer in the test serum can be measured.

상기 방법에서 이용될 수 있는 실험과정, 시약 및 반응조건은 종래 당업계에서 통상적으로 알려져 있는 것들을 이용할 수 있으며, 이는 당업자에게 있어서 자명한 일이다.Experimental procedures, reagents and reaction conditions that can be used in the method can be used those conventionally known in the art, which is obvious to those skilled in the art.

본 발명의 구제역 진단 방법의 합성 펩타이드를 이용한 효소면역측정법은 구제역 항체에 특이적으로 반응하는 구제역 항원결정부위만을 사용하였기 때문에 그 민감도 및 정확도가 매우 뛰어나고(도 3 내지 도 10 참조), 또한 구제역 비구조단백질의 한 부위만을 사용하는 종래의 방법보다 두 부위를 동시에 사용함으로써 진단 효율에서 기존의 진단 방법보다 우수하다(표 2 참조). 또한, 본 발명에서 항원으로 사용된 서열번호 17 및 서열번호 18로 기재되는 펩타이드는 구제역 바이러스의 7가지 혈청형에 관계없이 공통으로 반응하는 비구조단백질 부위이므로 이를 항원으로 이용할 경우 각기 다른 혈청형의 구제역 바이러스의 감염여부에 대해 신속한 진단이 가능하다는 이점이 있다. 또한, 구제역 백신중에는 상기 두 부위에 대한 2C 및 3B 비구조단백질의 항원이 포함되어 있지 않으므로, 비구조단백질 항원에 대한 항체는 구제역에 야외감염된 가축에 한하여 나타나고 백신접총축에서는 나타나지 않기 때문에 백신감염축과 야외감염축을 진단할 수 있는 장점이 있다.The enzyme immunoassay method using the synthetic peptide of the foot-and-mouth disease diagnosis method of the present invention used only the foot-and-mouth disease epitope that reacts specifically to the foot-and-mouth antibody, so its sensitivity and accuracy are very excellent (see FIGS. 3 to 10), and also foot-and-mouth disease acetabules. The use of both sites at the same time is superior to the conventional methods of diagnosis in comparison with the conventional methods using only one site of crude protein (see Table 2). In addition, since the peptides described in SEQ ID NO: 17 and SEQ ID NO: 18 used as antigens in the present invention are non-structural protein sites that react in common regardless of the seven serotypes of foot-and-mouth virus, the foot-and-mouth disease of different serotypes when used as antigens The advantage is that rapid diagnosis of the virus can be made. In addition, because the foot-and-mouth vaccine does not contain antigens of 2C and 3B non-structural proteins for the two sites, the antibody against the non-structural protein antigen appears only in livestock infected with foot-and-mouth disease, and not in the vaccination axis. There is an advantage to diagnose.

이하, 본 발명을 실시예에 의해 상세히 설명한다.Hereinafter, the present invention will be described in detail by way of examples.

단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 한정되는 것은 아니다.However, the following examples are merely to illustrate the invention, but the content of the present invention is not limited to the following examples.

<실시예 1> 국내분리 구제역 바이러스의 전체 유전자 염기서열 및 아미노산 서열 결정Example 1 Determination of Total Gene Sequence and Amino Acid Sequence of Korean Isolated Foot-and-mouth Disease Virus

본 발명에서 사용된 국내분리 구제역 바이러스는 국내 감염우 및 감염돈의 조직 및 수포에서 추출된 것을 사용하였으며, 각각 "O/SKR/2000" 및 "O/SKR/2002"라 명명하였다. 먼저, 국내 발생한 구제역 감염우 및 감염돈의 조직 및 수포액을 균질화한 다음 구아니디움 티오시아네이트(guanidium thiocynate, GTC)를 함유한 용해 완충액(lysis buffer) 0.9㎖에 0.1㎖의 비율로 혼합하였다. 상온에서 10분간 실리카(silica)로 흡착시킨 다음 원심분리하여 상층액을 버렸으며, GTC를 함유한 세척액과 에탄올, 아세톤의 순서로 펠렛(pellet)을 세척한 후 56℃에서 건조시켰다. 여기에 RNase 억제제를 첨가한 정제수를 넣고 65℃에서 5분간 가열하여 RNA를 용출하였다.The isolated foot-and-mouth virus used in the present invention was extracted from tissues and blisters of domestically infected cattle and infected pigs, and was named "O / SKR / 2000" and "O / SKR / 2002", respectively. First, the tissues and vesicles of foot-and-mouth disease and infected pigs produced in Korea were homogenized, and then mixed in 0.9 ml of lysis buffer containing guanidium thiocynate (GTC) at a rate of 0.1 ml. After adsorbing with silica for 10 minutes at room temperature, the supernatant was discarded by centrifugation. The pellet was washed in the order of the wash solution containing GTC, ethanol and acetone, and then dried at 56 ° C. Purified water added with the RNase inhibitor was added thereto, followed by heating at 65 ° C. for 5 minutes to elute RNA.

다음으로, 상기 RNA로부터 cDNA를 합성하였다. 이를 위하여, 추출한 상기 RNA를 서열번호 20으로 기재되는 역(reverse) 프라이머와 혼합하여 5분간 끊인 후, 즉시 얼음에 넣고 5분간 냉각시켜 10,000rpm에서 1분간 원심분리하였다. 첫째가닥(first-strand) cDNA는 1㎍의 전체 RNA, 40 유니트(unit)의 RNAsin (Promega), 50mM Tris-HCl pH 8.3, 3mM MgCl2, 75mM KCl, 10mM DTT, 0.4mM dATP, 0.4mM dCTP, 0.4mM dTTP, 0.4mM dGTP 및 상기 역 프라이머를 20㎕의 반응액에 넣고 42℃에서 2분간 반응시킨 다음, 2,000 유니트의 역전사 효소(SUPERSCIPT II RNase H-Reverse Transcriptase, Gibco-BRL)를 첨가하여 42℃에서 50분간 반응시켜 합성하였다. cDNA는 유전자은행(GenBank, http://www.ncbi.nlm.nih.gov)에서 검색한 구제역의 유전자 서열을 참고로 하여 작성된 하기 표 1로 기재되는 서열번호 21 내지 서열번호 42로 기재되는 염기서열을 가지는 합성 프라이머와 Tag 중합효소(polymerase, Takara)를 사용하여 95℃에서 5분간 변성(denature)시킨 후 50∼58℃ 1분, 72℃ 2∼5분, 92∼94℃ 1∼5분씩 30∼35회 순환 반응시킨 다음, 50∼58℃ 1∼5분, 72℃ 2∼5분간 반응시켜 합성하였다(Gene Amp PCR system 9600, Perkin Elmer). PCR을 이용하여 증폭된 DNA 단편은 제한효소 처리없이 바로 pGEM-T Easy 벡터(Promega)에 클로닝하였고, 디데옥시-체인 다이 종결 순환 시퀀싱 키트(dye terminator cycle sequencing kit, PE-Bio-system)를 이용하여 반응시켰다. 반응 후 유전자 자동염기서열분석기(ABI)를 사용하여 국내분리 구제역 바이러스의 염기서열을 분석하였다.Next, cDNA was synthesized from the RNA. For this purpose, the extracted RNA was mixed with a reverse primer as set forth in SEQ ID NO: 20, and then cut off for 5 minutes, immediately placed in ice, cooled for 5 minutes, and centrifuged at 10,000 rpm for 1 minute. The first-strand cDNA contains 1 μg total RNA, 40 units of RNAsin (Promega), 50 mM Tris-HCl pH 8.3, 3 mM MgCl 2 , 75 mM KCl, 10 mM DTT, 0.4 mM dATP, 0.4 mM dCTP , 0.4mM dTTP, 0.4mM dGTP and the reverse primer was added to the reaction solution of 20µl for 2 minutes at 42 ℃, then 2,000 units of reverse transcriptase (SUPERSCIPT II RNase H-Reverse Transcriptase, Gibco-BRL) was added It was synthesize | combined by reacting for 50 minutes at 42 degreeC. cDNA is a base described in SEQ ID NO: 21 to SEQ ID NO: 42 as described in Table 1 prepared with reference to the gene sequence of foot-and-mouth disease retrieved from the GenBank (GenBank, http://www.ncbi.nlm.nih.gov) Denature at 95 ° C for 5 minutes using a synthetic primer having a sequence and a Tag polymerase (Takara), followed by 50 to 58 ° C for 1 minute, 72 ° C for 2 to 5 minutes, and 92 to 94 ° C for 1 to 5 minutes. After 30 to 35 cycles of reaction, it was synthesized by reacting 50 to 58 ℃ 1-5 minutes, 72 ℃ 2-5 minutes (Gene Amp PCR system 9600, Perkin Elmer). DNA fragments amplified using PCR were immediately cloned into pGEM-T Easy vector (Promega) without restriction enzyme treatment, using a dideoxy-chain die terminator cycle sequencing kit (PE-Bio-system). The reaction was carried out. After the reaction, the nucleotide sequence of the isolated foot-and-mouth virus was analyzed using a gene automatic sequencing (ABI).

O/SKR/2002 바이러스의 전체 유전자 시퀀싱을 위해 사용된 프라이머Primers Used for Whole Gene Sequencing of O / SKR / 2002 Virus 프라이머 염기서열Primer Sequence 위치location 종류Kinds 서열번호SEQ ID NO: TTGAAAGGGGGCGCTAGGGTCTTGAAAGGGGGCGCTAGGGTC 1One 정상 프라이머Normal primer 2121 TGAAAGGCGGGTTTCGGGTGTGAAAGGCGGGTTTCGGGTG 368368 역프라이머Reverse Primer 2222 AAGTTTTACCGTCTGTCCCGAAGTTTTACCGTCTGTCCCG 369369 정상 프라이머Normal primer 2323 TTGTTACCAAGGAGGAGTTTTGTTACCAAGGAGGAGTT 658658 역프라이머Reverse Primer 2424 CCTGGTCTTTCCAGGTCTAGCCTGGTCTTTCCAGGTCTAG 665665 정상 프라이머Normal primer 2525 TCACCAAGCTGTGTGTTCCATTCACCAAGCTGTGTGTTCCAT 16541654 역프라이머Reverse Primer 2626 TCAACAATTACTACATGCAGCTCAACAATTACTACATGCAGC 17491749 정상프라이머Normal Primer 2727 GTGCCACTGTACTGTGTTGTAGTGTGCCACTGTACTGTGTTGTAGT 29072907 역프라이머Reverse Primer 2828 GTGCTCGCCCAGTTTGACGTGCTCGCCCAGTTTGAC 28102810 정상프라이머Normal Primer 2929 GCTGCCTACCTCCTTCAATGCTGCCTACCTCCTTCAAT 37273727 정상프라이머Normal Primer 3030 CAGATGCAGGAGGACATGTGCAGATGCAGGAGGACATGTG 39983998 정상프라이머Normal Primer 3131 GAGCTTGTACCAGGGTTTGGCGAGCTTGTACCAGGGTTTGGC 41094109 역프라이머Reverse Primer 3232 CCAAGCCTTCATCCAGTCGCCCAAGCCTTCATCCAGTCGC 44824482 역프라이머Reverse Primer 3333 GTGTCGAGCCACCCGATTTTCGTGTCGAGCCACCCGATTTTC 53395339 정상프라이머Normal Primer 3434 GGTTTCTGACGCTCGAGGGTTTCTGACGCTCGAG 58365836 역프라이머Reverse Primer 3535 CCACTCGAGCGTCAGAAACCCCACTCGAGCGTCAGAAACC 58335833 정상 프라이머Normal primer 3636 CTCGTGGTGTGGTTCGGGGTCCTCGTGGTGTGGTTCGGGGTC 66496649 역프라이머Reverse Primer 3737 GACAGGACATGCTCTCAGACGCGACAGGACATGCTCTCAGACGC 62636263 정상프라이머Normal Primer 3838 GATGCGTTTGTTCTCATAGGCGGATGCGTTTGTTCTCATAGGCG 75197519 역프라이머Reverse Primer 3939 GCTGAGTGGATCCTGAAACGCTGAGTGGATCCTGAAAC 74817481 정상프라이머Normal Primer 4040 GGATTATGCGTCACCGCACAGGATTATGCGTCACCGCACA 80688068 역프라이머Reverse Primer 4141 GTTTTCCCAGTCACGACGTTTTCCCAGTCACGAC 81558155 역프라이머Reverse Primer 4242

그 결과, 본 발명의 국내분리 구제역 바이러스인 O/SKR/2000 및 O/SKR/2002는 각각 서열번호 1 및 서열번호 2로 기재되는 염기서열을 가지며, 각각 서열번호 3 및 서열번호 4로 기재되는 하나의 폴리펩타이드를 코딩하고 있음을 확인하였다. 상기 서열번호 3 및 서열번호 4로 기재되는 아미노산 서열을 비교한 결과를 도 1에 나타내었다. 본 발명자들은 상기 염기서열 및 아미노산 서열을 2003년 7월 2일자로 유전자은행(GenBank)에 각각 AY312589 및 AY312587로 등록하였다.As a result, the domestic isolated foot-and-mouth virus O / SKR / 2000 and O / SKR / 2002 of the present invention have base sequences described in SEQ ID NO: 1 and SEQ ID NO: 2, respectively, and are described in SEQ ID NO: 3 and SEQ ID NO: 4, respectively. It was confirmed that one polypeptide was encoded. A result of comparing the amino acid sequences described in SEQ ID NO: 3 and SEQ ID NO: 4 is shown in FIG. The inventors have registered the base sequence and amino acid sequence as AY312589 and AY312587 in GenBank as of July 2, 2003, respectively.

<실시예 2> 합성 펩타이드의 선발Example 2 Selection of Synthetic Peptides

아미노산 염기 서열 분석을 여러 분석 프로그램을 통해 실시하더라도 실제로 가검 샘플과의 반응성이 있는 펩타이드를 선발하는 것이 더욱 중요하다. 이를 위하여, 본 발명자들은 단백질 분석 프로그램인 Protean(Dnastar)을 이용하여 항원결정기 부위를 포함하는 2C 및 3B 부위를 여러 펩타이드 형태로 제작한 후에 다양한 혈청 판낼(panel)을 이용하여 펩타이드를 스크리닝(screening)함으로써 항원성이 가장 뛰어난 부위를 선발하였다.Even if amino acid sequencing is performed through various analysis programs, it is more important to select peptides that are actually reactive with the sample. To this end, the present inventors used the protein analysis program Protean (Dnastar) to produce 2C and 3B sites including the epitope site in various peptide forms, and then screen the peptides using various serum panels. By doing so, the site having the most antigenicity was selected.

그 결과, 하기 표 2에 기재된 바와 같이, 총 15종의 펩타이드가 구제역 항체 검출을 위한 합성 펩타이드로 선발되었다.As a result, as shown in Table 2 below, a total of 15 peptides were selected as synthetic peptides for the detection of foot and mouth antibodies.

서열번호SEQ ID NO: 단백질protein 아미노산 서열Amino acid sequence 위치 location 55 2C2C LKARDINDIFAILKNGECLKARDINDIFAILKNGEC 1-181-18 66 2C2C QRDLNDPSKYKEAQRDLNDPSKYKEA 54-6654-66 77 2C2C VAPAPSKSRPEPVAPAPSKSRPEP 92-10392-103 88 2C2C GKSGQGKSFLANGKSGQGKSFLAN 110-121110-121 99 2C2C STHFTGRTDSVWYCSTHFTGRTDSVWYC 128-141128-141 1010 2C2C CPDPDHFDGYNQQTCPDPDHFDGYNQQT 143-155143-155 1111 2C2C CMDDLGQNPDGKDFKCMDDLGQNPDGKDFK 159-172159-172 1212 2C2C CLEDKGKPFNSKVICLEDKGKPFNSKVI 190-202190-202 1313 2C2C CVSAKDGYKINNKLCVSAKDGYKINNKL 233-245233-245 1414 2C2C CKALEDTHTNPVAMCKALEDTHTNPVAM 249-261249-261 1515 2C2C CEMKRMQQDMFKPQCEMKRMQQDMFKPQ 275-287275-287 1616 2C2C CEVIDRVELHEKVSSHPCEVIDRVELHEKVSSHP 299-314299-314 1717 2C2C CELHEKVSSHPIFKQCELHEKVSSHPIFKQ 305-318305-318 1818 3B3B GPYTGPLERQKPLKGPYTGPLERQKPLK 1-141-14 1919 3B3B PLKVRAKLPQQEPLKVRAKLPQQE 12-2312-23

다음으로, 구제역 양성 혈청 2점(동물실험을 통해 얻어진 28 DPI 와 56 DPI 혈청), 백신혈청 1점(2000년 발생 당시 채취한 소혈청) 및 음성혈청 1점(제주도에서 채취한 음성혈청)을 이용하여 상기에서 선발된 펩타이드의 항체 결합능을 확인하였다. 구체적으로, 제작된 펩타이드를 Maxisorp 플레이트(Nunc)에 1㎍/㎖의 농도로 코팅한 후, 상기 4종류의 혈청을 이용하여 펩타이드와의 반응성을 조사하였으며, 이때 혈청은 1:100과 1:20으로 희석하여 사용하였다. 그 결과, 항체와의 반응성이 가장 좋은 펩타이드로 서열번호 17 및 서열번호 18로 기재되는 아미노산 서열을 가지는 펩타이드를 선발하였다(도 2).Next, two foot-and-mouth disease positive serum (28 DPI and 56 DPI serum obtained from animal experiments), one vaccine serum (small serum collected at the time of occurrence in 2000) and one negative serum (negative serum taken from Jeju) The antibody binding capacity of the peptide selected above was confirmed. Specifically, the prepared peptide was coated on a Maxisorp plate (Nunc) at a concentration of 1 µg / ml, and then the reactivity with the peptide was examined using the four types of serum, wherein the serum was 1: 100 and 1:20. It was diluted with and used. As a result, a peptide having an amino acid sequence described in SEQ ID NO: 17 and SEQ ID NO: 18 was selected as the peptide having the best reactivity with the antibody (Fig. 2).

<실시예 3> 선발된 펩타이드 2종에 대한 구제역 감염혈청, 백신혈청 및 음성혈청을 이용한 평가 실험Example 3 Evaluation Experiment Using Foot-and-mouth Disease Infected Serum, Vaccine Serum and Negative Serum for Two Selected Peptides

<3-1> 일자별 구제역 감염혈청을 이용한 민감도 측정<3-1> Sensitivity measurement using foot-and-mouth disease serum by date

국내에서 분리한 O/SKR/2000 바이러스를 이용하여 소, 돼지, 양, 염소 등 구제역 감수성 동물에서 일자별 병원성 실험을 통해 확보된 구제역 감염혈청을 이용하여 민감도(sensitivity) 측정 실험을 실시하였다. 먼저, 상기 실시예 2에서 선발된 서열번호 17 및 서열번호 18로 기재되는 2종의 펩타이드를 각각 1㎍/㎖씩 혼합하여 100㎕씩 플레이트(Nunc사)에 분주한 후 4℃에서 최소 10시간 정도 코팅을 실시하였다. 냉장 보관된 플레이트를 계면활성제인 트윈을 함유한 인산완충액(phosphate buffered saline containing Tween 20, PBST)으로 3회 세척하고 흡수지에 깨끗하게 털어준 후, 1% BSA (bovine serum albumin)와 5% 젤라틴(gelatine)이 포함된 PBST에 가검 혈청을 100배 희석하여 시료당 펩타이드가 코팅된 웰에 2 반복, 대조군으로 구제역 바이러스 항체와 반응성이 없는 펩타이드가 코팅된 웰에 2 반복으로하여 각 웰당 100㎕씩 분주하였다. 이때, 양성 대조 혈청과 음성 대조 혈청(국내 분리주 구제역 바이러스에 대한 감염 실험을 통해 확보된 구제역 양성 혈청 28 DPI과 음성혈청 0 DPI를 세계표준 진단법인 중화시험을 통해 역가를 측정하여 사용)을 모든 플레이트에 함께 반응시켜 평가 기준으로 삼았다. 플레이트를 37℃에서 40분간 방치한 후, PBST로 3회 세척하고 흡습지에 깨끗이 털어준 후 퍼옥시다제(peroxidase)가 결합된 콘쥬게이트를 1% BSA와 젤라틴 5%가 함유된 PBST에 2,000배 희석하여 웰당 100㎕씩 분주하였다. 37℃에서 40분간 방치 후 PBST로 3회 세척하였으며, TMB (KPL)를 제조사의 농도대로 100㎕씩 분주하고 실온에서 15분간 가볍게 흔들어 주며 발색시켰다. 15분 후에 1.25M 황산(Sigma) 용액을 첨가하여 반응을 정지시켰다. 발색이 정지된 플레이트 내 반응을 ELISA 판독기(reader)를 이용하여 450nm에서 흡광도를 측정함으로써 펩타이드의 민감도 여부를 판정하였다.Sensitivity measurement experiments were performed using foot-and-mouth disease-derived serum from foot-and-mouth disease-sensitive animals, such as cattle, pigs, sheep and goats, using O / SKR / 2000 virus isolated from Korea. First, 1 µg / ml of the two peptides described in SEQ ID NO: 17 and SEQ ID NO: 18 selected in Example 2 were mixed, and 100 µl was dispensed onto a plate (Nunc), followed by a minimum of 10 hours at 4 ° C. Degree coating was carried out. The refrigerated plates were washed three times with phosphate buffered saline containing Tween 20 (PBST) as a surfactant, and then thoroughly shaken on the blotter paper, followed by 1% BSA (bovine serum albumin) and 5% gelatin (gelatine). ) Diluted 100 times the test serum in PBST containing 2) in the wells coated with peptides per sample and 2 times in the wells coated with peptides that are not reactive with foot-and-mouth virus virus as a control. . At this time, all plates were used as positive control serum and negative control serum (we used 28 foot-and-mouth-positive serum and 0-percent-negative serum obtained through the infection test for domestic isolate foot-and-mouth virus). Reactions together were used as the evaluation criteria. The plate was left at 37 ° C. for 40 minutes, washed three times with PBST, shaken off on a damp paper, and diluted 2,000 times in PBST containing 1% BSA and 5% gelatin. 100 μl / well was dispensed. After standing at 37 ° C. for 40 minutes, washing was performed three times with PBST, and 100 μl of TMB (KPL) was dispensed according to the manufacturer's concentration, followed by light shaking at room temperature for 15 minutes. After 15 minutes the reaction was stopped by the addition of 1.25M sulfuric acid (Sigma) solution. The sensitivity of the peptide was determined by measuring the absorbance at 450 nm using the ELISA reader in which the color stops the reaction.

그 결과, 도 3 내지 도 6에서 알 수 있는 바와 같이, 본 발명의 펩타이드를 사용하였을 때 평균 7-10 DPI에서 구제역 특이 항체를 검출할 수 있었으며, 이는 본 발명의 펩타이드를 사용함으로써 종래의 진단 방법에 비해 3-5DPI 정도 일찍 구제역 항체를 검출할 수 있음을 의미한다.As a result, as can be seen in Figures 3 to 6, when using the peptide of the present invention was able to detect the foot-and-mouth specific antibody at an average of 7-10 DPI, which is a conventional diagnostic method by using the peptide of the present invention This means that it is possible to detect foot-and-mouth disease antibodies as early as 3-5DPI.

<3-2> 구제역 백신 혈청을 이용한 특이도 측정<3-2> Specificity measurement using foot-and-mouth vaccine vaccine

국내에서 2000년 구제역 발생당시 긴급 백신을 접종했던 소에서 채취한 구제역 백신 혈청 327점과 돼지 혈청 96점을 사용하여 백신혈청에 대한 특이도 실험을 상기 실시예 <3-1>의 방법에 따라 실시하였다.Specificity test for vaccine serum was performed using 327 foot-and-mouth vaccine vaccines and 96 pig serum samples collected from cows inoculated with emergency vaccines at the time of foot-and-mouth disease outbreak in 2000 according to the method of Example <3-1>. It was.

그 결과, 도 7 및 도 8에서 알 수 있는 바와 같이, 거의 모든 백신 혈청에서 흡광도 수치가 0.2 이하로 나타났다. 이는 구제역 백신축에 대해 높은 특이도를 나타내는 것으로 구제역 감염축과 백신축에 대해 본 방법을 적용시 감별 가능함을 의미한다.As a result, as can be seen in Figures 7 and 8, almost all vaccine serum showed absorbance values of 0.2 or less. This shows high specificity for the foot-and-mouth disease vaccine axis, which means that the method can be distinguished between the foot-and-mouth disease vaccine and the vaccine axis.

<3-3> 구제역 음성 혈청을 이용한 특이도 측정<3-3> Specificity Measurement Using Foot-and-mouth Negative Serum

국내에서 구제역 비 발생 지역으로부터 확보된 소 및 돼지 음성 혈청 각각 96개를 사용하여 구제역 음성 혈청에 대한 특이도 실험을 상기 실시예 <3-1>의 방법에 따라 실시하였다.Specificity tests for foot-and-mouth negative sera were performed in accordance with the method of Example <3-1> by using 96 bovine and swine negative sera obtained from non-foot-and-mouth disease-producing regions in Korea.

그 결과, 도 9 및 도 10에서 알 수 있는 바와 같이, 거의 모든 음성 혈청에서 흡광도 수치가 0.2 이하로 나타났다. 이는 구제역 음성축에 대해 높은 특이도를 나타내는 것으로 구제역 감염축과 음성축에 대해 본 방법을 적용시 감별 가능함을 의미한다.As a result, as can be seen in Figures 9 and 10, the absorbance value was found to be 0.2 or less in almost all negative sera. This shows a high specificity for the foot and mouth disease axis, which means that it is possible to discriminate between the foot and mouth infection axis and the voice axis.

<비교예> 2C 및 3B 펩타이드를 이용한 효소결합면역측정법 비교Comparative Example Comparison of enzyme-linked immunoassay using 2C and 3B peptides

2000년도 구제역 발생 당시 발생농장에서 확보한 구제역 가검 혈청 98개와 백신접종축으로부터 얻은 백신 혈청 100개를 사용하여 이태리 ELISA 키트(Brecia,ltaly), 영국산 ELISA 키트(Pirbright laboratory, UK), 국내산 3D ELISA 키트(NVRQS, Korea) 및 본 발명의 펩타이드를 이용한 ELISA에 대한 민감도 및 특이도(specificity) 비교 실험을 상기 실시예 <3-1>의 방법에 따라 실시하였다.Italian ELISA kit (Brecia, ltaly), UK ELISA kit (Pirbright laboratory, UK), domestic 3D ELISA using 98 foot-and-mouth disease-tested sera obtained from farms that produced foot-and-mouth disease in 2000 and 100 vaccine sera from the vaccination shaft Sensitivity and specificity comparison experiments for the ELISA using the kit (NVRQS, Korea) and the peptide of the present invention were performed according to the method of Example <3-1>.

그 결과, 구제역 발생 농장으로부터 확보된 96개 가검 혈청에 대한 본 발명의 진단 키트의 양성율이 22%로 나타나 종래의 진단 키트보다 높은 진단 효율을 나타내었으며, 백신 접종축으로부터 얻은 혈청에 대한 특이도 실험에서도 이태리 ELISA와는 동등하게 100%의 특이도를 나타내었고 국내 3D ELISA보다는 월등히 높은 특이도를 나타내었다(표 3).As a result, the positive rate of the diagnostic kit of the present invention with respect to 96 test sera obtained from foot-and-mouth disease-producing farms was 22%, indicating higher diagnostic efficiency than the conventional diagnostic kit, and specificity test for serum obtained from the vaccination axis. Also showed 100% specificity equivalent to that of Italian ELISA and significantly higher specificity than domestic 3D ELISA (Table 3).

2C 및 3B 펩타이드를 이용한 효소결합면역측정법 비교Comparison of Enzyme-linked Immunoassays Using 2C and 3B Peptides 지역area system 본 발명 ELISAInvention ELISA 영국산 ELISA British ELISA 이태리산 ELISAItaly ELISA 국내산 ELISADomestic ELISA 양성positivity 음성voice 양성positivity 음성voice 양성positivity 음성voice 양성positivity 음성voice 구제역 감염지역Foot and mouth disease area 9696 2222 7474 5656 4040 1313 8383 1616 8080 구제역 백신지역Foot-and-mouth disease vaccine area 100100 00 100100 8989 1111 00 100100 2424 7676 민감도responsiveness 22.9%22.9% 73.9%73.9% 13.5%13.5% 16.6%16.6% 특이도Specificity 100100 100100 76%76% 정확도accuracy 62.2%62.2% 57.6%57.6% 46.9%46.9%

상기에서 살펴본 바와 같이, 본 발명의 구제역 진단 키트는 구제역 바이러스에 대한 항체에 특이적으로 결합하는 서열번호 17 및 서열번호 18로 기재되는 펩타이드를 이용하여 구제역바이러스 비구조단백질에 대한 항체 2종을 동시에 검출함으로써 백신 접종축과 야외 감염축에 대한 감별 진단에 보다 효과적으로 사용될 수 있다.As described above, the foot-and-mouth disease diagnostic kit of the present invention simultaneously detects two antibodies to foot-and-mouth virus non-structural proteins using peptides described in SEQ ID NO: 17 and SEQ ID NO: 18 that specifically bind to antibodies to foot-and-mouth virus. This can be used more effectively for differential diagnosis of vaccination and field infections.

도 1은 국내 분리 구제역 바이러스인 O/SKR/2000 및 O/SKR/2002의 전체 아미노산 염기서열을 비교한 것이고,1 is a comparison of the entire amino acid sequence of the isolated foot-and-mouth disease virus O / SKR / 2000 and O / SKR / 2002,

도 2는 합성된 펩타이드를 구제역 감염혈청 2점, 백신혈청 1점, 음성혈청 1점을 이용하여 항체와의 반응성을 스크리닝(screening)한 결과를 보여주는 그래프이고,FIG. 2 is a graph showing the results of screening the reactivity with the antibody using the synthesized peptides using foot and mouth disease infected serum 2 points, vaccine serum 1 point, 1 negative serum,

양성 혈청 1 ; 구제역 감염 28일째에 채취한 혈청,Positive serum 1; Serum collected on day 28 of foot and mouth infection,

양성 혈청 2 ; 구제역 감염 56일째 채취한 혈청,Positive serum 2; Serum collected on day 56 of foot-and-mouth disease infection,

백신 혈청 ; 2000년도 긴급 구제역 백신접종 후 채취한 혈청,Vaccine serum; Serum collected after the 2000 emergency foot-and-mouth disease vaccination,

음성 혈청 ; 구제역의 발생 보고가 없는 지역에서 채취한 혈청Negative serum; Serum collected from area where foot and mouth disease was not reported

도 3은 일자별 소 구제역(O/SKR/2000) 감염혈청에 대한 2C 및 3B 펩타이드 ELISA (enzyme-linked immunosorbent assay)에서의 반응성을 보여주는 그래프이고,3 is a graph showing the reactivity of 2C and 3B peptide enzyme-linked immunosorbent assay (ELISA) against daily bovine foot and mouth disease (O / SKR / 2000) infected serum,

도 4는 일자별 돼지 감염혈청(O/SKR/2000)에 대한 2C 및 3B 펩타이드 ELISA에서의 반응성을 보여주는 그래프이고,FIG. 4 is a graph showing reactivity in 2C and 3B peptide ELISAs for daily porcine infected serum (O / SKR / 2000). FIG.

도 5는 일자별 양 감염혈청(O/SKR/2000)에 대한 2C 및 3B 펩타이드 ELISA에서의 반응성을 보여주는 그래프이고,FIG. 5 is a graph showing the reactivity in 2C and 3B peptide ELISA to sheep infected serum (O / SKR / 2000) by day,

도 6은 일자별 염소 감염혈청(O/SKR/2000)에 대한 2C 및 3B 펩타이드 ELISA에서의 반응성을 보여주는 그래프이고,FIG. 6 is a graph showing reactivity in 2C and 3B peptide ELISA against goat infection serum (O / SKR / 2000) by day,

도 7은 구제역 소 백신혈청에 대한 2C 및 3B 펩타이드 ELISA의 특이도를 측정한 결과를 보여주는 그래프이고,Figure 7 is a graph showing the results of measuring the specificity of 2C and 3B peptide ELISA for foot and mouth bovine vaccine serum,

도 8은 구제역 소 야외 음성 혈청에 대한 2C 및 3B 펩타이드 ELISA의 특이도를 측정한 결과를 보여주는 그래프이고,Figure 8 is a graph showing the results of measuring the specificity of 2C and 3B peptide ELISA for foot-and-mouth bovine field negative sera,

도 9는 구제역 돼지 백신혈청에 대한 2C 및 3B 펩타이드 ELISA의 특이도를 측정한 결과를 보여주는 그래프이고,9 is a graph showing the results of measuring the specificity of 2C and 3B peptide ELISA for foot-and-mouth pig vaccine serum,

도 10은 구제역 돼지 야외 음성 혈청에 대한 2C 및 3B 펩타이드 ELISA의 특이도를 측정한 결과를 보여주는 그래프이다.Figure 10 is a graph showing the results of measuring the specificity of 2C and 3B peptide ELISA for foot-and-mouth pigs negative field serum.

상기 도 3 내지 도 6에 있어서, Y축은 일자별 구제역 감염 혈청에 대한 본 진단법을 이용하여 측정한 흡광도 측정치를 나타내고, X축은 구제역바이러스 감염후 날짜를 나타내며, #은 동물의 개체 번호를 나타낸다.3 to 6, the Y axis represents absorbance measurements measured using the present diagnostic method for the daily foot-and-mouth disease infected serum, the X-axis represents the date after foot-and-mouth disease virus infection, and # represents the animal's individual number.

<110> National Veterinary Research and Quarantine Service <120> Kit for Diagnosis of Foot-and-Mouth Disease Containing Peptide of 2C and 3B Nonstructural Protein of Foot-and-Mouth Disease Virus <130> aaaaa <160> 42 <170> KopatentIn 1.71 <210> 1 <211> 7803 <212> DNA <213> Foot-and-mouth disease virus <400> 1 agttttaccg tctgtcccgg cgttaaaggg aggtaaccac aagcttgcga ctgtcttgct 60 cgacgataaa gggctgtgac cgcaagatga caccgccttt cccggcgtta attggatgta 120 accacaagat gaaccttcac ccggaagtaa aacggtaaat tcgcctagtt ttgcccgttt 180 tcacgagaaa tgggacgtct gcgcacgaaa cgcgccgtcg cttgaggagg acttgtacaa 240 acacggtcca ttcaggtccc cacaaccgac acaaatcgtg caacttgaaa ctccgcctgg 300 tctttccagg tctagagggg tgacattttg tactgtgctt gactccacgc tcggtccact 360 ggcgagtgct agtaacagca ctgctgcttc gtagcggagc atggtggccg cgggaattcc 420 tccttggtaa cagggacccg cggggccgaa agccacgtcc tcacggaccc accatgtgtg 480 caaccccagc acggcaactt tactgtgaaa accactttaa ggtgacactg atactggtac 540 tcaatcactg gtgacaggct aaggatgccc ttcaggtacc ctgaggtaac acgcgacact 600 cgggatcttg agaaggggac tggggcttct ttaaaagcgc ctagtttaaa aagcttctac 660 gcctgaatag gtgaccggag gccggcacct ttcttttaaa caactatttt taatgaacac 720 aaccgactgt ctcaccgctt tgttgtacgc cttcagagag atcaaaacac tgttcttatc 780 acgagcacaa ggaaagatgg agttcacact tcacaacggt gagaagaaaa cattctactc 840 caggcccaac aaccacgaca actgctggct gaacgccatc ctccagttgt ttaggtacgt 900 tgatgaacct ttcttcgact gggtctacta ctcacctgag aacctcacgc tcgatgctat 960 caaacaactg gaaggaatta ctggtctcga gctccacgag ggtggaccac ccgctctcgt 1020 tatttggaac attaaacacc tgctcaacac cggaatcggc accgcttcac gacccaacga 1080 agtgtgcatg gtagatggga cggacatgtg tttggctgac ttccacgctg gcatcttcct 1140 gaaaggacag gaacacgctg tgttcgcctg tgtcacctcc aacgggtggt acgcgattga 1200 tgacgaggac ttttacccct ggacgccgga cccgtctgac gttctggtgt tcgtcccgta 1260 cgaccaacaa ccgctcaacg gagaatggaa agcgaaggtt cagaaacgac tcagaggcgc 1320 cgggcaatcc agcccggcga ctgggtcgca gaaccagtca ggtaacactg gaagcattat 1380 caacaattac tacatgcagc agtaccagaa ctccatggac acgcaacttg gtgacaacgc 1440 tattagtgga ggctccaacg aggggtccac ggacaccacc tccacccaca caaccaacac 1500 tcagaataat gactggtttt caaagctggc cagttccgct tttagcggtc ttttcggcgc 1560 tctcctcgcc gacaagaaaa ccgaggagac cactcttctc gaggaccgca tcctcactac 1620 ccgcaacgga cacacgacct cgacaaccca gtcgagcgtt ggagtcactt acgggtacgc 1680 aacagctgag gacttcgtga gcggaccaaa cacatctggg cttgagacca gggttgtgca 1740 ggcagagcgg ttctttaaaa cccacttgtt cgactgggtc accagtgacc cgttcggacg 1800 gtgctacctg ctggaactcc caactgacca caaaggtgtc tacggcagcc tgaccgactc 1860 ttatgcttac atgagaaacg gttgggacgt tgaggtcact gcagtgggaa atcagttcaa 1920 cggaggatgt ttgttggtgg tcatggtgcc agaactttgc tctattgaca agagagggct 1980 ataccagctc acgctctttc cccaccaatt catcaacccc cagacgaaca tgacggcgca 2040 cattactgtg ccctttgttg gcgtcaaccg ctacgaccag tacaaagtac acaaaccttg 2100 gaccctcgtt gtcatggttg tggccccgct gactgtcaac accgaaggtg ccccacagat 2160 caaggtctat gccaacatcg cccctactaa cgtgcacgtt gcgggtgagc tcccttctaa 2220 ggaagggatc ttccccgtgg catgtagcga cggttacggt ggtctggtga ccactgaccc 2280 aaagacggct gaccccgcct acgggaaagt gttcaatcca cctcgcaaca tgttgccggg 2340 gcggttcacc aacttccttg atgtggctga ggcgtgccct acgttcctgc actttgaggg 2400 tgacgtgccg tacgtgacca caaagacgga ctcagacagg gtactcgccc agtttgactt 2460 gtctctggca gcaaagcaca tgtcaaacac cttcctggca ggtctcgccc agtactacac 2520 acagtacagt ggcaccatca acctgcactt catgttcaca ggacccactg acgcgaaagc 2580 gcgttacatg attgcatacg ccccccctgg catggagccg cccaaaacac ccgaggcggc 2640 cgctcactgc attcatgcgg agtgggacac agggttgaat tcaaaattca cattttcaat 2700 cccttacctt tcggcggctg attatgcgta caccgcgtct gacaccgcgg agaccacaaa 2760 tgtgcagggt tgggtttgcc tgtttcaaat tacacacggg aaggctgacg gcgacgcact 2820 ggtcgttcta gctagcgccg gtaaggattt tgagctgcgt ctgccagttg acgctcgcac 2880 gcagaccacc tccacaggtg agtcggctga ccccgtgact gccaccgttg agaactacgg 2940 tggtgagaca caggtccaga gacgccaaca cacggatgtc tcgttcatac tagacagatt 3000 tgtgaaagta acaccaaaag accaaattaa tgtgttggac ctgatgcaaa tccctgcaca 3060 cactttggta ggcgcgctcc tccgtactgc cacctactac ttcgcagatc tggaagtggc 3120 agtgaaacac gaggggaacc tcacctgggt cccgaacggg gcgcccgagg cagcgttgga 3180 caacaccacc aatccaacgg cctatcacaa ggcgccgctc acccggcttg cactgcctta 3240 cacggcacca caccgtgtct tggctactgt ttacaacggg aactgcaagt atggcgagag 3300 ccccgtgacc aatctgagag gtgacctgca agtgttgacc cagaaggcgg caagaacgct 3360 gcctacctcc ttcaattacg gtgccatcaa agccactcgg gtgactgaac tgctttaccg 3420 catgaagagg gccgaaacat actgcccccg gcctcttttg gctattcacc cgagcgaagc 3480 tagacacaaa caaaagattg tggcgcctgt gaaacagctg ttgaactttg acctgctcaa 3540 gttggcagga gacgtcgagc ccaaccctgg gcccttcttc ttctctgacg tcaggtcaaa 3600 tttttccaag ttggttgaaa ccgtcaacca gatgcaggag gacatgtcaa caaaacacgg 3660 acccgacttt aaccggttgg tgtctgcatt tgaggaactg gccactggag tgaaggccat 3720 caggaccggt ctcgacgagg ccaaaccctg gtacaagctc atcaagctct tgagccgcct 3780 gtcatgtatg gccgctgtag cagcacggtc aaaggaccca ctccttgtgg ccatcatgct 3840 ggctgacacc ggccttgaga tcctggacag tacctttgtc gtgaagaaga tctccgactc 3900 gctctccagt ctctttcacg tgccggcccc cgtcttcagt tccggagccc cgattttgtt 3960 ggccgggttg gtcaaagtcg cctcgagttt cttccggtcc acacccgaag accttgagag 4020 agcggagaaa cagctcaaag cacgtgacat caatgacata ttcgccattc ttaagaacgg 4080 cgagtggccg gtcaagctga ttcttgccat ccgcgactgg atcaaggcat ggatcgcctc 4140 agaagaaaag tttgtcacca tgacagacct ggtgcctggc atccttgaaa agcagcggga 4200 tctcaacgac ccaagcaagt acaaggaggc caaggagtgg ctcgacaacg cgcgccaagc 4260 gtgtctgaag agcgggaaca tccacatcgc aaacctttgc aaagtggttg ccccagcgcc 4320 cagcaggtcg aggcccgaac ccgtggtcgt ttgcctccgt ggcaagtcag gccagggcaa 4380 gagtttcctt gcgaacgtgc ttgcacaagc aatttcaacc cacttcactg gcagaaccga 4440 ttcagtttgg tactgcccac ctgaccctga ccacttcgac ggttacaacc agcagaccgt 4500 tgtagtaatg gatgatttgg gccacaaccc cgacgggaag gacttcaagt acttcgccca 4560 aatggtttca actacggggt ttatcccgcc catggcttca ctagaggata aaggcaaacc 4620 tttcaacagc aaggtcatca tcgccaccac caacctgtac tcgggcttca ccccgagaac 4680 tatggtgtgc cctgatgcac tgaaccgaag gttccacttt gacattgacg tgagcgccaa 4740 ggacgggtac aaaattaaca acaaattgga catcatcaaa gctcttgaag acacccaccc 4800 caacccagtg gcaatgtttc aatacgactg tgcccttctc aacggcatgg ccgttgaaat 4860 gaagagaatg caacaagata tgttcaagcc tcaaccgccc ctccagaacg tctaccagct 4920 tgttcaggag gtgattgacc gggtcgagct ccacgagaag gtgtcgagtc acccgatctt 4980 caagcagatc tcaattcctt cccaaaaggc tgtgctgtac tttctcattg agaaaggcca 5040 gcacgaagca gcaattgaat tctttgaggg gatggtgtgt gactccatca aggaggagct 5100 ccggcctctc atccaacaga cctcatttgt gaagcgcgct tttaagcgcc tgaaggaaaa 5160 ctttgagata gttgccctgt gtttgactct aatggcaaac atagtgatca tgatccgcga 5220 gactcgcaag agacagcaga tggtggatga tgcagtgaac gagtacactg agaaggtaaa 5280 catcaccacg gatgacaaga ctcttgacga ggcggaaaag aaccctctgg aaaccagcgg 5340 tgccaccact gttggtttca gagagaaaac tctcccgggg cacaagacgg gtgatgacgt 5400 gagctccgag cccaccaaac ccgtggaagg acaaccacaa gctgaaggac cctacaccgg 5460 cccactcgag cgtcaaaaac ctctgaaagt gagagccaag ctcccgcagc aggaggggcc 5520 ttatgctggt cccatggaga gacagaaacc actgaaagtg aaagcgaaag ccccggtcgt 5580 taaggaagga ccttacgaag gaccggtgaa gaaacctgtc gctttgaaag tgaaagcaaa 5640 gaacttgatt gtcactgaga gtggtgctcc cccgactgac ttgcaaaaga tggtcatggg 5700 taacaccaag cctgttgagc tcgtcctcga tgggaagacg gtggccatct gctgcgccac 5760 cggagtgttt ggtactgcct accttgttcc tcgtcatctt ttcgcagaga agtatgacaa 5820 gatcatgttg gacggcagag ccatgacaga cagtgactac agagtgtttg agtttgagat 5880 taaagtgaaa ggacaggaca tgctctcaga cgccgcgctc atggtgcttc accgtgggaa 5940 tcgagtgcgg gacatcacga agcacttccg tgatgtggca agaatgaaga aaggcacccc 6000 cgtcgtcggc gtgatcaaca acgctgatgt tgggaggctg atcttctctg gtgaggccct 6060 tacctacaag gacattgtag tgcgcatgga cggagacacc atgcccggtc tcttcgccta 6120 caaagccgcc accaaggcgg gctactgtgg aggatccgtt cttgcaaagg acggagccga 6180 tactttcatc gtcggcactc actccgcagg cggcaatgga gttggatact gctcatgcgt 6240 ttccaggtct atgctgctta aaatgaaggc acacatcgac cccgaaccac accacgaggg 6300 attgatagtt gacaccagag atgttgagga gcgcgtacat gtcatgcgca aaaccaagct 6360 cgcacccacc gtggcacacg gtgtgtttaa ccccgaattt gggcctgccg ccttgtccaa 6420 caagggcccg cgcctgaatg agggggttgt cctcgatgaa gccatcttct ccaaacacaa 6480 aggaaacaca aagatgtctg aggaggacaa agcgctgttc cgccgctgtg ctgctgatta 6540 cgcgtcgcgt ctgcacagtg tgctgggtac ggcaaatgcc ccactgagca tttacgaggc 6600 aatcaagggc gtcgacggac ttgacgccat ggaaccagac accgcgcctg gtctcccttg 6660 ggctctccag gggaaacgcc ggggtgcgct cattgacttc gaaaacggca ctgtcggacc 6720 cgaggttgaa gctgccttga agctcatgga gaaaagagag tacaagtttg tgtgccagac 6780 cttcttgaag gacgagattc gcccgatgga gaaggtacgt gccggtaaga ctcgcattgt 6840 cgacgtcctg cctgttgaac acattcttta caccaggatg atgattggca gattttgtgc 6900 tcaaatgcac tcaaacaacg gaccgcaaat tggctcggcg gttggttgta atcctgatgt 6960 tgattggcaa agatttggca cgcactttgc tcagtacaga aacgtgtggg atgtagacta 7020 ttcggccttc gacgccaacc actgcagtga cgcaatgaac atcatgcttg aggaggtgtt 7080 caacacggat ttcggtttcc acccaaacgc tgagtggatc ctgaaaaccc tcgtgaacac 7140 tgaacacgcc tatgagaaca aacgcatcac tgttgaaggc gggatgccgt ctggttgttc 7200 cgcgacaagc atcatcaaca caattttgaa caacatctac gtgctctacg ccttgcgtag 7260 acactacgag ggagtcgagc tggactctta caccatgatc tcctacggag acgacatcgt 7320 ggttgcaagt gatcacgatc tggactttga ggccctcaag cctcacttca aatcccttgg 7380 tcaaaccatc actccagctg acaaaagcga caaaggtttt gttcttggtc actccattac 7440 cgatgtcact ttcctcaaaa gacacttcca catggactat ggaactgggt tttacaaacc 7500 tgtgatggct tcgaagaccc tcgaagctat cctctccttt gcacgtcgtg ggaccataca 7560 ggagaagttg atctccgtgg caggacttgc cgtccactct ggacctgacg agtaccggcg 7620 tctctttgag cctttccagg gtctctttga gattccaagc tacagatcac tttacctgcg 7680 ttgggtgaac cccgtgtgcg gtgacgcata atccctcaga tgtcacaatt ggcagaaaga 7740 cgctgaggcg agcgacgccg taggagtgga aagtccgaaa gggtttttcc cgcttcctat 7800 ttc 7803 <210> 2 <211> 7799 <212> DNA <213> Foot-and-mouth disease virus <400> 2 agttttaccg tcgttcccgg cgttaaaggg aggtaaccac aagcttgcaa ctgtcttgct 60 cgacgataaa gggctgtgac cgcaagatga taccgccttc ccggcgttaa ttggatgcaa 120 ccacaagatg aaccttcacc cggaagtaaa acggcacatt cgcctagttt tacccgtttt 180 caggagaaat gggacgtccg cgcacgaaac gcgccgtcgc ttgaggagga cttgtacaaa 240 cacgatatat tcaggttccc acaaccgaca caaaccgtgc aacctgaaac tccgcctggt 300 ctttccaggt ctagaggggt gacattttgt actgtgcttg actccacgct cggtccactg 360 gcgagtgcta gtaacagcac tgttgcttcg tagcggagca tggtggccgc gggaactcct 420 ccttggtaac agggacccgc ggggccgaaa gccacgtcct cacggaccca ccatgtgtgc 480 aaccccagca cggcaacttt actgtggaaa ccactttaag gtgacactga tactggtact 540 caaccactgg tgacaggcta aggatgccct tcaggtaccc tgaggtaaca cgcgacactc 600 gggatctgag aaggggactg gggcttcttt aaaagcgcct agtttaaaaa gcttctacgc 660 ctgaataggt gaccggaggc cggcaccttt cttttaaaca actactttta atgagcacaa 720 ctgactgttt catcgctttg ttgtacgctt tcagagagat taaaacactg ttcttatcac 780 gagcacaagg aaagatggag ttcacacttc acaacggtga gaagaaaaca ttctactcca 840 ggcccaacaa ccacgacaac tgctggctga acaccatcct ccagttgttt aggtacgttg 900 atgaaccttt cttcgactgg gtctactact cacctgagaa cctcacgctt gatgctatca 960 aacaattgga agaaattact ggtctcgaac tccaggaggg tggaccaccc gctctcgtta 1020 tttggaacat taaacacctg ctcaacaccg gaatcggcac cgcttcacga cccaacgaag 1080 tgtgcatggt agacgggacg gacatgtgtt tggctgactt ccacgctggc atcttcctga 1140 aaggacagga acacgctgtg ttcgcctgcg tcacctccaa cgggtggtac gcgattgacg 1200 ataaggactt ttacccctgg acgccggacc cgtccgacgt tctggtgttt gtcccgtacg 1260 atcaagaacc gctcaacgga gaatggaaag caagggttca gaaacgactc agaggcgccg 1320 ggcaatccag cccggcgact gggtcacaga accagtcagg caacactgga agcatcatca 1380 acaattacta catgcagcag taccagaact ccatggacac gcaacttggt gacgacgcta 1440 ttagcggagg ctccaacgag gggtccacgg acaccacttc cactcacaca accaacactc 1500 agaacaatga ctggttctca aagctggcca gttccgcttt tagcggtctt ttcggcgctc 1560 ttctcgccga taagaaaacc gaggagacca ctcttctcga ggaccgcatc ctcactaccc 1620 gcaacgggca cacgacctcg acaacccagt cgagcgttgg agtcacttac gggtacgcaa 1680 cagccgagga ctttgtgagc ggaccaaaca catctgggct cgagaccagg gttgtgcagg 1740 cagagcggtt cttcaaaacc cacttgttcg actgggtcac cagtgacccg ttcggacggt 1800 gctacctgct ggaactccca actgaccaca aaggtgtcta cggcagcctg actgactctt 1860 atgcttacat gagaaacggt tgggttgttg aggtcactgc agtgggaaat cagttcaacg 1920 gaggatgtcc gttggtggcc atggtgccag aacattgctc tattgacaag agagagctgt 1980 accagctcac gctctttccc caccagttca tcaacccccg gacgaacatg acggcgcaca 2040 tcactgtgcc ctttgttggt gtcaatcgct acgaccagta caaggtacac aaaccttgga 2100 ccctcgtggt tatggttgtg gccccgctga ctgtcaacac cgaaggtgcc ccacagacca 2160 aggtctacgc caacatcgcc cctaccaacg tgtacgttgc gggtgagttc ccttccaagg 2220 aagggatctt ccccgtggca tgtagcgacg gttacggtgg tctggtgacc actgacccaa 2280 agacggctga ccccgcctac gggaaagtgt tcaatccacc tcgcaacatg ttgccggggc 2340 ggttcaccaa cttccttgat gtggctgagg cgtgccctac gtttctgcac tttgagggtg 2400 acgtgccgta cgtgaccaca aagacggact cagacagggt gctcgcccag tttgacttgt 2460 ctctggcagc aaaacacatg tcaaacacct tcctggcggg tctcgcccag tactacacac 2520 agtacagtgg caccatcaac ctgcacttca tgttcacagg acccactgac gcgaaagcgc 2580 gttacatgat tgcatacgcc ccccctggca tggagccgcc caaaacacct gaggcggccg 2640 ctcactgcat tcatgcggag tgggacacag ggttgaattc aaaattcaca ttttcaatcc 2700 cttacctttc ggcggctgat tacgcgtaca ccgcgtctga tgctgcggag accacaaatg 2760 tacagggttg ggtttgcctg tttcaaatta cacacgggaa ggctgacggc gacgcactgg 2820 tcgttctagc tagcgccggc aaggactttg agctgcgtct gccagttgac gctcgcacgc 2880 agaccacctc cacaggtgag tcggctgacc ccgtgactgc cactgttgag aactacggtg 2940 gtgagacaca ggtccagaga cgccaacaca cggatgtctc gttcatatta gacagatttg 3000 tgaaagtaac accaaaagac caaattaatg tgttggacct gatgcaaacc cctgcacaca 3060 ctttggtagg cgcgctcctc cgtactgcca cctactactt cgcagatcta gaagtggcag 3120 tgaaacacga ggggaacctt acctgggtcc cgaacggggc gcccgagaca gcgttggaca 3180 acaccaccaa tccaacggcc taccacaagg caccgctcac ccggcttgca ctgccttaca 3240 cggcaccaca ccgtgtcttg gctactgttt acaacgggaa ctgcaagtat ggcgagggcc 3300 ccgtgaccaa tgtgagaggt gacctgcaag tattggccca gaaggcggca agaacgctgc 3360 ctacctcctt caactacggt gccatcaaag ccactcgggt gactgaactg ctttaccgca 3420 tgaagagggc cgaaacatac tgtccccggc ctcttttggc tattcacccg agcgaagcta 3480 gacacaaaca aaagattgtg gcgcctgtga aacagcttct gaactttgac ctgctcaagt 3540 tggcaggaga cgtcgagtcc aaccctgggc ctttcttctt ctctgacgtc aggtcaaatt 3600 tttccaagtt ggttgaaacc atcaaccaga tgcaggagga catgtcaaca aaacacggac 3660 ccgactttaa ccggttggtg tctgcatttg aggaactggc cactggagtg aaggctatca 3720 ggaccggtct cgatgaggcc aaaccctggt acaagctcat caagctcttg agccgcctgt 3780 catgcatggc cgctgtagca gcacggtcaa aggacccagt ccttgtggcc atcatgctgg 3840 ctgacaccgg ccttgagatt ctggacagta cctttgtcgt gaagaagatc tccgactcgc 3900 tctccagtct ctttcacgtg ccggcccccg tcttcagttt cggagccccg attttgttgg 3960 ccgggttggt caaagtcgcc tcgactttct tccggtccac acccgaggac cttgagagag 4020 cggagaaaca gctcaaagca cgtgacatca atgacatatt cgccattctc aagaacggcg 4080 agtggttggt caagctgatt cttgccatcc gcgactggat caaggcatgg atcgcctcag 4140 aagaaaaatt tgtcaccatg acagacctgg tacctggcat ccttgaaaag cagcgggatc 4200 ttaacgaccc aagcaagtac aaggaggcca aggagtggct cgacaacgcg cgccaagcgt 4260 gtttgaagag cgggaacatc cacattgcaa acctttgtaa agtagttgcc ccagcaccca 4320 gcaggtcgag gcctgaaccc gtggtcgttt gcctccgtgg caaatcgggc cagggcaaga 4380 gtttccttgc gaacgtgctt gcacaagcaa tttcaaccca cttcactggc agaaccgatt 4440 cagtttggta ctgcccacct gaccctgacc acttcgacgg ttacaaccag cagaccgttg 4500 tagtaatgga tgatttgggc cagaaccccg acgggaagga cttcaaatac ttcgcccaaa 4560 tggtttcaac tacggggttt atcccgccca tggcttcact cgaggacaaa ggcaaacctt 4620 tcaacagcaa ggtcatcatc gccaccacca acctgtactc gggcttcacc ccgagaacta 4680 tggtgtgccc tgatgcactg aaccgaaggt tccactttga cattgacgtg agcgccaagg 4740 acgggtacaa aattaacaac aaattggaca tcaccaaagc tcttgaagat acccacacca 4800 acccagtggc aatgtttcaa tacgactgtg cccttctcaa cggcatggcc gttgagatga 4860 agagaatgca acaagatatg ttcaagcctc aaccgcccct ccagaacgtc taccagcttg 4920 ttcaggaggt gattgaccgg gtcgagctcc acgagaaggt gtcgagtcac ccgatcttca 4980 agcagatctc aataccttcc caaaaggctg tgctgtactt tctcattgag aagggccagc 5040 acgatgcagc aattgaattc tttgagggga tggtgcatga ctccatcaag gaggagctcc 5100 ggcctctcat ccaacagacc tcatttgtga agcgcgcttt taagcgcctg aaggaaaact 5160 ttgaggtagt tgccctgtgt ttgacccttt tggcaaacat agtgatcatg atccgcgaga 5220 ctcgcaagag acagcagatg gtggatgacg cagtgaacga gtacattgag aaggcaaaca 5280 tcaccacgga tgacaagact cttgacgagg cggaaaagaa ccctctggag accagcggtg 5340 ccaccactgt tggttttaga gagaaaactc tcccgggaca caaggcgagt gacgacgtga 5400 actccgagcc cgccaaaccc gcggaagaac aaccacaagc tgaaggaccc tacaccggtc 5460 cactcgagcg tcaaaaacct ctgaaagtga gagccaagct cccacagcag gaggggccct 5520 acgctggtcc gatggagaga cagaaaccgc tgaaagtgaa agtgaaagcc ccggttgtta 5580 aggaaggacc ttacgaagga ccggtgaaga aacctgtcgc tttgaaagtg aaagcaaaga 5640 acttgattgt cactgagagt ggtgctcccc cgactgactt gcaaaagatg gtcatgggta 5700 acaccaagcc tgttgagctc atcctcgacg ggaagacggt ggccatctgt tgcgccaccg 5760 gagtgtttgg tactgcttac cttgtccctc gtcatctttt cgcagagaag tatgacaaga 5820 tcatgttgga cggcagagcc atgacagaca gtgactacag agtgtttgag tttgagatta 5880 aagtgaaagg acaggacatg ctctcagacg ccgcgctcat ggtgcttcac cgtgggaatc 5940 gcgtgcggga catcacgaag cacttccgtg atgtggcaag aatgaagaaa ggcacccccg 6000 tcgtcggcgt ggtcaacaac gctgatgttg ggagactgat cttctctggt gaggccctta 6060 cctacaagga cattgtagtg tgcatggacg gagacaccat gcccggtctc ttcgcctaca 6120 aagccgccac caaggcgggt tactgtggag gagccgttct tgcaaaggac ggagccgaga 6180 ctttcatcgt cggcactcac tccgcaggcg gcaatggggt tggatactgc tcatgcgttt 6240 ccaggtctat gctgcttaaa atgaaggcac acatcgatcc cgaaccacac cacgagggat 6300 tgatagttga caccagagat gttgaggagc gcgtacatgt catgcgcaaa accaagctcg 6360 cacccaccgt ggcacacggt gtgtttaacc ccgaatttgg gcctgccgcc ttgtccaaca 6420 aggacccgcg cctgaatgag ggggttgccc tcgatgaagc catcttctcc aaacacaagg 6480 gaaacacaaa gatgtctgag gaggacaaag cgctgttccg ccgctgtgct gctgactacg 6540 cgtcgcgtct gcatagcgtg ctgggtacgg caaacgcccc actgagcatt tacgaggcaa 6600 tcaagggcgt cgacggactt gacgccatgg aaccagacac cgcgcctggt ttaccctggg 6660 ctctccaggg gaaacgccgt ggtgcgctca ttgactttga gaacggcaca atcggacccg 6720 aggttgaagc tgccttgaag ctcatggaga aaagagagta caagtttgta tgtcagacct 6780 tcctgaagga cgagattcgc ccgatggaga aggtacgtgc cggcaagact cgcattgtcg 6840 acgtcctgcc tgttgaacac actctttaca ccaggatgat gattggcaga ttttgtgctc 6900 aaatgcactc aaacaacgga ccgcaaattg gctcggcggt tgggtgtaat cctgatgttg 6960 attggcaaag atttggcacg cattttgctc agtacagaaa cgtgtgggat gtagactatt 7020 cggcctttga tgccaaccac tgcagtgacg caatgaacat catgtttgag gaggtgttca 7080 acacggattt cggtttccac ccaaacgctg agtggatcct gaaaactctc gtgaacactg 7140 aacacgccta tgagaacaaa cgcatcactg ttgaaggcgg gatgccgtct ggttgttccg 7200 caacaagcat catcaacaca attttgaaca acatctacgt gctctacgcc ttgcgtaggc 7260 actatgaggg agttgagctg gactcttaca ccatgatctc ctacggagac gacatcgtgg 7320 ttgcaagtga ttacgatctg gactttgagg ccctcaagcc tcacttcaaa tcccttggtc 7380 aaaccattac tccagctgac aaaagcgaca aaggttttgt tcttggtcac tccattaccg 7440 atgtcacttt cctcaaaaga tctttccaca tggactatgg aactgggttt tacaaacctg 7500 tgatggcttc gaagaccctc gaggctatcc tctcctttgc acgccgtggg accatacagg 7560 agaagttgat ctccgtggca ggactcgccg tccactctgg acctgacgag taccggcgtc 7620 tctttgagcc cttccagggt ctctttgaga ttccaagcta cagatcgctt tacctgcgtt 7680 gggtgaacgc cgtgtgcggt gacgcataat ccctcagatg tcacaattgg cagaaagacg 7740 ctgaggcgag cggcgccgta ggagtgaaaa gtccgaaagg gtttttcccg cttcctttc 7799 <210> 3 <211> 2332 <212> PRT <213> Foot-and-mouth disease virus <400> 3 Met Asn Thr Thr Asp Cys Leu Thr Ala Leu Leu Tyr Ala Phe Arg Glu 1 5 10 15 Ile Lys Thr Leu Phe Leu Ser Arg Ala Gln Gly Lys Met Glu Phe Thr 20 25 30 Leu His Asn Gly Glu Lys Lys Thr Phe Tyr Ser Arg Pro Asn Asn His 35 40 45 Asp Asn Cys Trp Leu Asn Ala Ile Leu Gln Leu Phe Arg Tyr Val Asp 50 55 60 Glu Pro Phe Phe Asp Trp Val Tyr Tyr Ser Pro Glu Asn Leu Thr Leu 65 70 75 80 Asp Ala Ile Lys Gln Leu Glu Gly Ile Thr Gly Leu Glu Leu His Glu 85 90 95 Gly Gly Pro Pro Ala Leu Val Ile Trp Asn Ile Lys His Leu Leu Asn 100 105 110 Thr Gly Ile Gly Thr Ala Ser Arg Pro Asn Glu Val Cys Met Val Asp 115 120 125 Gly Thr Asp Met Cys Leu Ala Asp Phe His Ala Gly Ile Phe Leu Lys 130 135 140 Gly Gln Glu His Ala Val Phe Ala Cys Val Thr Ser Asn Gly Trp Tyr 145 150 155 160 Ala Ile Asp Asp Glu Asp Phe Tyr Pro Trp Thr Pro Asp Pro Ser Asp 165 170 175 Val Leu Val Phe Val Pro Tyr Asp Gln Gln Pro Leu Asn Gly Glu Trp 180 185 190 Lys Ala Lys Val Gln Lys Arg Leu Arg Gly Ala Gly Gln Ser Ser Pro 195 200 205 Ala Thr Gly Ser Gln Asn Gln Ser Gly Asn Thr Gly Ser Ile Ile Asn 210 215 220 Asn Tyr Tyr Met Gln Gln Tyr Gln Asn Ser Met Asp Thr Gln Leu Gly 225 230 235 240 Asp Asn Ala Ile Ser Gly Gly Ser Asn Glu Gly Ser Thr Asp Thr Thr 245 250 255 Ser Thr His Thr Thr Asn Thr Gln Asn Asn Asp Trp Phe Ser Lys Leu 260 265 270 Ala Ser Ser Ala Phe Ser Gly Leu Phe Gly Ala Leu Leu Ala Asp Lys 275 280 285 Lys Thr Glu Glu Thr Thr Leu Leu Glu Asp Arg Ile Leu Thr Thr Arg 290 295 300 Asn Gly His Thr Thr Ser Thr Thr Gln Ser Ser Val Gly Val Thr Tyr 305 310 315 320 Gly Tyr Ala Thr Ala Glu Asp Phe Val Ser Gly Pro Asn Thr Ser Gly 325 330 335 Leu Glu Thr Arg Val Val Gln Ala Glu Arg Phe Phe Lys Thr His Leu 340 345 350 Phe Asp Trp Val Thr Ser Asp Pro Phe Gly Arg Cys Tyr Leu Leu Glu 355 360 365 Leu Pro Thr Asp His Lys Gly Val Tyr Gly Ser Leu Thr Asp Ser Tyr 370 375 380 Ala Tyr Met Arg Asn Gly Trp Asp Val Glu Val Thr Ala Val Gly Asn 385 390 395 400 Gln Phe Asn Gly Gly Cys Leu Leu Val Val Met Val Pro Glu Leu Cys 405 410 415 Ser Ile Asp Lys Arg Gly Leu Tyr Gln Leu Thr Leu Phe Pro His Gln 420 425 430 Phe Ile Asn Pro Gln Thr Asn Met Thr Ala His Ile Thr Val Pro Phe 435 440 445 Val Gly Val Asn Arg Tyr Asp Gln Tyr Lys Val His Lys Pro Trp Thr 450 455 460 Leu Val Val Met Val Val Ala Pro Leu Thr Val Asn Thr Glu Gly Ala 465 470 475 480 Pro Gln Ile Lys Val Tyr Ala Asn Ile Ala Pro Thr Asn Val His Val 485 490 495 Ala Gly Glu Leu Pro Ser Lys Glu Gly Ile Phe Pro Val Ala Cys Ser 500 505 510 Asp Gly Tyr Gly Gly Leu Val Thr Thr Asp Pro Lys Thr Ala Asp Pro 515 520 525 Ala Tyr Gly Lys Val Phe Asn Pro Pro Arg Asn Met Leu Pro Gly Arg 530 535 540 Phe Thr Asn Phe Leu Asp Val Ala Glu Ala Cys Pro Thr Phe Leu His 545 550 555 560 Phe Glu Gly Asp Val Pro Tyr Val Thr Thr Lys Thr Asp Ser Asp Arg 565 570 575 Val Leu Ala Gln Phe Asp Leu Ser Leu Ala Ala Lys His Met Ser Asn 580 585 590 Thr Phe Leu Ala Gly Leu Ala Gln Tyr Tyr Thr Gln Tyr Ser Gly Thr 595 600 605 Ile Asn Leu His Phe Met Phe Thr Gly Pro Thr Asp Ala Lys Ala Arg 610 615 620 Tyr Met Ile Ala Tyr Ala Pro Pro Gly Met Glu Pro Pro Lys Thr Pro 625 630 635 640 Glu Ala Ala Ala His Cys Ile His Ala Glu Trp Asp Thr Gly Leu Asn 645 650 655 Ser Lys Phe Thr Phe Ser Ile Pro Tyr Leu Ser Ala Ala Asp Tyr Ala 660 665 670 Tyr Thr Ala Ser Asp Thr Ala Glu Thr Thr Asn Val Gln Gly Trp Val 675 680 685 Cys Leu Phe Gln Ile Thr His Gly Lys Ala Asp Gly Asp Ala Leu Val 690 695 700 Val Leu Ala Ser Ala Gly Lys Asp Phe Glu Leu Arg Leu Pro Val Asp 705 710 715 720 Ala Arg Thr Gln Thr Thr Ser Thr Gly Glu Ser Ala Asp Pro Val Thr 725 730 735 Ala Thr Val Glu Asn Tyr Gly Gly Glu Thr Gln Val Gln Arg Arg Gln 740 745 750 His Thr Asp Val Ser Phe Ile Leu Asp Arg Phe Val Lys Val Thr Pro 755 760 765 Lys Asp Gln Ile Asn Val Leu Asp Leu Met Gln Ile Pro Ala His Thr 770 775 780 Leu Val Gly Ala Leu Leu Arg Thr Ala Thr Tyr Tyr Phe Ala Asp Leu 785 790 795 800 Glu Val Ala Val Lys His Glu Gly Asn Leu Thr Trp Val Pro Asn Gly 805 810 815 Ala Pro Glu Ala Ala Leu Asp Asn Thr Thr Asn Pro Thr Ala Tyr His 820 825 830 Lys Ala Pro Leu Thr Arg Leu Ala Leu Pro Tyr Thr Ala Pro His Arg 835 840 845 Val Leu Ala Thr Val Tyr Asn Gly Asn Cys Lys Tyr Gly Glu Ser Pro 850 855 860 Val Thr Asn Leu Arg Gly Asp Leu Gln Val Leu Thr Gln Lys Ala Ala 865 870 875 880 Arg Thr Leu Pro Thr Ser Phe Asn Tyr Gly Ala Ile Lys Ala Thr Arg 885 890 895 Val Thr Glu Leu Leu Tyr Arg Met Lys Arg Ala Glu Thr Tyr Cys Pro 900 905 910 Arg Pro Leu Leu Ala Ile His Pro Ser Glu Ala Arg His Lys Gln Lys 915 920 925 Ile Val Ala Pro Val Lys Gln Leu Leu Asn Phe Asp Leu Leu Lys Leu 930 935 940 Ala Gly Asp Val Glu Pro Asn Pro Gly Pro Phe Phe Phe Ser Asp Val 945 950 955 960 Arg Ser Asn Phe Ser Lys Leu Val Glu Thr Val Asn Gln Met Gln Glu 965 970 975 Asp Met Ser Thr Lys His Gly Pro Asp Phe Asn Arg Leu Val Ser Ala 980 985 990 Phe Glu Glu Leu Ala Thr Gly Val Lys Ala Ile Arg Thr Gly Leu Asp 995 1000 1005 Glu Ala Lys Pro Trp Tyr Lys Leu Ile Lys Leu Leu Ser Arg Leu Ser 1010 1015 1020 Cys Met Ala Ala Val Ala Ala Arg Ser Lys Asp Pro Leu Leu Val Ala 1025 1030 1035 1040 Ile Met Leu Ala Asp Thr Gly Leu Glu Ile Leu Asp Ser Thr Phe Val 1045 1050 1055 Val Lys Lys Ile Ser Asp Ser Leu Ser Ser Leu Phe His Val Pro Ala 1060 1065 1070 Pro Val Phe Ser Ser Gly Ala Pro Ile Leu Leu Ala Gly Leu Val Lys 1075 1080 1085 Val Ala Ser Ser Phe Phe Arg Ser Thr Pro Glu Asp Leu Glu Arg Ala 1090 1095 1100 Glu Lys Gln Leu Lys Ala Arg Asp Ile Asn Asp Ile Phe Ala Ile Leu 1105 1110 1115 1120 Lys Asn Gly Glu Trp Pro Val Lys Leu Ile Leu Ala Ile Arg Asp Trp 1125 1130 1135 Ile Lys Ala Trp Ile Ala Ser Glu Glu Lys Phe Val Thr Met Thr Asp 1140 1145 1150 Leu Val Pro Gly Ile Leu Glu Lys Gln Arg Asp Leu Asn Asp Pro Ser 1155 1160 1165 Lys Tyr Lys Glu Ala Lys Glu Trp Leu Asp Asn Ala Arg Gln Ala Cys 1170 1175 1180 Leu Lys Ser Gly Asn Ile His Ile Ala Asn Leu Cys Lys Val Val Ala 1185 1190 1195 1200 Pro Ala Pro Ser Arg Ser Arg Pro Glu Pro Val Val Val Cys Leu Arg 1205 1210 1215 Gly Lys Ser Gly Gln Gly Lys Ser Phe Leu Ala Asn Val Leu Ala Gln 1220 1225 1230 Ala Ile Ser Thr His Phe Thr Gly Arg Thr Asp Ser Val Trp Tyr Cys 1235 1240 1245 Pro Pro Asp Pro Asp His Phe Asp Gly Tyr Asn Gln Gln Thr Val Val 1250 1255 1260 Val Met Asp Asp Leu Gly His Asn Pro Asp Gly Lys Asp Phe Lys Tyr 1265 1270 1275 1280 Phe Ala Gln Met Val Ser Thr Thr Gly Phe Ile Pro Pro Met Ala Ser 1285 1290 1295 Leu Glu Asp Lys Gly Lys Pro Phe Asn Ser Lys Val Ile Ile Ala Thr 1300 1305 1310 Thr Asn Leu Tyr Ser Gly Phe Thr Pro Arg Thr Met Val Cys Pro Asp 1315 1320 1325 Ala Leu Asn Arg Arg Phe His Phe Asp Ile Asp Val Ser Ala Lys Asp 1330 1335 1340 Gly Tyr Lys Ile Asn Asn Lys Leu Asp Ile Ile Lys Ala Leu Glu Asp 1345 1350 1355 1360 Thr His Pro Asn Pro Val Ala Met Phe Gln Tyr Asp Cys Ala Leu Leu 1365 1370 1375 Asn Gly Met Ala Val Glu Met Lys Arg Met Gln Gln Asp Met Phe Lys 1380 1385 1390 Pro Gln Pro Pro Leu Gln Asn Val Tyr Gln Leu Val Gln Glu Val Ile 1395 1400 1405 Asp Arg Val Glu Leu His Glu Lys Val Ser Ser His Pro Ile Phe Lys 1410 1415 1420 Gln Ile Ser Ile Pro Ser Gln Lys Ala Val Leu Tyr Phe Leu Ile Glu 1425 1430 1435 1440 Lys Gly Gln His Glu Ala Ala Ile Glu Phe Phe Glu Gly Met Val Cys 1445 1450 1455 Asp Ser Ile Lys Glu Glu Leu Arg Pro Leu Ile Gln Gln Thr Ser Phe 1460 1465 1470 Val Lys Arg Ala Phe Lys Arg Leu Lys Glu Asn Phe Glu Ile Val Ala 1475 1480 1485 Leu Cys Leu Thr Leu Met Ala Asn Ile Val Ile Met Ile Arg Glu Thr 1490 1495 1500 Arg Lys Arg Gln Gln Met Val Asp Asp Ala Val Asn Glu Tyr Thr Glu 1505 1510 1515 1520 Lys Val Asn Ile Thr Thr Asp Asp Lys Thr Leu Asp Glu Ala Glu Lys 1525 1530 1535 Asn Pro Leu Glu Thr Ser Gly Ala Thr Thr Val Gly Phe Arg Glu Lys 1540 1545 1550 Thr Leu Pro Gly His Lys Thr Gly Asp Asp Val Ser Ser Glu Pro Thr 1555 1560 1565 Lys Pro Val Glu Gly Gln Pro Gln Ala Glu Gly Pro Tyr Thr Gly Pro 1570 1575 1580 Leu Glu Arg Gln Lys Pro Leu Lys Val Arg Ala Lys Leu Pro Gln Gln 1585 1590 1595 1600 Glu Gly Pro Tyr Ala Gly Pro Met Glu Arg Gln Lys Pro Leu Lys Val 1605 1610 1615 Lys Ala Lys Ala Pro Val Val Lys Glu Gly Pro Tyr Glu Gly Pro Val 1620 1625 1630 Lys Lys Pro Val Ala Leu Lys Val Lys Ala Lys Asn Leu Ile Val Thr 1635 1640 1645 Glu Ser Gly Ala Pro Pro Thr Asp Leu Gln Lys Met Val Met Gly Asn 1650 1655 1660 Thr Lys Pro Val Glu Leu Val Leu Asp Gly Lys Thr Val Ala Ile Cys 1665 1670 1675 1680 Cys Ala Thr Gly Val Phe Gly Thr Ala Tyr Leu Val Pro Arg His Leu 1685 1690 1695 Phe Ala Glu Lys Tyr Asp Lys Ile Met Leu Asp Gly Arg Ala Met Thr 1700 1705 1710 Asp Ser Asp Tyr Arg Val Phe Glu Phe Glu Ile Lys Val Lys Gly Gln 1715 1720 1725 Asp Met Leu Ser Asp Ala Ala Leu Met Val Leu His Arg Gly Asn Arg 1730 1735 1740 Val Arg Asp Ile Thr Lys His Phe Arg Asp Val Ala Arg Met Lys Lys 1745 1750 1755 1760 Gly Thr Pro Val Val Gly Val Ile Asn Asn Ala Asp Val Gly Arg Leu 1765 1770 1775 Ile Phe Ser Gly Glu Ala Leu Thr Tyr Lys Asp Ile Val Val Arg Met 1780 1785 1790 Asp Gly Asp Thr Met Pro Gly Leu Phe Ala Tyr Lys Ala Ala Thr Lys 1795 1800 1805 Ala Gly Tyr Cys Gly Gly Ser Val Leu Ala Lys Asp Gly Ala Asp Thr 1810 1815 1820 Phe Ile Val Gly Thr His Ser Ala Gly Gly Asn Gly Val Gly Tyr Cys 1825 1830 1835 1840 Ser Cys Val Ser Arg Ser Met Leu Leu Lys Met Lys Ala His Ile Asp 1845 1850 1855 Pro Glu Pro His His Glu Gly Leu Ile Val Asp Thr Arg Asp Val Glu 1860 1865 1870 Glu Arg Val His Val Met Arg Lys Thr Lys Leu Ala Pro Thr Val Ala 1875 1880 1885 His Gly Val Phe Asn Pro Glu Phe Gly Pro Ala Ala Leu Ser Asn Lys 1890 1895 1900 Gly Pro Arg Leu Asn Glu Gly Val Val Leu Asp Glu Ala Ile Phe Ser 1905 1910 1915 1920 Lys His Lys Gly Asn Thr Lys Met Ser Glu Glu Asp Lys Ala Leu Phe 1925 1930 1935 Arg Arg Cys Ala Ala Asp Tyr Ala Ser Arg Leu His Ser Val Leu Gly 1940 1945 1950 Thr Ala Asn Ala Pro Leu Ser Ile Tyr Glu Ala Ile Lys Gly Val Asp 1955 1960 1965 Gly Leu Asp Ala Met Glu Pro Asp Thr Ala Pro Gly Leu Pro Trp Ala 1970 1975 1980 Leu Gln Gly Lys Arg Arg Gly Ala Leu Ile Asp Phe Glu Asn Gly Thr 1985 1990 1995 2000 Val Gly Pro Glu Val Glu Ala Ala Leu Lys Leu Met Glu Lys Arg Glu 2005 2010 2015 Tyr Lys Phe Val Cys Gln Thr Phe Leu Lys Asp Glu Ile Arg Pro Met 2020 2025 2030 Glu Lys Val Arg Ala Gly Lys Thr Arg Ile Val Asp Val Leu Pro Val 2035 2040 2045 Glu His Ile Leu Tyr Thr Arg Met Met Ile Gly Arg Phe Cys Ala Gln 2050 2055 2060 Met His Ser Asn Asn Gly Pro Gln Ile Gly Ser Ala Val Gly Cys Asn 2065 2070 2075 2080 Pro Asp Val Asp Trp Gln Arg Phe Gly Thr His Phe Ala Gln Tyr Arg 2085 2090 2095 Asn Val Trp Asp Val Asp Tyr Ser Ala Phe Asp Ala Asn His Cys Ser 2100 2105 2110 Asp Ala Met Asn Ile Met Leu Glu Glu Val Phe Asn Thr Asp Phe Gly 2115 2120 2125 Phe His Pro Asn Ala Glu Trp Ile Leu Lys Thr Leu Val Asn Thr Glu 2130 2135 2140 His Ala Tyr Glu Asn Lys Arg Ile Thr Val Glu Gly Gly Met Pro Ser 2145 2150 2155 2160 Gly Cys Ser Ala Thr Ser Ile Ile Asn Thr Ile Leu Asn Asn Ile Tyr 2165 2170 2175 Val Leu Tyr Ala Leu Arg Arg His Tyr Glu Gly Val Glu Leu Asp Ser 2180 2185 2190 Tyr Thr Met Ile Ser Tyr Gly Asp Asp Ile Val Val Ala Ser Asp His 2195 2200 2205 Asp Leu Asp Phe Glu Ala Leu Lys Pro His Phe Lys Ser Leu Gly Gln 2210 2215 2220 Thr Ile Thr Pro Ala Asp Lys Ser Asp Lys Gly Phe Val Leu Gly His 2225 2230 2235 2240 Ser Ile Thr Asp Val Thr Phe Leu Lys Arg His Phe His Met Asp Tyr 2245 2250 2255 Gly Thr Gly Phe Tyr Lys Pro Val Met Ala Ser Lys Thr Leu Glu Ala 2260 2265 2270 Ile Leu Ser Phe Ala Arg Arg Gly Thr Ile Gln Glu Lys Leu Ile Ser 2275 2280 2285 Val Ala Gly Leu Ala Val His Ser Gly Pro Asp Glu Tyr Arg Arg Leu 2290 2295 2300 Phe Glu Pro Phe Gln Gly Leu Phe Glu Ile Pro Ser Tyr Arg Ser Leu 2305 2310 2315 2320 Tyr Leu Arg Trp Val Asn Pro Val Cys Gly Asp Ala 2325 2330 <210> 4 <211> 2332 <212> PRT <213> Foot-and-mouth disease virus <400> 4 Met Ser Thr Thr Asp Cys Phe Ile Ala Leu Leu Tyr Ala Phe Arg Glu 1 5 10 15 Ile Lys Thr Leu Phe Leu Ser Arg Ala Gln Gly Lys Met Glu Phe Thr 20 25 30 Leu His Asn Gly Glu Lys Lys Thr Phe Tyr Ser Arg Pro Asn Asn His 35 40 45 Asp Asn Cys Trp Leu Asn Thr Ile Leu Gln Leu Phe Arg Tyr Val Asp 50 55 60 Glu Pro Phe Phe Asp Trp Val Tyr Tyr Ser Pro Glu Asn Leu Thr Leu 65 70 75 80 Asp Ala Ile Lys Gln Leu Glu Glu Ile Thr Gly Leu Glu Leu Gln Glu 85 90 95 Gly Gly Pro Pro Ala Leu Val Ile Trp Asn Ile Lys His Leu Leu Asn 100 105 110 Thr Gly Ile Gly Thr Ala Ser Arg Pro Asn Glu Val Cys Met Val Asp 115 120 125 Gly Thr Asp Met Cys Leu Ala Asp Phe His Ala Gly Ile Phe Leu Lys 130 135 140 Gly Gln Glu His Ala Val Phe Ala Cys Val Thr Ser Asn Gly Trp Tyr 145 150 155 160 Ala Ile Asp Asp Lys Asp Phe Tyr Pro Trp Thr Pro Asp Pro Ser Asp 165 170 175 Val Leu Val Phe Val Pro Tyr Asp Gln Glu Pro Leu Asn Gly Glu Trp 180 185 190 Lys Ala Arg Val Gln Lys Arg Leu Arg Gly Ala Gly Gln Ser Ser Pro 195 200 205 Ala Thr Gly Ser Gln Asn Gln Ser Gly Asn Thr Gly Ser Ile Ile Asn 210 215 220 Asn Tyr Tyr Met Gln Gln Tyr Gln Asn Ser Met Asp Thr Gln Leu Gly 225 230 235 240 Asp Asp Ala Ile Ser Gly Gly Ser Asn Glu Gly Ser Thr Asp Thr Thr 245 250 255 Ser Thr His Thr Thr Asn Thr Gln Asn Asn Asp Trp Phe Ser Lys Leu 260 265 270 Ala Ser Ser Ala Phe Ser Gly Leu Phe Gly Ala Leu Leu Ala Asp Lys 275 280 285 Lys Thr Glu Glu Thr Thr Leu Leu Glu Asp Arg Ile Leu Thr Thr Arg 290 295 300 Asn Gly His Thr Thr Ser Thr Thr Gln Ser Ser Val Gly Val Thr Tyr 305 310 315 320 Gly Tyr Ala Thr Ala Glu Asp Phe Val Ser Gly Pro Asn Thr Ser Gly 325 330 335 Leu Glu Thr Arg Val Val Gln Ala Glu Arg Phe Phe Lys Thr His Leu 340 345 350 Phe Asp Trp Val Thr Ser Asp Pro Phe Gly Arg Cys Tyr Leu Leu Glu 355 360 365 Leu Pro Thr Asp His Lys Gly Val Tyr Gly Ser Leu Thr Asp Ser Tyr 370 375 380 Ala Tyr Met Arg Asn Gly Trp Val Val Glu Val Thr Ala Val Gly Asn 385 390 395 400 Gln Phe Asn Gly Gly Cys Pro Leu Val Ala Met Val Pro Glu His Cys 405 410 415 Ser Ile Asp Lys Arg Glu Leu Tyr Gln Leu Thr Leu Phe Pro His Gln 420 425 430 Phe Ile Asn Pro Arg Thr Asn Met Thr Ala His Ile Thr Val Pro Phe 435 440 445 Val Gly Val Asn Arg Tyr Asp Gln Tyr Lys Val His Lys Pro Trp Thr 450 455 460 Leu Val Val Met Val Val Ala Pro Leu Thr Val Asn Thr Glu Gly Ala 465 470 475 480 Pro Gln Thr Lys Val Tyr Ala Asn Ile Ala Pro Thr Asn Val Tyr Val 485 490 495 Ala Gly Glu Phe Pro Ser Lys Glu Gly Ile Phe Pro Val Ala Cys Ser 500 505 510 Asp Gly Tyr Gly Gly Leu Val Thr Thr Asp Pro Lys Thr Ala Asp Pro 515 520 525 Ala Tyr Gly Lys Val Phe Asn Pro Pro Arg Asn Met Leu Pro Gly Arg 530 535 540 Phe Thr Asn Phe Leu Asp Val Ala Glu Ala Cys Pro Thr Phe Leu His 545 550 555 560 Phe Glu Gly Asp Val Pro Tyr Val Thr Thr Lys Thr Asp Ser Asp Arg 565 570 575 Val Leu Ala Gln Phe Asp Leu Ser Leu Ala Ala Lys His Met Ser Asn 580 585 590 Thr Phe Leu Ala Gly Leu Ala Gln Tyr Tyr Thr Gln Tyr Ser Gly Thr 595 600 605 Ile Asn Leu His Phe Met Phe Thr Gly Pro Thr Asp Ala Lys Ala Arg 610 615 620 Tyr Met Ile Ala Tyr Ala Pro Pro Gly Met Glu Pro Pro Lys Thr Pro 625 630 635 640 Glu Ala Ala Ala His Cys Ile His Ala Glu Trp Asp Thr Gly Leu Asn 645 650 655 Ser Lys Phe Thr Phe Ser Ile Pro Tyr Leu Ser Ala Ala Asp Tyr Ala 660 665 670 Tyr Thr Ala Ser Asp Ala Ala Glu Thr Thr Asn Val Gln Gly Trp Val 675 680 685 Cys Leu Phe Gln Ile Thr His Gly Lys Ala Asp Gly Asp Ala Leu Val 690 695 700 Val Leu Ala Ser Ala Gly Lys Asp Phe Glu Leu Arg Leu Pro Val Asp 705 710 715 720 Ala Arg Thr Gln Thr Thr Ser Thr Gly Glu Ser Ala Asp Pro Val Thr 725 730 735 Ala Thr Val Glu Asn Tyr Gly Gly Glu Thr Gln Val Gln Arg Arg Gln 740 745 750 His Thr Asp Val Ser Phe Ile Leu Asp Arg Phe Val Lys Val Thr Pro 755 760 765 Lys Asp Gln Ile Asn Val Leu Asp Leu Met Gln Thr Pro Ala His Thr 770 775 780 Leu Val Gly Ala Leu Leu Arg Thr Ala Thr Tyr Tyr Phe Ala Asp Leu 785 790 795 800 Glu Val Ala Val Lys His Glu Gly Asn Leu Thr Trp Val Pro Asn Gly 805 810 815 Ala Pro Glu Thr Ala Leu Asp Asn Thr Thr Asn Pro Thr Ala Tyr His 820 825 830 Lys Ala Pro Leu Thr Arg Leu Ala Leu Pro Tyr Thr Ala Pro His Arg 835 840 845 Val Leu Ala Thr Val Tyr Asn Gly Asn Cys Lys Tyr Gly Glu Gly Pro 850 855 860 Val Thr Asn Val Arg Gly Asp Leu Gln Val Leu Ala Gln Lys Ala Ala 865 870 875 880 Arg Thr Leu Pro Thr Ser Phe Asn Tyr Gly Ala Ile Lys Ala Thr Arg 885 890 895 Val Thr Glu Leu Leu Tyr Arg Met Lys Arg Ala Glu Thr Tyr Cys Pro 900 905 910 Arg Pro Leu Leu Ala Ile His Pro Ser Glu Ala Arg His Lys Gln Lys 915 920 925 Ile Val Ala Pro Val Lys Gln Leu Leu Asn Phe Asp Leu Leu Lys Leu 930 935 940 Ala Gly Asp Val Glu Ser Asn Pro Gly Pro Phe Phe Phe Ser Asp Val 945 950 955 960 Arg Ser Asn Phe Ser Lys Leu Val Glu Thr Ile Asn Gln Met Gln Glu 965 970 975 Asp Met Ser Thr Lys His Gly Pro Asp Phe Asn Arg Leu Val Ser Ala 980 985 990 Phe Glu Glu Leu Ala Thr Gly Val Lys Ala Ile Arg Thr Gly Leu Asp 995 1000 1005 Glu Ala Lys Pro Trp Tyr Lys Leu Ile Lys Leu Leu Ser Arg Leu Ser 1010 1015 1020 Cys Met Ala Ala Val Ala Ala Arg Ser Lys Asp Pro Val Leu Val Ala 1025 1030 1035 1040 Ile Met Leu Ala Asp Thr Gly Leu Glu Ile Leu Asp Ser Thr Phe Val 1045 1050 1055 Val Lys Lys Ile Ser Asp Ser Leu Ser Ser Leu Phe His Val Pro Ala 1060 1065 1070 Pro Val Phe Ser Phe Gly Ala Pro Ile Leu Leu Ala Gly Leu Val Lys 1075 1080 1085 Val Ala Ser Thr Phe Phe Arg Ser Thr Pro Glu Asp Leu Glu Arg Ala 1090 1095 1100 Glu Lys Gln Leu Lys Ala Arg Asp Ile Asn Asp Ile Phe Ala Ile Leu 1105 1110 1115 1120 Lys Asn Gly Glu Trp Leu Val Lys Leu Ile Leu Ala Ile Arg Asp Trp 1125 1130 1135 Ile Lys Ala Trp Ile Ala Ser Glu Glu Lys Phe Val Thr Met Thr Asp 1140 1145 1150 Leu Val Pro Gly Ile Leu Glu Lys Gln Arg Asp Leu Asn Asp Pro Ser 1155 1160 1165 Lys Tyr Lys Glu Ala Lys Glu Trp Leu Asp Asn Ala Arg Gln Ala Cys 1170 1175 1180 Leu Lys Ser Gly Asn Ile His Ile Ala Asn Leu Cys Lys Val Val Ala 1185 1190 1195 1200 Pro Ala Pro Ser Arg Ser Arg Pro Glu Pro Val Val Val Cys Leu Arg 1205 1210 1215 Gly Lys Ser Gly Gln Gly Lys Ser Phe Leu Ala Asn Val Leu Ala Gln 1220 1225 1230 Ala Ile Ser Thr His Phe Thr Gly Arg Thr Asp Ser Val Trp Tyr Cys 1235 1240 1245 Pro Pro Asp Pro Asp His Phe Asp Gly Tyr Asn Gln Gln Thr Val Val 1250 1255 1260 Val Met Asp Asp Leu Gly Gln Asn Pro Asp Gly Lys Asp Phe Lys Tyr 1265 1270 1275 1280 Phe Ala Gln Met Val Ser Thr Thr Gly Phe Ile Pro Pro Met Ala Ser 1285 1290 1295 Leu Glu Asp Lys Gly Lys Pro Phe Asn Ser Lys Val Ile Ile Ala Thr 1300 1305 1310 Thr Asn Leu Tyr Ser Gly Phe Thr Pro Arg Thr Met Val Cys Pro Asp 1315 1320 1325 Ala Leu Asn Arg Arg Phe His Phe Asp Ile Asp Val Ser Ala Lys Asp 1330 1335 1340 Gly Tyr Lys Ile Asn Asn Lys Leu Asp Ile Thr Lys Ala Leu Glu Asp 1345 1350 1355 1360 Thr His Thr Asn Pro Val Ala Met Phe Gln Tyr Asp Cys Ala Leu Leu 1365 1370 1375 Asn Gly Met Ala Val Glu Met Lys Arg Met Gln Gln Asp Met Phe Lys 1380 1385 1390 Pro Gln Pro Pro Leu Gln Asn Val Tyr Gln Leu Val Gln Glu Val Ile 1395 1400 1405 Asp Arg Val Glu Leu His Glu Lys Val Ser Ser His Pro Ile Phe Lys 1410 1415 1420 Gln Ile Ser Ile Pro Ser Gln Lys Ala Val Leu Tyr Phe Leu Ile Glu 1425 1430 1435 1440 Lys Gly Gln His Asp Ala Ala Ile Glu Phe Phe Glu Gly Met Val His 1445 1450 1455 Asp Ser Ile Lys Glu Glu Leu Arg Pro Leu Ile Gln Gln Thr Ser Phe 1460 1465 1470 Val Lys Arg Ala Phe Lys Arg Leu Lys Glu Asn Phe Glu Val Val Ala 1475 1480 1485 Leu Cys Leu Thr Leu Leu Ala Asn Ile Val Ile Met Ile Arg Glu Thr 1490 1495 1500 Arg Lys Arg Gln Gln Met Val Asp Asp Ala Val Asn Glu Tyr Ile Glu 1505 1510 1515 1520 Lys Ala Asn Ile Thr Thr Asp Asp Lys Thr Leu Asp Glu Ala Glu Lys 1525 1530 1535 Asn Pro Leu Glu Thr Ser Gly Ala Thr Thr Val Gly Phe Arg Glu Lys 1540 1545 1550 Thr Leu Pro Gly His Lys Ala Ser Asp Asp Val Asn Ser Glu Pro Ala 1555 1560 1565 Lys Pro Ala Glu Glu Gln Pro Gln Ala Glu Gly Pro Tyr Thr Gly Pro 1570 1575 1580 Leu Glu Arg Gln Lys Pro Leu Lys Val Arg Ala Lys Leu Pro Gln Gln 1585 1590 1595 1600 Glu Gly Pro Tyr Ala Gly Pro Met Glu Arg Gln Lys Pro Leu Lys Val 1605 1610 1615 Lys Val Lys Ala Pro Val Val Lys Glu Gly Pro Tyr Glu Gly Pro Val 1620 1625 1630 Lys Lys Pro Val Ala Leu Lys Val Lys Ala Lys Asn Leu Ile Val Thr 1635 1640 1645 Glu Ser Gly Ala Pro Pro Thr Asp Leu Gln Lys Met Val Met Gly Asn 1650 1655 1660 Thr Lys Pro Val Glu Leu Ile Leu Asp Gly Lys Thr Val Ala Ile Cys 1665 1670 1675 1680 Cys Ala Thr Gly Val Phe Gly Thr Ala Tyr Leu Val Pro Arg His Leu 1685 1690 1695 Phe Ala Glu Lys Tyr Asp Lys Ile Met Leu Asp Gly Arg Ala Met Thr 1700 1705 1710 Asp Ser Asp Tyr Arg Val Phe Glu Phe Glu Ile Lys Val Lys Gly Gln 1715 1720 1725 Asp Met Leu Ser Asp Ala Ala Leu Met Val Leu His Arg Gly Asn Arg 1730 1735 1740 Val Arg Asp Ile Thr Lys His Phe Arg Asp Val Ala Arg Met Lys Lys 1745 1750 1755 1760 Gly Thr Pro Val Val Gly Val Val Asn Asn Ala Asp Val Gly Arg Leu 1765 1770 1775 Ile Phe Ser Gly Glu Ala Leu Thr Tyr Lys Asp Ile Val Val Cys Met 1780 1785 1790 Asp Gly Asp Thr Met Pro Gly Leu Phe Ala Tyr Lys Ala Ala Thr Lys 1795 1800 1805 Ala Gly Tyr Cys Gly Gly Ala Val Leu Ala Lys Asp Gly Ala Glu Thr 1810 1815 1820 Phe Ile Val Gly Thr His Ser Ala Gly Gly Asn Gly Val Gly Tyr Cys 1825 1830 1835 1840 Ser Cys Val Ser Arg Ser Met Leu Leu Lys Met Lys Ala His Ile Asp 1845 1850 1855 Pro Glu Pro His His Glu Gly Leu Ile Val Asp Thr Arg Asp Val Glu 1860 1865 1870 Glu Arg Val His Val Met Arg Lys Thr Lys Leu Ala Pro Thr Val Ala 1875 1880 1885 His Gly Val Phe Asn Pro Glu Phe Gly Pro Ala Ala Leu Ser Asn Lys 1890 1895 1900 Asp Pro Arg Leu Asn Glu Gly Val Ala Leu Asp Glu Ala Ile Phe Ser 1905 1910 1915 1920 Lys His Lys Gly Asn Thr Lys Met Ser Glu Glu Asp Lys Ala Leu Phe 1925 1930 1935 Arg Arg Cys Ala Ala Asp Tyr Ala Ser Arg Leu His Ser Val Leu Gly 1940 1945 1950 Thr Ala Asn Ala Pro Leu Ser Ile Tyr Glu Ala Ile Lys Gly Val Asp 1955 1960 1965 Gly Leu Asp Ala Met Glu Pro Asp Thr Ala Pro Gly Leu Pro Trp Ala 1970 1975 1980 Leu Gln Gly Lys Arg Arg Gly Ala Leu Ile Asp Phe Glu Asn Gly Thr 1985 1990 1995 2000 Ile Gly Pro Glu Val Glu Ala Ala Leu Lys Leu Met Glu Lys Arg Glu 2005 2010 2015 Tyr Lys Phe Val Cys Gln Thr Phe Leu Lys Asp Glu Ile Arg Pro Met 2020 2025 2030 Glu Lys Val Arg Ala Gly Lys Thr Arg Ile Val Asp Val Leu Pro Val 2035 2040 2045 Glu His Thr Leu Tyr Thr Arg Met Met Ile Gly Arg Phe Cys Ala Gln 2050 2055 2060 Met His Ser Asn Asn Gly Pro Gln Ile Gly Ser Ala Val Gly Cys Asn 2065 2070 2075 2080 Pro Asp Val Asp Trp Gln Arg Phe Gly Thr His Phe Ala Gln Tyr Arg 2085 2090 2095 Asn Val Trp Asp Val Asp Tyr Ser Ala Phe Asp Ala Asn His Cys Ser 2100 2105 2110 Asp Ala Met Asn Ile Met Phe Glu Glu Val Phe Asn Thr Asp Phe Gly 2115 2120 2125 Phe His Pro Asn Ala Glu Trp Ile Leu Lys Thr Leu Val Asn Thr Glu 2130 2135 2140 His Ala Tyr Glu Asn Lys Arg Ile Thr Val Glu Gly Gly Met Pro Ser 2145 2150 2155 2160 Gly Cys Ser Ala Thr Ser Ile Ile Asn Thr Ile Leu Asn Asn Ile Tyr 2165 2170 2175 Val Leu Tyr Ala Leu Arg Arg His Tyr Glu Gly Val Glu Leu Asp Ser 2180 2185 2190 Tyr Thr Met Ile Ser Tyr Gly Asp Asp Ile Val Val Ala Ser Asp Tyr 2195 2200 2205 Asp Leu Asp Phe Glu Ala Leu Lys Pro His Phe Lys Ser Leu Gly Gln 2210 2215 2220 Thr Ile Thr Pro Ala Asp Lys Ser Asp Lys Gly Phe Val Leu Gly His 2225 2230 2235 2240 Ser Ile Thr Asp Val Thr Phe Leu Lys Arg Ser Phe His Met Asp Tyr 2245 2250 2255 Gly Thr Gly Phe Tyr Lys Pro Val Met Ala Ser Lys Thr Leu Glu Ala 2260 2265 2270 Ile Leu Ser Phe Ala Arg Arg Gly Thr Ile Gln Glu Lys Leu Ile Ser 2275 2280 2285 Val Ala Gly Leu Ala Val His Ser Gly Pro Asp Glu Tyr Arg Arg Leu 2290 2295 2300 Phe Glu Pro Phe Gln Gly Leu Phe Glu Ile Pro Ser Tyr Arg Ser Leu 2305 2310 2315 2320 Tyr Leu Arg Trp Val Asn Ala Val Cys Gly Asp Ala 2325 2330 <210> 5 <211> 18 <212> PRT <213> Foot-and-mouth disease virus <400> 5 Leu Lys Ala Arg Asp Ile Asn Asp Ile Phe Ala Ile Leu Lys Asn Gly 1 5 10 15 Glu Cys <210> 6 <211> 13 <212> PRT <213> Foot-and-mouth disease virus <400> 6 Gln Arg Asp Leu Asn Asp Pro Ser Lys Tyr Lys Glu Ala 1 5 10 <210> 7 <211> 12 <212> PRT <213> Foot-and-mouth disease virus <400> 7 Val Ala Pro Ala Pro Ser Lys Ser Arg Pro Glu Pro 1 5 10 <210> 8 <211> 12 <212> PRT <213> Foot-and-mouth disease virus <400> 8 Gly Lys Ser Gly Gln Gly Lys Ser Phe Leu Ala Asn 1 5 10 <210> 9 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 9 Ser Thr His Phe Thr Gly Arg Thr Asp Ser Val Trp Tyr Cys 1 5 10 <210> 10 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 10 Cys Pro Asp Pro Asp His Phe Asp Gly Tyr Asn Gln Gln Thr 1 5 10 <210> 11 <211> 15 <212> PRT <213> Foot-and-mouth disease virus <400> 11 Cys Met Asp Asp Leu Gly Gln Asn Pro Asp Gly Lys Asp Phe Lys 1 5 10 15 <210> 12 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 12 Cys Leu Glu Asp Lys Gly Lys Pro Phe Asn Ser Lys Val Ile 1 5 10 <210> 13 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 13 Cys Val Ser Ala Lys Asp Gly Tyr Lys Ile Asn Asn Lys Leu 1 5 10 <210> 14 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 14 Cys Lys Ala Leu Glu Asp Thr His Thr Asn Pro Val Ala Met 1 5 10 <210> 15 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 15 Cys Glu Met Lys Arg Met Gln Gln Asp Met Phe Lys Pro Gln 1 5 10 <210> 16 <211> 17 <212> PRT <213> Foot-and-mouth disease virus <400> 16 Cys Glu Val Ile Asp Arg Val Glu Leu His Glu Lys Val Ser Ser His 1 5 10 15 Pro <210> 17 <211> 15 <212> PRT <213> Foot-and-mouth disease virus <400> 17 Cys Glu Leu His Glu Lys Val Ser Ser His Pro Ile Phe Lys Gln 1 5 10 15 <210> 18 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 18 Gly Pro Tyr Thr Gly Pro Leu Glu Arg Gln Lys Pro Leu Lys 1 5 10 <210> 19 <211> 12 <212> PRT <213> Foot-and-mouth disease virus <400> 19 Pro Leu Lys Val Arg Ala Lys Leu Pro Gln Gln Glu 1 5 10 <210> 20 <211> 17 <212> DNA <213> Artificial Sequence <220> <223> rever primer for synthesis of virus cDNA <400> 20 gttttcccag tcacgac 17 <210> 21 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 1 position of the virus genome <400> 21 ttgaaagggg gcgctagggt c 21 <210> 22 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 368 position of the virus genome <400> 22 tgaaaggcgg gtttcgggtg 20 <210> 23 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 369 position of the virus genome <400> 23 aagttttacc gtctgtcccg 20 <210> 24 <211> 19 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 658 position of the virus genome <400> 24 ttgttaccaa ggaggagtt 19 <210> 25 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 665 position of the virus genome <400> 25 cctggtcttt ccaggtctag 20 <210> 26 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 1654 position of the virus genome <400> 26 tcaccaagct gtgtgttcca t 21 <210> 27 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 1749 position of the virus genome <400> 27 tcaacaatta ctacatgcag c 21 <210> 28 <211> 23 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 2907 position of the virus genome <400> 28 gtgccactgt actgtgttgt agt 23 <210> 29 <211> 18 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 2810 position of the virus genome <400> 29 gtgctcgccc agtttgac 18 <210> 30 <211> 19 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 3727 position of the virus genome <400> 30 gctgcctacc tccttcaat 19 <210> 31 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 3998 position of the virus genome <400> 31 cagatgcagg aggacatgtg 20 <210> 32 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 4109 position of the virus genome <400> 32 gagcttgtac cagggtttgg c 21 <210> 33 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 4482 position of the virus genome <400> 33 ccaagccttc atccagtcgc 20 <210> 34 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 5339 position of the virus genome <400> 34 gtgtcgagcc acccgatttt c 21 <210> 35 <211> 17 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 5836 position of the virus genome <400> 35 ggtttctgac gctcgag 17 <210> 36 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 5833 position of the virus genome <400> 36 ccactcgagc gtcagaaacc 20 <210> 37 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 6649 position of the virus genome <400> 37 ctcgtggtgt ggttcggggt c 21 <210> 38 <211> 22 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 6263 position of the virus genome <400> 38 gacaggacat gctctcagac gc 22 <210> 39 <211> 22 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 7519 position of the virus genome <400> 39 gatgcgtttg ttctcatagg cg 22 <210> 40 <211> 19 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 7481 position of the virus genome <400> 40 gctgagtgga tcctgaaac 19 <210> 41 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 8068 position of the virus genome <400> 41 ggattatgcg tcaccgcaca 20 <210> 42 <211> 17 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 8155 position of the virus genome <400> 42 gttttcccag tcacgac 17<110> National Veterinary Research and Quarantine Service <120> Kit for Diagnosis of Foot-and-Mouth Disease Containing Peptide of 2C and 3B Nonstructural Protein of Foot-and-Mouth Disease Virus <130> aaaaa <160> 42 <170> KopatentIn 1.71 <210> 1 <211> 7803 <212> DNA <213> Foot-and-mouth disease virus <400> 1 agttttaccg tctgtcccgg cgttaaaggg aggtaaccac aagcttgcga ctgtcttgct 60 cgacgataaa gggctgtgac cgcaagatga caccgccttt cccggcgtta attggatgta 120 accacaagat gaaccttcac ccggaagtaa aacggtaaat tcgcctagtt ttgcccgttt 180 tcacgagaaa tgggacgtct gcgcacgaaa cgcgccgtcg cttgaggagg acttgtacaa 240 acacggtcca ttcaggtccc cacaaccgac acaaatcgtg caacttgaaa ctccgcctgg 300 tctttccagg tctagagggg tgacattttg tactgtgctt gactccacgc tcggtccact 360 ggcgagtgct agtaacagca ctgctgcttc gtagcggagc atggtggccg cgggaattcc 420 tccttggtaa cagggacccg cggggccgaa agccacgtcc tcacggaccc accatgtgtg 480 caaccccagc acggcaactt tactgtgaaa accactttaa ggtgacactg atactggtac 540 tcaatcactg gtgacaggct aaggatgccc ttcaggtacc ctgaggtaac acgcgacact 600 cgggatcttg agaaggggac tggggcttct ttaaaagcgc ctagtttaaa aagcttctac 660 gcctgaatag gtgaccggag gccggcacct ttcttttaaa caactatttt taatgaacac 720 aaccgactgt ctcaccgctt tgttgtacgc cttcagagag atcaaaacac tgttcttatc 780 acgagcacaa ggaaagatgg agttcacact tcacaacggt gagaagaaaa cattctactc 840 caggcccaac aaccacgaca actgctggct gaacgccatc ctccagttgt ttaggtacgt 900 tgatgaacct ttcttcgact gggtctacta ctcacctgag aacctcacgc tcgatgctat 960 caaacaactg gaaggaatta ctggtctcga gctccacgag ggtggaccac ccgctctcgt 1020 tatttggaac attaaacacc tgctcaacac cggaatcggc accgcttcac gacccaacga 1080 agtgtgcatg gtagatggga cggacatgtg tttggctgac ttccacgctg gcatcttcct 1140 gaaaggacag gaacacgctg tgttcgcctg tgtcacctcc aacgggtggt acgcgattga 1200 tgacgaggac ttttacccct ggacgccgga cccgtctgac gttctggtgt tcgtcccgta 1260 cgaccaacaa ccgctcaacg gagaatggaa agcgaaggtt cagaaacgac tcagaggcgc 1320 cgggcaatcc agcccggcga ctgggtcgca gaaccagtca ggtaacactg gaagcattat 1380 caacaattac tacatgcagc agtaccagaa ctccatggac acgcaacttg gtgacaacgc 1440 tattagtgga ggctccaacg aggggtccac ggacaccacc tccacccaca caaccaacac 1500 tcagaataat gactggtttt caaagctggc cagttccgct tttagcggtc ttttcggcgc 1560 tctcctcgcc gacaagaaaa ccgaggagac cactcttctc gaggaccgca tcctcactac 1620 ccgcaacgga cacacgacct cgacaaccca gtcgagcgtt ggagtcactt acgggtacgc 1680 aacagctgag gacttcgtga gcggaccaaa cacatctggg cttgagacca gggttgtgca 1740 ggcagagcgg ttctttaaaa cccacttgtt cgactgggtc accagtgacc cgttcggacg 1800 gtgctacctg ctggaactcc caactgacca caaaggtgtc tacggcagcc tgaccgactc 1860 ttatgcttac atgagaaacg gttgggacgt tgaggtcact gcagtgggaa atcagttcaa 1920 cggaggatgt ttgttggtgg tcatggtgcc agaactttgc tctattgaca agagagggct 1980 ataccagctc acgctctttc cccaccaatt catcaacccc cagacgaaca tgacggcgca 2040 cattactgtg ccctttgttg gcgtcaaccg ctacgaccag tacaaagtac acaaaccttg 2100 gaccctcgtt gtcatggttg tggccccgct gactgtcaac accgaaggtg ccccacagat 2160 caaggtctat gccaacatcg cccctactaa cgtgcacgtt gcgggtgagc tcccttctaa 2220 ggaagggatc ttccccgtgg catgtagcga cggttacggt ggtctggtga ccactgaccc 2280 aaagacggct gaccccgcct acgggaaagt gttcaatcca cctcgcaaca tgttgccggg 2340 gcggttcacc aacttccttg atgtggctga ggcgtgccct acgttcctgc actttgaggg 2400 tgacgtgccg tacgtgacca caaagacgga ctcagacagg gtactcgccc agtttgactt 2460 gtctctggca gcaaagcaca tgtcaaacac cttcctggca ggtctcgccc agtactacac 2520 acagtacagt ggcaccatca acctgcactt catgttcaca ggacccactg acgcgaaagc 2580 gcgttacatg attgcatacg ccccccctgg catggagccg cccaaaacac ccgaggcggc 2640 cgctcactgc attcatgcgg agtgggacac agggttgaat tcaaaattca cattttcaat 2700 cccttacctt tcggcggctg attatgcgta caccgcgtct gacaccgcgg agaccacaaa 2760 tgtgcagggt tgggtttgcc tgtttcaaat tacacacggg aaggctgacg gcgacgcact 2820 ggtcgttcta gctagcgccg gtaaggattt tgagctgcgt ctgccagttg acgctcgcac 2880 gcagaccacc tccacaggtg agtcggctga ccccgtgact gccaccgttg agaactacgg 2940 tggtgagaca caggtccaga gacgccaaca cacggatgtc tcgttcatac tagacagatt 3000 tgtgaaagta acaccaaaag accaaattaa tgtgttggac ctgatgcaaa tccctgcaca 3060 cactttggta ggcgcgctcc tccgtactgc cacctactac ttcgcagatc tggaagtggc 3120 agtgaaacac gaggggaacc tcacctgggt cccgaacggg gcgcccgagg cagcgttgga 3180 caacaccacc aatccaacgg cctatcacaa ggcgccgctc acccggcttg cactgcctta 3240 cacggcacca caccgtgtct tggctactgt ttacaacggg aactgcaagt atggcgagag 3300 ccccgtgacc aatctgagag gtgacctgca agtgttgacc cagaaggcgg caagaacgct 3360 gcctacctcc ttcaattacg gtgccatcaa agccactcgg gtgactgaac tgctttaccg 3420 catgaagagg gccgaaacat actgcccccg gcctcttttg gctattcacc cgagcgaagc 3480 tagacacaaa caaaagattg tggcgcctgt gaaacagctg ttgaactttg acctgctcaa 3540 gttggcagga gacgtcgagc ccaaccctgg gcccttcttc ttctctgacg tcaggtcaaa 3600 tttttccaag ttggttgaaa ccgtcaacca gatgcaggag gacatgtcaa caaaacacgg 3660 acccgacttt aaccggttgg tgtctgcatt tgaggaactg gccactggag tgaaggccat 3720 caggaccggt ctcgacgagg ccaaaccctg gtacaagctc atcaagctct tgagccgcct 3780 gtcatgtatg gccgctgtag cagcacggtc aaaggaccca ctccttgtgg ccatcatgct 3840 ggctgacacc ggccttgaga tcctggacag tacctttgtc gtgaagaaga tctccgactc 3900 gctctccagt ctctttcacg tgccggcccc cgtcttcagt tccggagccc cgattttgtt 3960 ggccgggttg gtcaaagtcg cctcgagttt cttccggtcc acacccgaag accttgagag 4020 agcggagaaa cagctcaaag cacgtgacat caatgacata ttcgccattc ttaagaacgg 4080 cgagtggccg gtcaagctga ttcttgccat ccgcgactgg atcaaggcat ggatcgcctc 4140 agaagaaaag tttgtcacca tgacagacct ggtgcctggc atccttgaaa agcagcggga 4200 tctcaacgac ccaagcaagt acaaggaggc caaggagtgg ctcgacaacg cgcgccaagc 4260 gtgtctgaag agcgggaaca tccacatcgc aaacctttgc aaagtggttg ccccagcgcc 4320 cagcaggtcg aggcccgaac ccgtggtcgt ttgcctccgt ggcaagtcag gccagggcaa 4380 gagtttcctt gcgaacgtgc ttgcacaagc aatttcaacc cacttcactg gcagaaccga 4440 ttcagtttgg tactgcccac ctgaccctga ccacttcgac ggttacaacc agcagaccgt 4500 tgtagtaatg gatgatttgg gccacaaccc cgacgggaag gacttcaagt acttcgccca 4560 aatggtttca actacggggt ttatcccgcc catggcttca ctagaggata aaggcaaacc 4620 tttcaacagc aaggtcatca tcgccaccac caacctgtac tcgggcttca ccccgagaac 4680 tatggtgtgc cctgatgcac tgaaccgaag gttccacttt gacattgacg tgagcgccaa 4740 ggacgggtac aaaattaaca acaaattgga catcatcaaa gctcttgaag acacccaccc 4800 caacccagtg gcaatgtttc aatacgactg tgcccttctc aacggcatgg ccgttgaaat 4860 gaagagaatg caacaagata tgttcaagcc tcaaccgccc ctccagaacg tctaccagct 4920 tgttcaggag gtgattgacc gggtcgagct ccacgagaag gtgtcgagtc acccgatctt 4980 caagcagatc tcaattcctt cccaaaaggc tgtgctgtac tttctcattg agaaaggcca 5040 gcacgaagca gcaattgaat tctttgaggg gatggtgtgt gactccatca aggaggagct 5100 ccggcctctc atccaacaga cctcatttgt gaagcgcgct tttaagcgcc tgaaggaaaa 5160 ctttgagata gttgccctgt gtttgactct aatggcaaac atagtgatca tgatccgcga 5220 gactcgcaag agacagcaga tggtggatga tgcagtgaac gagtacactg agaaggtaaa 5280 catcaccacg gatgacaaga ctcttgacga ggcggaaaag aaccctctgg aaaccagcgg 5340 tgccaccact gttggtttca gagagaaaac tctcccgggg cacaagacgg gtgatgacgt 5400 gagctccgag cccaccaaac ccgtggaagg acaaccacaa gctgaaggac cctacaccgg 5460 cccactcgag cgtcaaaaac ctctgaaagt gagagccaag ctcccgcagc aggaggggcc 5520 ttatgctggt cccatggaga gacagaaacc actgaaagtg aaagcgaaag ccccggtcgt 5580 taaggaagga ccttacgaag gaccggtgaa gaaacctgtc gctttgaaag tgaaagcaaa 5640 gaacttgatt gtcactgaga gtggtgctcc cccgactgac ttgcaaaaga tggtcatggg 5700 taacaccaag cctgttgagc tcgtcctcga tgggaagacg gtggccatct gctgcgccac 5760 cggagtgttt ggtactgcct accttgttcc tcgtcatctt ttcgcagaga agtatgacaa 5820 gatcatgttg gacggcagag ccatgacaga cagtgactac agagtgtttg agtttgagat 5880 taaagtgaaa ggacaggaca tgctctcaga cgccgcgctc atggtgcttc accgtgggaa 5940 tcgagtgcgg gacatcacga agcacttccg tgatgtggca agaatgaaga aaggcacccc 6000 cgtcgtcggc gtgatcaaca acgctgatgt tgggaggctg atcttctctg gtgaggccct 6060 tacctacaag gacattgtag tgcgcatgga cggagacacc atgcccggtc tcttcgccta 6120 caaagccgcc accaaggcgg gctactgtgg aggatccgtt cttgcaaagg acggagccga 6180 tactttcatc gtcggcactc actccgcagg cggcaatgga gttggatact gctcatgcgt 6240 ttccaggtct atgctgctta aaatgaaggc acacatcgac cccgaaccac accacgaggg 6300 attgatagtt gacaccagag atgttgagga gcgcgtacat gtcatgcgca aaaccaagct 6360 cgcacccacc gtggcacacg gtgtgtttaa ccccgaattt gggcctgccg ccttgtccaa 6420 caagggcccg cgcctgaatg agggggttgt cctcgatgaa gccatcttct ccaaacacaa 6480 aggaaacaca aagatgtctg aggaggacaa agcgctgttc cgccgctgtg ctgctgatta 6540 cgcgtcgcgt ctgcacagtg tgctgggtac ggcaaatgcc ccactgagca tttacgaggc 6600 aatcaagggc gtcgacggac ttgacgccat ggaaccagac accgcgcctg gtctcccttg 6660 ggctctccag gggaaacgcc ggggtgcgct cattgacttc gaaaacggca ctgtcggacc 6720 cgaggttgaa gctgccttga agctcatgga gaaaagagag tacaagtttg tgtgccagac 6780 cttcttgaag gacgagattc gcccgatgga gaaggtacgt gccggtaaga ctcgcattgt 6840 cgacgtcctg cctgttgaac acattcttta caccaggatg atgattggca gattttgtgc 6900 tcaaatgcac tcaaacaacg gaccgcaaat tggctcggcg gttggttgta atcctgatgt 6960 tgattggcaa agatttggca cgcactttgc tcagtacaga aacgtgtggg atgtagacta 7020 ttcggccttc gacgccaacc actgcagtga cgcaatgaac atcatgcttg aggaggtgtt 7080 caacacggat ttcggtttcc acccaaacgc tgagtggatc ctgaaaaccc tcgtgaacac 7140 tgaacacgcc tatgagaaca aacgcatcac tgttgaaggc gggatgccgt ctggttgttc 7200 cgcgacaagc atcatcaaca caattttgaa caacatctac gtgctctacg ccttgcgtag 7260 acactacgag ggagtcgagc tggactctta caccatgatc tcctacggag acgacatcgt 7320 ggttgcaagt gatcacgatc tggactttga ggccctcaag cctcacttca aatcccttgg 7380 tcaaaccatc actccagctg acaaaagcga caaaggtttt gttcttggtc actccattac 7440 cgatgtcact ttcctcaaaa gacacttcca catggactat ggaactgggt tttacaaacc 7500 tgtgatggct tcgaagaccc tcgaagctat cctctccttt gcacgtcgtg ggaccataca 7560 ggagaagttg atctccgtgg caggacttgc cgtccactct ggacctgacg agtaccggcg 7620 tctctttgag cctttccagg gtctctttga gattccaagc tacagatcac tttacctgcg 7680 ttgggtgaac cccgtgtgcg gtgacgcata atccctcaga tgtcacaatt ggcagaaaga 7740 cgctgaggcg agcgacgccg taggagtgga aagtccgaaa gggtttttcc cgcttcctat 7800 ttc 7803 <210> 2 <211> 7799 <212> DNA <213> Foot-and-mouth disease virus <400> 2 agttttaccg tcgttcccgg cgttaaaggg aggtaaccac aagcttgcaa ctgtcttgct 60 cgacgataaa gggctgtgac cgcaagatga taccgccttc ccggcgttaa ttggatgcaa 120 ccacaagatg aaccttcacc cggaagtaaa acggcacatt cgcctagttt tacccgtttt 180 caggagaaat gggacgtccg cgcacgaaac gcgccgtcgc ttgaggagga cttgtacaaa 240 cacgatatat tcaggttccc acaaccgaca caaaccgtgc aacctgaaac tccgcctggt 300 ctttccaggt ctagaggggt gacattttgt actgtgcttg actccacgct cggtccactg 360 gcgagtgcta gtaacagcac tgttgcttcg tagcggagca tggtggccgc gggaactcct 420 ccttggtaac agggacccgc ggggccgaaa gccacgtcct cacggaccca ccatgtgtgc 480 aaccccagca cggcaacttt actgtggaaa ccactttaag gtgacactga tactggtact 540 caaccactgg tgacaggcta aggatgccct tcaggtaccc tgaggtaaca cgcgacactc 600 gggatctgag aaggggactg gggcttcttt aaaagcgcct agtttaaaaa gcttctacgc 660 ctgaataggt gaccggaggc cggcaccttt cttttaaaca actactttta atgagcacaa 720 ctgactgttt catcgctttg ttgtacgctt tcagagagat taaaacactg ttcttatcac 780 gagcacaagg aaagatggag ttcacacttc acaacggtga gaagaaaaca ttctactcca 840 ggcccaacaa ccacgacaac tgctggctga acaccatcct ccagttgttt aggtacgttg 900 atgaaccttt cttcgactgg gtctactact cacctgagaa cctcacgctt gatgctatca 960 aacaattgga agaaattact ggtctcgaac tccaggaggg tggaccaccc gctctcgtta 1020 tttggaacat taaacacctg ctcaacaccg gaatcggcac cgcttcacga cccaacgaag 1080 tgtgcatggt agacgggacg gacatgtgtt tggctgactt ccacgctggc atcttcctga 1140 aaggacagga acacgctgtg ttcgcctgcg tcacctccaa cgggtggtac gcgattgacg 1200 ataaggactt ttacccctgg acgccggacc cgtccgacgt tctggtgttt gtcccgtacg 1260 atcaagaacc gctcaacgga gaatggaaag caagggttca gaaacgactc agaggcgccg 1320 ggcaatccag cccggcgact gggtcacaga accagtcagg caacactgga agcatcatca 1380 acaattacta catgcagcag taccagaact ccatggacac gcaacttggt gacgacgcta 1440 ttagcggagg ctccaacgag gggtccacgg acaccacttc cactcacaca accaacactc 1500 agaacaatga ctggttctca aagctggcca gttccgcttt tagcggtctt ttcggcgctc 1560 ttctcgccga taagaaaacc gaggagacca ctcttctcga ggaccgcatc ctcactaccc 1620 gcaacgggca cacgacctcg acaacccagt cgagcgttgg agtcacttac gggtacgcaa 1680 cagccgagga ctttgtgagc ggaccaaaca catctgggct cgagaccagg gttgtgcagg 1740 cagagcggtt cttcaaaacc cacttgttcg actgggtcac cagtgacccg ttcggacggt 1800 gctacctgct ggaactccca actgaccaca aaggtgtcta cggcagcctg actgactctt 1860 atgcttacat gagaaacggt tgggttgttg aggtcactgc agtgggaaat cagttcaacg 1920 gaggatgtcc gttggtggcc atggtgccag aacattgctc tattgacaag agagagctgt 1980 accagctcac gctctttccc caccagttca tcaacccccg gacgaacatg acggcgcaca 2040 tcactgtgcc ctttgttggt gtcaatcgct acgaccagta caaggtacac aaaccttgga 2100 ccctcgtggt tatggttgtg gccccgctga ctgtcaacac cgaaggtgcc ccacagacca 2160 aggtctacgc caacatcgcc cctaccaacg tgtacgttgc gggtgagttc ccttccaagg 2220 aagggatctt ccccgtggca tgtagcgacg gttacggtgg tctggtgacc actgacccaa 2280 agacggctga ccccgcctac gggaaagtgt tcaatccacc tcgcaacatg ttgccggggc 2340 ggttcaccaa cttccttgat gtggctgagg cgtgccctac gtttctgcac tttgagggtg 2400 acgtgccgta cgtgaccaca aagacggact cagacagggt gctcgcccag tttgacttgt 2460 ctctggcagc aaaacacatg tcaaacacct tcctggcggg tctcgcccag tactacacac 2520 agtacagtgg caccatcaac ctgcacttca tgttcacagg acccactgac gcgaaagcgc 2580 gttacatgat tgcatacgcc ccccctggca tggagccgcc caaaacacct gaggcggccg 2640 ctcactgcat tcatgcggag tgggacacag ggttgaattc aaaattcaca ttttcaatcc 2700 cttacctttc ggcggctgat tacgcgtaca ccgcgtctga tgctgcggag accacaaatg 2760 tacagggttg ggtttgcctg tttcaaatta cacacgggaa ggctgacggc gacgcactgg 2820 tcgttctagc tagcgccggc aaggactttg agctgcgtct gccagttgac gctcgcacgc 2880 agaccacctc cacaggtgag tcggctgacc ccgtgactgc cactgttgag aactacggtg 2940 gtgagacaca ggtccagaga cgccaacaca cggatgtctc gttcatatta gacagatttg 3000 tgaaagtaac accaaaagac caaattaatg tgttggacct gatgcaaacc cctgcacaca 3060 ctttggtagg cgcgctcctc cgtactgcca cctactactt cgcagatcta gaagtggcag 3120 tgaaacacga ggggaacctt acctgggtcc cgaacggggc gcccgagaca gcgttggaca 3180 acaccaccaa tccaacggcc taccacaagg caccgctcac ccggcttgca ctgccttaca 3240 cggcaccaca ccgtgtcttg gctactgttt acaacgggaa ctgcaagtat ggcgagggcc 3300 ccgtgaccaa tgtgagaggt gacctgcaag tattggccca gaaggcggca agaacgctgc 3360 ctacctcctt caactacggt gccatcaaag ccactcgggt gactgaactg ctttaccgca 3420 tgaagagggc cgaaacatac tgtccccggc ctcttttggc tattcacccg agcgaagcta 3480 gacacaaaca aaagattgtg gcgcctgtga aacagcttct gaactttgac ctgctcaagt 3540 tggcaggaga cgtcgagtcc aaccctgggc ctttcttctt ctctgacgtc aggtcaaatt 3600 tttccaagtt ggttgaaacc atcaaccaga tgcaggagga catgtcaaca aaacacggac 3660 ccgactttaa ccggttggtg tctgcatttg aggaactggc cactggagtg aaggctatca 3720 ggaccggtct cgatgaggcc aaaccctggt acaagctcat caagctcttg agccgcctgt 3780 catgcatggc cgctgtagca gcacggtcaa aggacccagt ccttgtggcc atcatgctgg 3840 ctgacaccgg ccttgagatt ctggacagta cctttgtcgt gaagaagatc tccgactcgc 3900 tctccagtct ctttcacgtg ccggcccccg tcttcagttt cggagccccg attttgttgg 3960 ccgggttggt caaagtcgcc tcgactttct tccggtccac acccgaggac cttgagagag 4020 cggagaaaca gctcaaagca cgtgacatca atgacatatt cgccattctc aagaacggcg 4080 agtggttggt caagctgatt cttgccatcc gcgactggat caaggcatgg atcgcctcag 4140 aagaaaaatt tgtcaccatg acagacctgg tacctggcat ccttgaaaag cagcgggatc 4200 ttaacgaccc aagcaagtac aaggaggcca aggagtggct cgacaacgcg cgccaagcgt 4260 gtttgaagag cgggaacatc cacattgcaa acctttgtaa agtagttgcc ccagcaccca 4320 gcaggtcgag gcctgaaccc gtggtcgttt gcctccgtgg caaatcgggc cagggcaaga 4380 gtttccttgc gaacgtgctt gcacaagcaa tttcaaccca cttcactggc agaaccgatt 4440 cagtttggta ctgcccacct gaccctgacc acttcgacgg ttacaaccag cagaccgttg 4500 tagtaatgga tgatttgggc cagaaccccg acgggaagga cttcaaatac ttcgcccaaa 4560 tggtttcaac tacggggttt atcccgccca tggcttcact cgaggacaaa ggcaaacctt 4620 tcaacagcaa ggtcatcatc gccaccacca acctgtactc gggcttcacc ccgagaacta 4680 tggtgtgccc tgatgcactg aaccgaaggt tccactttga cattgacgtg agcgccaagg 4740 acgggtacaa aattaacaac aaattggaca tcaccaaagc tcttgaagat acccacacca 4800 acccagtggc aatgtttcaa tacgactgtg cccttctcaa cggcatggcc gttgagatga 4860 agagaatgca acaagatatg ttcaagcctc aaccgcccct ccagaacgtc taccagcttg 4920 ttcaggaggt gattgaccgg gtcgagctcc acgagaaggt gtcgagtcac ccgatcttca 4980 agcagatctc aataccttcc caaaaggctg tgctgtactt tctcattgag aagggccagc 5040 acgatgcagc aattgaattc tttgagggga tggtgcatga ctccatcaag gaggagctcc 5100 ggcctctcat ccaacagacc tcatttgtga agcgcgcttt taagcgcctg aaggaaaact 5160 ttgaggtagt tgccctgtgt ttgacccttt tggcaaacat agtgatcatg atccgcgaga 5220 ctcgcaagag acagcagatg gtggatgacg cagtgaacga gtacattgag aaggcaaaca 5280 tcaccacgga tgacaagact cttgacgagg cggaaaagaa ccctctggag accagcggtg 5340 ccaccactgt tggttttaga gagaaaactc tcccgggaca caaggcgagt gacgacgtga 5400 actccgagcc cgccaaaccc gcggaagaac aaccacaagc tgaaggaccc tacaccggtc 5460 cactcgagcg tcaaaaacct ctgaaagtga gagccaagct cccacagcag gaggggccct 5520 acgctggtcc gatggagaga cagaaaccgc tgaaagtgaa agtgaaagcc ccggttgtta 5580 aggaaggacc ttacgaagga ccggtgaaga aacctgtcgc tttgaaagtg aaagcaaaga 5640 acttgattgt cactgagagt ggtgctcccc cgactgactt gcaaaagatg gtcatgggta 5700 acaccaagcc tgttgagctc atcctcgacg ggaagacggt ggccatctgt tgcgccaccg 5760 gagtgtttgg tactgcttac cttgtccctc gtcatctttt cgcagagaag tatgacaaga 5820 tcatgttgga cggcagagcc atgacagaca gtgactacag agtgtttgag tttgagatta 5880 aagtgaaagg acaggacatg ctctcagacg ccgcgctcat ggtgcttcac cgtgggaatc 5940 gcgtgcggga catcacgaag cacttccgtg atgtggcaag aatgaagaaa ggcacccccg 6000 tcgtcggcgt ggtcaacaac gctgatgttg ggagactgat cttctctggt gaggccctta 6060 cctacaagga cattgtagtg tgcatggacg gagacaccat gcccggtctc ttcgcctaca 6120 aagccgccac caaggcgggt tactgtggag gagccgttct tgcaaaggac ggagccgaga 6180 ctttcatcgt cggcactcac tccgcaggcg gcaatggggt tggatactgc tcatgcgttt 6240 ccaggtctat gctgcttaaa atgaaggcac acatcgatcc cgaaccacac cacgagggat 6300 tgatagttga caccagagat gttgaggagc gcgtacatgt catgcgcaaa accaagctcg 6360 cacccaccgt ggcacacggt gtgtttaacc ccgaatttgg gcctgccgcc ttgtccaaca 6420 aggacccgcg cctgaatgag ggggttgccc tcgatgaagc catcttctcc aaacacaagg 6480 gaaacacaaa gatgtctgag gaggacaaag cgctgttccg ccgctgtgct gctgactacg 6540 cgtcgcgtct gcatagcgtg ctgggtacgg caaacgcccc actgagcatt tacgaggcaa 6600 tcaagggcgt cgacggactt gacgccatgg aaccagacac cgcgcctggt ttaccctggg 6660 ctctccaggg gaaacgccgt ggtgcgctca ttgactttga gaacggcaca atcggacccg 6720 aggttgaagc tgccttgaag ctcatggaga aaagagagta caagtttgta tgtcagacct 6780 tcctgaagga cgagattcgc ccgatggaga aggtacgtgc cggcaagact cgcattgtcg 6840 acgtcctgcc tgttgaacac actctttaca ccaggatgat gattggcaga ttttgtgctc 6900 aaatgcactc aaacaacgga ccgcaaattg gctcggcggt tgggtgtaat cctgatgttg 6960 attggcaaag atttggcacg cattttgctc agtacagaaa cgtgtgggat gtagactatt 7020 cggcctttga tgccaaccac tgcagtgacg caatgaacat catgtttgag gaggtgttca 7080 acacggattt cggtttccac ccaaacgctg agtggatcct gaaaactctc gtgaacactg 7140 aacacgccta tgagaacaaa cgcatcactg ttgaaggcgg gatgccgtct ggttgttccg 7200 caacaagcat catcaacaca attttgaaca acatctacgt gctctacgcc ttgcgtaggc 7260 actatgaggg agttgagctg gactcttaca ccatgatctc ctacggagac gacatcgtgg 7320 ttgcaagtga ttacgatctg gactttgagg ccctcaagcc tcacttcaaa tcccttggtc 7380 aaaccattac tccagctgac aaaagcgaca aaggttttgt tcttggtcac tccattaccg 7440 atgtcacttt cctcaaaaga tctttccaca tggactatgg aactgggttt tacaaacctg 7500 tgatggcttc gaagaccctc gaggctatcc tctcctttgc acgccgtggg accatacagg 7560 agaagttgat ctccgtggca ggactcgccg tccactctgg acctgacgag taccggcgtc 7620 tctttgagcc cttccagggt ctctttgaga ttccaagcta cagatcgctt tacctgcgtt 7680 gggtgaacgc cgtgtgcggt gacgcataat ccctcagatg tcacaattgg cagaaagacg 7740 ctgaggcgag cggcgccgta ggagtgaaaa gtccgaaagg gtttttcccg cttcctttc 7799 <210> 3 <211> 2332 <212> PRT <213> Foot-and-mouth disease virus <400> 3 Met Asn Thr Thr Asp Cys Leu Thr Ala Leu Leu Tyr Ala Phe Arg Glu 1 5 10 15 Ile Lys Thr Leu Phe Leu Ser Arg Ala Gln Gly Lys Met Glu Phe Thr 20 25 30 Leu His Asn Gly Glu Lys Lys Thr Phe Tyr Ser Arg Pro Asn Asn His 35 40 45 Asp Asn Cys Trp Leu Asn Ala Ile Leu Gln Leu Phe Arg Tyr Val Asp 50 55 60 Glu Pro Phe Phe Asp Trp Val Tyr Tyr Ser Pro Glu Asn Leu Thr Leu 65 70 75 80 Asp Ala Ile Lys Gln Leu Glu Gly Ile Thr Gly Leu Glu Leu His Glu 85 90 95 Gly Gly Pro Pro Ala Leu Val Ile Trp Asn Ile Lys His Leu Leu Asn 100 105 110 Thr Gly Ile Gly Thr Ala Ser Arg Pro Asn Glu Val Cys Met Val Asp 115 120 125 Gly Thr Asp Met Cys Leu Ala Asp Phe His Ala Gly Ile Phe Leu Lys 130 135 140 Gly Gln Glu His Ala Val Phe Ala Cys Val Thr Ser Asn Gly Trp Tyr 145 150 155 160 Ala Ile Asp Asp Glu Asp Phe Tyr Pro Trp Thr Pro Asp Pro Ser Asp 165 170 175 Val Leu Val Phe Val Pro Tyr Asp Gln Gln Pro Leu Asn Gly Glu Trp 180 185 190 Lys Ala Lys Val Gln Lys Arg Leu Arg Gly Ala Gly Gln Ser Ser Pro 195 200 205 Ala Thr Gly Ser Gln Asn Gln Ser Gly Asn Thr Gly Ser Ile Ile Asn 210 215 220 Asn Tyr Tyr Met Gln Gln Tyr Gln Asn Ser Met Asp Thr Gln Leu Gly 225 230 235 240 Asp Asn Ala Ile Ser Gly Gly Ser Asn Glu Gly Ser Thr Asp Thr Thr 245 250 255 Ser Thr His Thr Thr Asn Thr Gln Asn Asn Asp Trp Phe Ser Lys Leu 260 265 270 Ala Ser Ser Ala Phe Ser Gly Leu Phe Gly Ala Leu Leu Ala Asp Lys 275 280 285 Lys Thr Glu Glu Thr Thr Leu Leu Glu Asp Arg Ile Leu Thr Thr Arg 290 295 300 Asn Gly His Thr Thr Ser Ser Thr Thr Gln Ser Ser Val Gly Val Thr Tyr 305 310 315 320 Gly Tyr Ala Thr Ala Glu Asp Phe Val Ser Gly Pro Asn Thr Ser Gly 325 330 335 Leu Glu Thr Arg Val Val Gln Ala Glu Arg Phe Phe Lys Thr His Leu 340 345 350 Phe Asp Trp Val Thr Ser Asp Pro Phe Gly Arg Cys Tyr Leu Leu Glu 355 360 365 Leu Pro Thr Asp His Lys Gly Val Tyr Gly Ser Leu Thr Asp Ser Tyr 370 375 380 Ala Tyr Met Arg Asn Gly Trp Asp Val Glu Val Thr Ala Val Gly Asn 385 390 395 400 Gln Phe Asn Gly Gly Cys Leu Leu Val Val Met Val Pro Glu Leu Cys 405 410 415 Ser Ile Asp Lys Arg Gly Leu Tyr Gln Leu Thr Leu Phe Pro His Gln 420 425 430 Phe Ile Asn Pro Gln Thr Asn Met Thr Ala His Ile Thr Val Pro Phe 435 440 445 Val Gly Val Asn Arg Tyr Asp Gln Tyr Lys Val His Lys Pro Trp Thr 450 455 460 Leu Val Val Met Val Val Ala Pro Leu Thr Val Asn Thr Glu Gly Ala 465 470 475 480 Pro Gln Ile Lys Val Tyr Ala Asn Ile Ala Pro Thr Asn Val His Val 485 490 495 Ala Gly Glu Leu Pro Ser Lys Glu Gly Ile Phe Pro Val Ala Cys Ser 500 505 510 Asp Gly Tyr Gly Gly Leu Val Thr Thr Asp Pro Lys Thr Ala Asp Pro 515 520 525 Ala Tyr Gly Lys Val Phe Asn Pro Pro Arg Asn Met Leu Pro Gly Arg 530 535 540 Phe Thr Asn Phe Leu Asp Val Ala Glu Ala Cys Pro Thr Phe Leu His 545 550 555 560 Phe Glu Gly Asp Val Pro Tyr Val Thr Thr Lys Thr Asp Ser Asp Arg 565 570 575 Val Leu Ala Gln Phe Asp Leu Ser Leu Ala Ala Lys His Met Ser Asn 580 585 590 Thr Phe Leu Ala Gly Leu Ala Gln Tyr Tyr Thr Gln Tyr Ser Gly Thr 595 600 605 Ile Asn Leu His Phe Met Phe Thr Gly Pro Thr Asp Ala Lys Ala Arg 610 615 620 Tyr Met Ile Ala Tyr Ala Pro Pro Gly Met Glu Pro Pro Lys Thr Pro 625 630 635 640 Glu Ala Ala Ala His Cys Ile His Ala Glu Trp Asp Thr Gly Leu Asn 645 650 655 Ser Lys Phe Thr Phe Ser Ile Pro Tyr Leu Ser Ala Ala Asp Tyr Ala 660 665 670 Tyr Thr Ala Ser Asp Thr Ala Glu Thr Thr Asn Val Gln Gly Trp Val 675 680 685 Cys Leu Phe Gln Ile Thr His Gly Lys Ala Asp Gly Asp Ala Leu Val 690 695 700 Val Leu Ala Ser Ala Gly Lys Asp Phe Glu Leu Arg Leu Pro Val Asp 705 710 715 720 Ala Arg Thr Gln Thr Thr Ser Ser Gly Glu Ser Ala Asp Pro Val Thr 725 730 735 Ala Thr Val Glu Asn Tyr Gly Gly Glu Thr Gln Val Gln Arg Arg Gln 740 745 750 His Thr Asp Val Ser Phe Ile Leu Asp Arg Phe Val Lys Val Thr Pro 755 760 765 Lys Asp Gln Ile Asn Val Leu Asp Leu Met Gln Ile Pro Ala His Thr 770 775 780 Leu Val Gly Ala Leu Leu Arg Thr Ala Thr Tyr Tyr Phe Ala Asp Leu 785 790 795 800 Glu Val Ala Val Lys His Glu Gly Asn Leu Thr Trp Val Pro Asn Gly 805 810 815 Ala Pro Glu Ala Ala Leu Asp Asn Thr Thr Asn Pro Thr Ala Tyr His 820 825 830 Lys Ala Pro Leu Thr Arg Leu Ala Leu Pro Tyr Thr Ala Pro His Arg 835 840 845 Val Leu Ala Thr Val Tyr Asn Gly Asn Cys Lys Tyr Gly Glu Ser Pro 850 855 860 Val Thr Asn Leu Arg Gly Asp Leu Gln Val Leu Thr Gln Lys Ala Ala 865 870 875 880 Arg Thr Leu Pro Thr Ser Phe Asn Tyr Gly Ala Ile Lys Ala Thr Arg 885 890 895 Val Thr Glu Leu Leu Tyr Arg Met Lys Arg Ala Glu Thr Tyr Cys Pro 900 905 910 Arg Pro Leu Leu Ala Ile His Pro Ser Glu Ala Arg His Lys Gln Lys 915 920 925 Ile Val Ala Pro Val Lys Gln Leu Leu Asn Phe Asp Leu Leu Lys Leu 930 935 940 Ala Gly Asp Val Glu Pro Asn Pro Gly Pro Phe Phe Phe Ser Asp Val 945 950 955 960 Arg Ser Asn Phe Ser Lys Leu Val Glu Thr Val Asn Gln Met Gln Glu 965 970 975 Asp Met Ser Thr Lys His Gly Pro Asp Phe Asn Arg Leu Val Ser Ala 980 985 990 Phe Glu Glu Leu Ala Thr Gly Val Lys Ala Ile Arg Thr Gly Leu Asp 995 1000 1005 Glu Ala Lys Pro Trp Tyr Lys Leu Ile Lys Leu Leu Ser Arg Leu Ser 1010 1015 1020 Cys Met Ala Ala Val Ala Ala Arg Ser Lys Asp Pro Leu Leu Val Ala 1025 1030 1035 1040 Ile Met Leu Ala Asp Thr Gly Leu Glu Ile Leu Asp Ser Thr Phe Val 1045 1050 1055 Val Lys Lys Ile Ser Asp Ser Leu Ser Ser Leu Phe His Val Pro Ala 1060 1065 1070 Pro Val Phe Ser Ser Gly Ala Pro Ile Leu Leu Ala Gly Leu Val Lys 1075 1080 1085 Val Ala Ser Ser Phe Phe Arg Ser Thr Pro Glu Asp Leu Glu Arg Ala 1090 1095 1100 Glu Lys Gln Leu Lys Ala Arg Asp Ile Asn Asp Ile Phe Ala Ile Leu 1105 1110 1115 1120 Lys Asn Gly Glu Trp Pro Val Lys Leu Ile Leu Ala Ile Arg Asp Trp 1125 1130 1135 Ile Lys Ala Trp Ile Ala Ser Glu Glu Lys Phe Val Thr Met Thr Asp 1140 1145 1150 Leu Val Pro Gly Ile Leu Glu Lys Gln Arg Asp Leu Asn Asp Pro Ser 1155 1160 1165 Lys Tyr Lys Glu Ala Lys Glu Trp Leu Asp Asn Ala Arg Gln Ala Cys 1170 1175 1180 Leu Lys Ser Gly Asn Ile His Ile Ala Asn Leu Cys Lys Val Val Ala 1185 1190 1195 1200 Pro Ala Pro Ser Arg Ser Arg Pro Glu Pro Val Val Val Cys Leu Arg 1205 1210 1215 Gly Lys Ser Gly Gln Gly Lys Ser Phe Leu Ala Asn Val Leu Ala Gln 1220 1225 1230 Ala Ile Ser Thr His Phe Thr Gly Arg Thr Asp Ser Val Trp Tyr Cys 1235 1240 1245 Pro Pro Asp Pro Asp His Phe Asp Gly Tyr Asn Gln Gln Thr Val Val 1250 1255 1260 Val Met Asp Asp Leu Gly His Asn Pro Asp Gly Lys Asp Phe Lys Tyr 1265 1270 1275 1280 Phe Ala Gln Met Val Ser Thr Thr Gly Phe Ile Pro Pro Met Ala Ser 1285 1290 1295 Leu Glu Asp Lys Gly Lys Pro Phe Asn Ser Lys Val Ile Ila Ala Thr 1300 1305 1310 Thr Asn Leu Tyr Ser Gly Phe Thr Pro Arg Thr Met Val Cys Pro Asp 1315 1320 1325 Ala Leu Asn Arg Arg Phe His Phe Asp Ile Asp Val Ser Ala Lys Asp 1330 1335 1340 Gly Tyr Lys Ile Asn Asn Lys Leu Asp Ile Ile Lys Ala Leu Glu Asp 1345 1350 1355 1360 Thr His Pro Asn Pro Val Ala Met Phe Gln Tyr Asp Cys Ala Leu Leu 1365 1370 1375 Asn Gly Met Ala Val Glu Met Lys Arg Met Gln Gln Asp Met Phe Lys 1380 1385 1390 Pro Gln Pro Pro Leu Gln Asn Val Tyr Gln Leu Val Gln Glu Val Ile 1395 1400 1405 Asp Arg Val Glu Leu His Glu Lys Val Ser Ser His Pro Ile Phe Lys 1410 1415 1420 Gln Ile Ser Ile Pro Ser Gln Lys Ala Val Leu Tyr Phe Leu Ile Glu 1425 1430 1435 1440 Lys Gly Gln His Glu Ala Ala Ile Glu Phe Phe Glu Gly Met Val Cys 1445 1450 1455 Asp Ser Ile Lys Glu Glu Leu Arg Pro Leu Ile Gln Gln Thr Ser Phe 1460 1465 1470 Val Lys Arg Ala Phe Lys Arg Leu Lys Glu Asn Phe Glu Ile Val Ala 1475 1480 1485 Leu Cys Leu Thr Leu Met Ala Asn Ile Val Ile Met Ile Arg Glu Thr 1490 1495 1500 Arg Lys Arg Gln Gln Met Val Asp Asp Ala Val Asn Glu Tyr Thr Glu 1505 1510 1515 1520 Lys Val Asn Ile Thr Thr Asp Asp Lys Thr Leu Asp Glu Ala Glu Lys 1525 1530 1535 Asn Pro Leu Glu Thr Ser Gly Ala Thr Thr Val Gly Phe Arg Glu Lys 1540 1545 1550 Thr Leu Pro Gly His Lys Thr Gly Asp Asp Val Ser Ser Glu Pro Thr 1555 1560 1565 Lys Pro Val Glu Gly Gln Pro Gln Ala Glu Gly Pro Tyr Thr Gly Pro 1570 1575 1580 Leu Glu Arg Gln Lys Pro Leu Lys Val Arg Ala Lys Leu Pro Gln Gln 1585 1590 1595 1600 Glu Gly Pro Tyr Ala Gly Pro Met Glu Arg Gln Lys Pro Leu Lys Val 1605 1610 1615 Lys Ala Lys Ala Pro Val Val Lys Glu Gly Pro Tyr Glu Gly Pro Val 1620 1625 1630 Lys Lys Pro Val Ala Leu Lys Val Lys Ala Lys Asn Leu Ile Val Thr 1635 1640 1645 Glu Ser Gly Ala Pro Pro Thr Asp Leu Gln Lys Met Val Met Gly Asn 1650 1655 1660 Thr Lys Pro Val Glu Leu Val Leu Asp Gly Lys Thr Val Ala Ile Cys 1665 1670 1675 1680 Cys Ala Thr Gly Val Phe Gly Thr Ala Tyr Leu Val Pro Arg His Leu 1685 1690 1695 Phe Ala Glu Lys Tyr Asp Lys Ile Met Leu Asp Gly Arg Ala Met Thr 1700 1705 1710 Asp Ser Asp Tyr Arg Val Phe Glu Phe Glu Ile Lys Val Lys Gly Gln 1715 1720 1725 Asp Met Leu Ser Asp Ala Ala Leu Met Val Leu His Arg Gly Asn Arg 1730 1735 1740 Val Arg Asp Ile Thr Lys His Phe Arg Asp Val Ala Arg Met Lys Lys 1745 1750 1755 1760 Gly Thr Pro Val Val Gly Val Ile Asn Asn Ala Asp Val Gly Arg Leu 1765 1770 1775 Ile Phe Ser Gly Glu Ala Leu Thr Tyr Lys Asp Ile Val Val Arg Met 1780 1785 1790 Asp Gly Asp Thr Met Pro Gly Leu Phe Ala Tyr Lys Ala Ala Thr Lys 1795 1800 1805 Ala Gly Tyr Cys Gly Gly Ser Val Leu Ala Lys Asp Gly Ala Asp Thr 1810 1815 1820 Phe Ile Val Gly Thr His Ser Ala Gly Gly Asn Gly Val Gly Tyr Cys 1825 1830 1835 1840 Ser Cys Val Ser Arg Ser Met Leu Leu Lys Met Lys Ala His Ile Asp 1845 1850 1855 Pro Glu Pro His His Glu Gly Leu Ile Val Asp Thr Arg Asp Val Glu 1860 1865 1870 Glu Arg Val His Val Met Arg Lys Thr Lys Leu Ala Pro Thr Val Ala 1875 1880 1885 His Gly Val Phe Asn Pro Glu Phe Gly Pro Ala Ala Leu Ser Asn Lys 1890 1895 1900 Gly Pro Arg Leu Asn Glu Gly Val Val Leu Asp Glu Ala Ile Phe Ser 1905 1910 1915 1920 Lys His Lys Gly Asn Thr Lys Met Ser Glu Glu Asp Lys Ala Leu Phe 1925 1930 1935 Arg Arg Cys Ala Ala Asp Tyr Ala Ser Arg Leu His Ser Val Leu Gly 1940 1945 1950 Thr Ala Asn Ala Pro Leu Ser Ile Tyr Glu Ala Ile Lys Gly Val Asp 1955 1960 1965 Gly Leu Asp Ala Met Glu Pro Asp Thr Ala Pro Gly Leu Pro Trp Ala 1970 1975 1980 Leu Gln Gly Lys Arg Arg Gly Ala Leu Ile Asp Phe Glu Asn Gly Thr 1985 1990 1995 2000 Val Gly Pro Glu Val Glu Ala Ala Leu Lys Leu Met Glu Lys Arg Glu 2005 2010 2015 Tyr Lys Phe Val Cys Gln Thr Phe Leu Lys Asp Glu Ile Arg Pro Met 2020 2025 2030 Glu Lys Val Arg Ala Gly Lys Thr Arg Ile Val Asp Val Leu Pro Val 2035 2040 2045 Glu His Ile Leu Tyr Thr Arg Met Met Ile Gly Arg Phe Cys Ala Gln 2050 2055 2060 Met His Ser Asn Asn Gly Pro Gln Ile Gly Ser Ala Val Gly Cys Asn 2065 2070 2075 2080 Pro Asp Val Asp Trp Gln Arg Phe Gly Thr His Phe Ala Gln Tyr Arg 2085 2090 2095 Asn Val Trp Asp Val Asp Tyr Ser Ala Phe Asp Ala Asn His Cys Ser 2100 2105 2110 Asp Ala Met Asn Ile Met Leu Glu Glu Val Phe Asn Thr Asp Phe Gly 2115 2120 2125 Phe His Pro Asn Ala Glu Trp Ile Leu Lys Thr Leu Val Asn Thr Glu 2130 2135 2140 His Ala Tyr Glu Asn Lys Arg Ile Thr Val Glu Gly Gly Met Pro Ser 2145 2150 2155 2160 Gly Cys Ser Ala Thr Ser Ile Ile Asn Thr Ile Leu Asn Asn Ile Tyr 2165 2170 2175 Val Leu Tyr Ala Leu Arg Arg His Tyr Glu Gly Val Glu Leu Asp Ser 2180 2185 2190 Tyr Thr Met Ile Ser Tyr Gly Asp Asp Ile Val Val Ala Ser Asp His 2195 2200 2205 Asp Leu Asp Phe Glu Ala Leu Lys Pro His Phe Lys Ser Leu Gly Gln 2210 2215 2220 Thr Ile Thr Pro Ala Asp Lys Ser Asp Lys Gly Phe Val Leu Gly His 2225 2230 2235 2240 Ser Ile Thr Asp Val Thr Phe Leu Lys Arg His Phe His Met Asp Tyr 2245 2250 2255 Gly Thr Gly Phe Tyr Lys Pro Val Met Ala Ser Lys Thr Leu Glu Ala 2260 2265 2270 Ile Leu Ser Phe Ala Arg Arg Gly Thr Ile Gln Glu Lys Leu Ile Ser 2275 2280 2285 Val Ala Gly Leu Ala Val His Ser Gly Pro Asp Glu Tyr Arg Arg Leu 2290 2295 2300 Phe Glu Pro Phe Gln Gly Leu Phe Glu Ile Pro Ser Tyr Arg Ser Leu 2305 2310 2315 2320 Tyr Leu Arg Trp Val Asn Pro Val Cys Gly Asp Ala 2325 2330 <210> 4 <211> 2332 <212> PRT <213> Foot-and-mouth disease virus <400> 4 Met Ser Thr Thr Asp Cys Phe Ile Ala Leu Leu Tyr Ala Phe Arg Glu 1 5 10 15 Ile Lys Thr Leu Phe Leu Ser Arg Ala Gln Gly Lys Met Glu Phe Thr 20 25 30 Leu His Asn Gly Glu Lys Lys Thr Phe Tyr Ser Arg Pro Asn Asn His 35 40 45 Asp Asn Cys Trp Leu Asn Thr Ile Leu Gln Leu Phe Arg Tyr Val Asp 50 55 60 Glu Pro Phe Phe Asp Trp Val Tyr Tyr Ser Pro Glu Asn Leu Thr Leu 65 70 75 80 Asp Ala Ile Lys Gln Leu Glu Glu Ile Thr Gly Leu Glu Leu Gln Glu 85 90 95 Gly Gly Pro Pro Ala Leu Val Ile Trp Asn Ile Lys His Leu Leu Asn 100 105 110 Thr Gly Ile Gly Thr Ala Ser Arg Pro Asn Glu Val Cys Met Val Asp 115 120 125 Gly Thr Asp Met Cys Leu Ala Asp Phe His Ala Gly Ile Phe Leu Lys 130 135 140 Gly Gln Glu His Ala Val Phe Ala Cys Val Thr Ser Asn Gly Trp Tyr 145 150 155 160 Ala Ile Asp Asp Lys Asp Phe Tyr Pro Trp Thr Pro Asp Pro Ser Asp 165 170 175 Val Leu Val Phe Val Pro Tyr Asp Gln Glu Pro Leu Asn Gly Glu Trp 180 185 190 Lys Ala Arg Val Gln Lys Arg Leu Arg Gly Ala Gly Gln Ser Ser Pro 195 200 205 Ala Thr Gly Ser Gln Asn Gln Ser Gly Asn Thr Gly Ser Ile Ile Asn 210 215 220 Asn Tyr Tyr Met Gln Gln Tyr Gln Asn Ser Met Asp Thr Gln Leu Gly 225 230 235 240 Asp Asp Ala Ile Ser Gly Gly Ser Asn Glu Gly Ser Thr Asp Thr Thr 245 250 255 Ser Thr His Thr Thr Asn Thr Gln Asn Asn Asp Trp Phe Ser Lys Leu 260 265 270 Ala Ser Ser Ala Phe Ser Gly Leu Phe Gly Ala Leu Leu Ala Asp Lys 275 280 285 Lys Thr Glu Glu Thr Thr Leu Leu Glu Asp Arg Ile Leu Thr Thr Arg 290 295 300 Asn Gly His Thr Thr Ser Ser Thr Thr Gln Ser Ser Val Gly Val Thr Tyr 305 310 315 320 Gly Tyr Ala Thr Ala Glu Asp Phe Val Ser Gly Pro Asn Thr Ser Gly 325 330 335 Leu Glu Thr Arg Val Val Gln Ala Glu Arg Phe Phe Lys Thr His Leu 340 345 350 Phe Asp Trp Val Thr Ser Asp Pro Phe Gly Arg Cys Tyr Leu Leu Glu 355 360 365 Leu Pro Thr Asp His Lys Gly Val Tyr Gly Ser Leu Thr Asp Ser Tyr 370 375 380 Ala Tyr Met Arg Asn Gly Trp Val Val Glu Val Thr Ala Val Gly Asn 385 390 395 400 Gln Phe Asn Gly Gly Cys Pro Leu Val Ala Met Val Pro Glu His Cys 405 410 415 Ser Ile Asp Lys Arg Glu Leu Tyr Gln Leu Thr Leu Phe Pro His Gln 420 425 430 Phe Ile Asn Pro Arg Thr Asn Met Thr Ala His Ile Thr Val Pro Phe 435 440 445 Val Gly Val Asn Arg Tyr Asp Gln Tyr Lys Val His Lys Pro Trp Thr 450 455 460 Leu Val Val Met Val Val Ala Pro Leu Thr Val Asn Thr Glu Gly Ala 465 470 475 480 Pro Gln Thr Lys Val Tyr Ala Asn Ile Ala Pro Thr Asn Val Tyr Val 485 490 495 Ala Gly Glu Phe Pro Ser Lys Glu Gly Ile Phe Pro Val Ala Cys Ser 500 505 510 Asp Gly Tyr Gly Gly Leu Val Thr Thr Asp Pro Lys Thr Ala Asp Pro 515 520 525 Ala Tyr Gly Lys Val Phe Asn Pro Pro Arg Asn Met Leu Pro Gly Arg 530 535 540 Phe Thr Asn Phe Leu Asp Val Ala Glu Ala Cys Pro Thr Phe Leu His 545 550 555 560 Phe Glu Gly Asp Val Pro Tyr Val Thr Thr Lys Thr Asp Ser Asp Arg 565 570 575 Val Leu Ala Gln Phe Asp Leu Ser Leu Ala Ala Lys His Met Ser Asn 580 585 590 Thr Phe Leu Ala Gly Leu Ala Gln Tyr Tyr Thr Gln Tyr Ser Gly Thr 595 600 605 Ile Asn Leu His Phe Met Phe Thr Gly Pro Thr Asp Ala Lys Ala Arg 610 615 620 Tyr Met Ile Ala Tyr Ala Pro Pro Gly Met Glu Pro Pro Lys Thr Pro 625 630 635 640 Glu Ala Ala Ala His Cys Ile His Ala Glu Trp Asp Thr Gly Leu Asn 645 650 655 Ser Lys Phe Thr Phe Ser Ile Pro Tyr Leu Ser Ala Ala Asp Tyr Ala 660 665 670 Tyr Thr Ala Ser Asp Ala Ala Glu Thr Thr Asn Val Gln Gly Trp Val 675 680 685 Cys Leu Phe Gln Ile Thr His Gly Lys Ala Asp Gly Asp Ala Leu Val 690 695 700 Val Leu Ala Ser Ala Gly Lys Asp Phe Glu Leu Arg Leu Pro Val Asp 705 710 715 720 Ala Arg Thr Gln Thr Thr Ser Ser Gly Glu Ser Ala Asp Pro Val Thr 725 730 735 Ala Thr Val Glu Asn Tyr Gly Gly Glu Thr Gln Val Gln Arg Arg Gln 740 745 750 His Thr Asp Val Ser Phe Ile Leu Asp Arg Phe Val Lys Val Thr Pro 755 760 765 Lys Asp Gln Ile Asn Val Leu Asp Leu Met Gln Thr Pro Ala His Thr 770 775 780 Leu Val Gly Ala Leu Leu Arg Thr Ala Thr Tyr Tyr Phe Ala Asp Leu 785 790 795 800 Glu Val Ala Val Lys His Glu Gly Asn Leu Thr Trp Val Pro Asn Gly 805 810 815 Ala Pro Glu Thr Ala Leu Asp Asn Thr Thr Asn Pro Thr Ala Tyr His 820 825 830 Lys Ala Pro Leu Thr Arg Leu Ala Leu Pro Tyr Thr Ala Pro His Arg 835 840 845 Val Leu Ala Thr Val Tyr Asn Gly Asn Cys Lys Tyr Gly Glu Gly Pro 850 855 860 Val Thr Asn Val Arg Gly Asp Leu Gln Val Leu Ala Gln Lys Ala Ala 865 870 875 880 Arg Thr Leu Pro Thr Ser Phe Asn Tyr Gly Ala Ile Lys Ala Thr Arg 885 890 895 Val Thr Glu Leu Leu Tyr Arg Met Lys Arg Ala Glu Thr Tyr Cys Pro 900 905 910 Arg Pro Leu Leu Ala Ile His Pro Ser Glu Ala Arg His Lys Gln Lys 915 920 925 Ile Val Ala Pro Val Lys Gln Leu Leu Asn Phe Asp Leu Leu Lys Leu 930 935 940 Ala Gly Asp Val Glu Ser Asn Pro Gly Pro Phe Phe Phe Ser Asp Val 945 950 955 960 Arg Ser Asn Phe Ser Lys Leu Val Glu Thr Ile Asn Gln Met Gln Glu 965 970 975 Asp Met Ser Thr Lys His Gly Pro Asp Phe Asn Arg Leu Val Ser Ala 980 985 990 Phe Glu Glu Leu Ala Thr Gly Val Lys Ala Ile Arg Thr Gly Leu Asp 995 1000 1005 Glu Ala Lys Pro Trp Tyr Lys Leu Ile Lys Leu Leu Ser Arg Leu Ser 1010 1015 1020 Cys Met Ala Ala Val Ala Ala Arg Ser Lys Asp Pro Val Leu Val Ala 1025 1030 1035 1040 Ile Met Leu Ala Asp Thr Gly Leu Glu Ile Leu Asp Ser Thr Phe Val 1045 1050 1055 Val Lys Lys Ile Ser Asp Ser Leu Ser Ser Leu Phe His Val Pro Ala 1060 1065 1070 Pro Val Phe Ser Phe Gly Ala Pro Ile Leu Leu Ala Gly Leu Val Lys 1075 1080 1085 Val Ala Ser Thr Phe Phe Arg Ser Thr Pro Glu Asp Leu Glu Arg Ala 1090 1095 1100 Glu Lys Gln Leu Lys Ala Arg Asp Ile Asn Asp Ile Phe Ala Ile Leu 1105 1110 1115 1120 Lys Asn Gly Glu Trp Leu Val Lys Leu Ile Leu Ala Ile Arg Asp Trp 1125 1130 1135 Ile Lys Ala Trp Ile Ala Ser Glu Glu Lys Phe Val Thr Met Thr Asp 1140 1145 1150 Leu Val Pro Gly Ile Leu Glu Lys Gln Arg Asp Leu Asn Asp Pro Ser 1155 1160 1165 Lys Tyr Lys Glu Ala Lys Glu Trp Leu Asp Asn Ala Arg Gln Ala Cys 1170 1175 1180 Leu Lys Ser Gly Asn Ile His Ile Ala Asn Leu Cys Lys Val Val Ala 1185 1190 1195 1200 Pro Ala Pro Ser Arg Ser Arg Pro Glu Pro Val Val Val Cys Leu Arg 1205 1210 1215 Gly Lys Ser Gly Gln Gly Lys Ser Phe Leu Ala Asn Val Leu Ala Gln 1220 1225 1230 Ala Ile Ser Thr His Phe Thr Gly Arg Thr Asp Ser Val Trp Tyr Cys 1235 1240 1245 Pro Pro Asp Pro Asp His Phe Asp Gly Tyr Asn Gln Gln Thr Val Val 1250 1255 1260 Val Met Asp Asp Leu Gly Gln Asn Pro Asp Gly Lys Asp Phe Lys Tyr 1265 1270 1275 1280 Phe Ala Gln Met Val Ser Thr Thr Gly Phe Ile Pro Pro Met Ala Ser 1285 1290 1295 Leu Glu Asp Lys Gly Lys Pro Phe Asn Ser Lys Val Ile Ila Ala Thr 1300 1305 1310 Thr Asn Leu Tyr Ser Gly Phe Thr Pro Arg Thr Met Val Cys Pro Asp 1315 1320 1325 Ala Leu Asn Arg Arg Phe His Phe Asp Ile Asp Val Ser Ala Lys Asp 1330 1335 1340 Gly Tyr Lys Ile Asn Asn Lys Leu Asp Ile Thr Lys Ala Leu Glu Asp 1345 1350 1355 1360 Thr His Thr Asn Pro Val Ala Met Phe Gln Tyr Asp Cys Ala Leu Leu 1365 1370 1375 Asn Gly Met Ala Val Glu Met Lys Arg Met Gln Gln Asp Met Phe Lys 1380 1385 1390 Pro Gln Pro Pro Leu Gln Asn Val Tyr Gln Leu Val Gln Glu Val Ile 1395 1400 1405 Asp Arg Val Glu Leu His Glu Lys Val Ser Ser His Pro Ile Phe Lys 1410 1415 1420 Gln Ile Ser Ile Pro Ser Gln Lys Ala Val Leu Tyr Phe Leu Ile Glu 1425 1430 1435 1440 Lys Gly Gln His Asp Ala Ala Ile Glu Phe Phe Glu Gly Met Val His 1445 1450 1455 Asp Ser Ile Lys Glu Glu Leu Arg Pro Leu Ile Gln Gln Thr Ser Phe 1460 1465 1470 Val Lys Arg Ala Phe Lys Arg Leu Lys Glu Asn Phe Glu Val Val Ala 1475 1480 1485 Leu Cys Leu Thr Leu Leu Ala Asn Ile Val Ile Met Ile Arg Glu Thr 1490 1495 1500 Arg Lys Arg Gln Gln Met Val Asp Asp Ala Val Asn Glu Tyr Ile Glu 1505 1510 1515 1520 Lys Ala Asn Ile Thr Thr Asp Asp Lys Thr Leu Asp Glu Ala Glu Lys 1525 1530 1535 Asn Pro Leu Glu Thr Ser Gly Ala Thr Thr Val Gly Phe Arg Glu Lys 1540 1545 1550 Thr Leu Pro Gly His Lys Ala Ser Asp Asp Val Asn Ser Glu Pro Ala 1555 1560 1565 Lys Pro Ala Glu Glu Gln Pro Gln Ala Glu Gly Pro Tyr Thr Gly Pro 1570 1575 1580 Leu Glu Arg Gln Lys Pro Leu Lys Val Arg Ala Lys Leu Pro Gln Gln 1585 1590 1595 1600 Glu Gly Pro Tyr Ala Gly Pro Met Glu Arg Gln Lys Pro Leu Lys Val 1605 1610 1615 Lys Val Lys Ala Pro Val Val Lys Glu Gly Pro Tyr Glu Gly Pro Val 1620 1625 1630 Lys Lys Pro Val Ala Leu Lys Val Lys Ala Lys Asn Leu Ile Val Thr 1635 1640 1645 Glu Ser Gly Ala Pro Pro Thr Asp Leu Gln Lys Met Val Met Gly Asn 1650 1655 1660 Thr Lys Pro Val Glu Leu Ile Leu Asp Gly Lys Thr Val Ala Ile Cys 1665 1670 1675 1680 Cys Ala Thr Gly Val Phe Gly Thr Ala Tyr Leu Val Pro Arg His Leu 1685 1690 1695 Phe Ala Glu Lys Tyr Asp Lys Ile Met Leu Asp Gly Arg Ala Met Thr 1700 1705 1710 Asp Ser Asp Tyr Arg Val Phe Glu Phe Glu Ile Lys Val Lys Gly Gln 1715 1720 1725 Asp Met Leu Ser Asp Ala Ala Leu Met Val Leu His Arg Gly Asn Arg 1730 1735 1740 Val Arg Asp Ile Thr Lys His Phe Arg Asp Val Ala Arg Met Lys Lys 1745 1750 1755 1760 Gly Thr Pro Val Val Gly Val Val Asn Asn Ala Asp Val Gly Arg Leu 1765 1770 1775 Ile Phe Ser Gly Glu Ala Leu Thr Tyr Lys Asp Ile Val Val Cys Met 1780 1785 1790 Asp Gly Asp Thr Met Pro Gly Leu Phe Ala Tyr Lys Ala Ala Thr Lys 1795 1800 1805 Ala Gly Tyr Cys Gly Gly Ala Val Leu Ala Lys Asp Gly Ala Glu Thr 1810 1815 1820 Phe Ile Val Gly Thr His Ser Ala Gly Gly Asn Gly Val Gly Tyr Cys 1825 1830 1835 1840 Ser Cys Val Ser Arg Ser Met Leu Leu Lys Met Lys Ala His Ile Asp 1845 1850 1855 Pro Glu Pro His His Glu Gly Leu Ile Val Asp Thr Arg Asp Val Glu 1860 1865 1870 Glu Arg Val His Val Met Arg Lys Thr Lys Leu Ala Pro Thr Val Ala 1875 1880 1885 His Gly Val Phe Asn Pro Glu Phe Gly Pro Ala Ala Leu Ser Asn Lys 1890 1895 1900 Asp Pro Arg Leu Asn Glu Gly Val Ala Leu Asp Glu Ala Ile Phe Ser 1905 1910 1915 1920 Lys His Lys Gly Asn Thr Lys Met Ser Glu Glu Asp Lys Ala Leu Phe 1925 1930 1935 Arg Arg Cys Ala Ala Asp Tyr Ala Ser Arg Leu His Ser Val Leu Gly 1940 1945 1950 Thr Ala Asn Ala Pro Leu Ser Ile Tyr Glu Ala Ile Lys Gly Val Asp 1955 1960 1965 Gly Leu Asp Ala Met Glu Pro Asp Thr Ala Pro Gly Leu Pro Trp Ala 1970 1975 1980 Leu Gln Gly Lys Arg Arg Gly Ala Leu Ile Asp Phe Glu Asn Gly Thr 1985 1990 1995 2000 Ile Gly Pro Glu Val Glu Ala Ala Leu Lys Leu Met Glu Lys Arg Glu 2005 2010 2015 Tyr Lys Phe Val Cys Gln Thr Phe Leu Lys Asp Glu Ile Arg Pro Met 2020 2025 2030 Glu Lys Val Arg Ala Gly Lys Thr Arg Ile Val Asp Val Leu Pro Val 2035 2040 2045 Glu His Thr Leu Tyr Thr Arg Met Met Ile Gly Arg Phe Cys Ala Gln 2050 2055 2060 Met His Ser Asn Asn Gly Pro Gln Ile Gly Ser Ala Val Gly Cys Asn 2065 2070 2075 2080 Pro Asp Val Asp Trp Gln Arg Phe Gly Thr His Phe Ala Gln Tyr Arg 2085 2090 2095 Asn Val Trp Asp Val Asp Tyr Ser Ala Phe Asp Ala Asn His Cys Ser 2100 2105 2110 Asp Ala Met Asn Ile Met Phe Glu Glu Val Phe Asn Thr Asp Phe Gly 2115 2120 2125 Phe His Pro Asn Ala Glu Trp Ile Leu Lys Thr Leu Val Asn Thr Glu 2130 2135 2140 His Ala Tyr Glu Asn Lys Arg Ile Thr Val Glu Gly Gly Met Pro Ser 2145 2150 2155 2160 Gly Cys Ser Ala Thr Ser Ile Ile Asn Thr Ile Leu Asn Asn Ile Tyr 2165 2170 2175 Val Leu Tyr Ala Leu Arg Arg His Tyr Glu Gly Val Glu Leu Asp Ser 2180 2185 2190 Tyr Thr Met Ile Ser Tyr Gly Asp Asp Ile Val Val Ala Ser Asp Tyr 2195 2200 2205 Asp Leu Asp Phe Glu Ala Leu Lys Pro His Phe Lys Ser Leu Gly Gln 2210 2215 2220 Thr Ile Thr Pro Ala Asp Lys Ser Asp Lys Gly Phe Val Leu Gly His 2225 2230 2235 2240 Ser Ile Thr Asp Val Thr Phe Leu Lys Arg Ser Phe His Met Asp Tyr 2245 2250 2255 Gly Thr Gly Phe Tyr Lys Pro Val Met Ala Ser Lys Thr Leu Glu Ala 2260 2265 2270 Ile Leu Ser Phe Ala Arg Arg Gly Thr Ile Gln Glu Lys Leu Ile Ser 2275 2280 2285 Val Ala Gly Leu Ala Val His Ser Gly Pro Asp Glu Tyr Arg Arg Leu 2290 2295 2300 Phe Glu Pro Phe Gln Gly Leu Phe Glu Ile Pro Ser Tyr Arg Ser Leu 2305 2310 2315 2320 Tyr Leu Arg Trp Val Asn Ala Val Cys Gly Asp Ala 2325 2330 <210> 5 <211> 18 <212> PRT <213> Foot-and-mouth disease virus <400> 5 Leu Lys Ala Arg Asp Ile Asn Asp Ile Phe Ala Ile Leu Lys Asn Gly 1 5 10 15 Glu cys <210> 6 <211> 13 <212> PRT <213> Foot-and-mouth disease virus <400> 6 Gln Arg Asp Leu Asn Asp Pro Ser Lys Tyr Lys Glu Ala 1 5 10 <210> 7 <211> 12 <212> PRT <213> Foot-and-mouth disease virus <400> 7 Val Ala Pro Ala Pro Ser Lys Ser Arg Pro Glu Pro 1 5 10 <210> 8 <211> 12 <212> PRT <213> Foot-and-mouth disease virus <400> 8 Gly Lys Ser Gly Gln Gly Lys Ser Phe Leu Ala Asn 1 5 10 <210> 9 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 9 Ser Thr His Phe Thr Gly Arg Thr Asp Ser Val Trp Tyr Cys 1 5 10 <210> 10 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 10 Cys Pro Asp Pro Asp His Phe Asp Gly Tyr Asn Gln Gln Thr 1 5 10 <210> 11 <211> 15 <212> PRT <213> Foot-and-mouth disease virus <400> 11 Cys Met Asp Asp Leu Gly Gln Asn Pro Asp Gly Lys Asp Phe Lys 1 5 10 15 <210> 12 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 12 Cys Leu Glu Asp Lys Gly Lys Pro Phe Asn Ser Lys Val Ile 1 5 10 <210> 13 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 13 Cys Val Ser Ala Lys Asp Gly Tyr Lys Ile Asn Asn Lys Leu 1 5 10 <210> 14 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 14 Cys Lys Ala Leu Glu Asp Thr His Thr Asn Pro Val Ala Met 1 5 10 <210> 15 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 15 Cys Glu Met Lys Arg Met Gln Gln Asp Met Phe Lys Pro Gln 1 5 10 <210> 16 <211> 17 <212> PRT <213> Foot-and-mouth disease virus <400> 16 Cys Glu Val Ile Asp Arg Val Glu Leu His Glu Lys Val Ser Ser His 1 5 10 15 Pro <210> 17 <211> 15 <212> PRT <213> Foot-and-mouth disease virus <400> 17 Cys Glu Leu His Glu Lys Val Ser Ser His Pro Ile Phe Lys Gln 1 5 10 15 <210> 18 <211> 14 <212> PRT <213> Foot-and-mouth disease virus <400> 18 Gly Pro Tyr Thr Gly Pro Leu Glu Arg Gln Lys Pro Leu Lys 1 5 10 <210> 19 <211> 12 <212> PRT <213> Foot-and-mouth disease virus <400> 19 Pro Leu Lys Val Arg Ala Lys Leu Pro Gln Gln Glu 1 5 10 <210> 20 <211> 17 <212> DNA <213> Artificial Sequence <220> <223> rever primer for synthesis of virus cDNA <400> 20 gttttcccag tcacgac 17 <210> 21 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 1 position of the virus genome <400> 21 ttgaaagggg gcgctagggt c 21 <210> 22 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 368 position of the virus genome <400> 22 tgaaaggcgg gtttcgggtg 20 <210> 23 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 369 position of the virus genome <400> 23 aagttttacc gtctgtcccg 20 <210> 24 <211> 19 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 658 position of the virus genome <400> 24 ttgttaccaa ggaggagtt 19 <210> 25 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 665 position of the virus genome <400> 25 cctggtcttt ccaggtctag 20 <210> 26 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 1654 position of the virus genome <400> 26 tcaccaagct gtgtgttcca t 21 <210> 27 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 1749 position of the virus genome <400> 27 tcaacaatta ctacatgcag c 21 <210> 28 <211> 23 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 2907 position of the virus genome <400> 28 gtgccactgt actgtgttgt agt 23 <210> 29 <211> 18 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 2810 position of the virus genome <400> 29 gtgctcgccc agtttgac 18 <210> 30 <211> 19 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 3727 position of the virus genome <400> 30 gctgcctacc tccttcaat 19 <210> 31 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 3998 position of the virus genome <400> 31 cagatgcagg aggacatgtg 20 <210> 32 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 4109 position of the virus genome <400> 32 gagcttgtac cagggtttgg c 21 <210> 33 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 4482 position of the virus genome <400> 33 ccaagccttc atccagtcgc 20 <210> 34 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 5339 position of the virus genome <400> 34 gtgtcgagcc acccgatttt c 21 <210> 35 <211> 17 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 5836 position of the virus genome <400> 35 ggtttctgac gctcgag 17 <210> 36 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 5833 position of the virus genome <400> 36 ccactcgagc gtcagaaacc 20 <210> 37 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 6649 position of the virus genome <400> 37 ctcgtggtgt ggttcggggt c 21 <210> 38 <211> 22 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 6263 position of the virus genome <400> 38 gacaggacat gctctcagac gc 22 <210> 39 <211> 22 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 7519 position of the virus genome <400> 39 gatgcgtttg ttctcatagg cg 22 <210> 40 <211> 19 <212> DNA <213> Artificial Sequence <220> <223> forward primer starting at 7481 position of the virus genome <400> 40 gctgagtgga tcctgaaac 19 <210> 41 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 8068 position of the virus genome <400> 41 ggattatgcg tcaccgcaca 20 <210> 42 <211> 17 <212> DNA <213> Artificial Sequence <220> <223> reverse primer starting at 8155 position of the virus genome <400> 42 gttttcccag tcacgac 17

Claims (7)

서열번호 17 및 서열번호 18로 기재되는 아미노산 서열을 가지는 구제역 바이러스의 비구조단백질 2C 및 3B에 대한 펩타이드를 항원으로 포함하는 구제역 진단용 키트.A kit for diagnosis of foot-and-mouth disease comprising a peptide for non-structural proteins 2C and 3B of a foot-and-mouth virus having an amino acid sequence set forth in SEQ ID NO: 17 and SEQ ID NO: 18 as an antigen. 제 1항에 있어서, 상기에 더하여 마이크로타이터 플레이트, 분석용 완충용액, 표준항체, 2차 항체 및 발색기질을 추가로 포함하는 것을 특징으로 하는 구제역 진단용 키트.The method for diagnosing foot-and-mouth disease according to claim 1, further comprising a microtiter plate, an assay buffer, a standard antibody, a secondary antibody, and a color substrate. 제 2항에 있어서, 2차 항체는 발색효소 또는 형광물질이 결합되는 것을 특징으로 하는 구제역 진단용 키트.The method for diagnosing foot-and-mouth disease according to claim 2, wherein the secondary antibody is bound to a chromophore or a fluorescent substance. 1) 서열번호 17 및 서열번호 18로 기재되는 아미노산 서열을 가지는 펩타이드를 플레이트에 부착시키는 단계;1) attaching a peptide having an amino acid sequence set forth in SEQ ID NO: 17 and SEQ ID NO: 18 to a plate; 2) 상기 플레이트에 부착되지 않은 펩타이드를 세척하여 제거하는 단계;2) washing and removing peptides not attached to the plate; 3) 상기 펩타이드가 부착된 플레이트에 검사하고자 하는 동물의 가검 혈청을 반응시키는 단계;3) reacting the test serum of the animal to be tested on the plate to which the peptide is attached; 4) 항원 펩타이드에 결합하지 않은 가검 혈청을 세척하여 제거하는 단계;4) washing and removing the test serum that does not bind the antigen peptide; 5) 상기 가검 혈청 중의 구제역 바이러스에 대한 항체에 특이적으로 결합하며, 검출 마커가 결합된 콘쥬게이트를 반응시키는 단계; 및5) specifically binding to an antibody to foot-and-mouth virus in the test serum, and reacting the conjugate to which the detection marker is bound; And 6) 상기 결합된 콘쥬게이트의 특이도를 측정하는 단계를 포함하는 동물의 구제역을 진단하는 방법.6) A method for diagnosing foot and mouth disease in an animal comprising measuring the specificity of the conjugated conjugate. 제 4항에 있어서, 상기 동물은 소, 돼지, 양, 염소 및 사슴으로 구성된 군으로부터 선택되는 것을 특징으로 하는 방법.5. The method of claim 4, wherein said animal is selected from the group consisting of cattle, pigs, sheep, goats, and deer. 제 4항에 있어서, 상기 콘쥬게이트는 항체인 것을 특징으로 하는 방법.The method of claim 4, wherein the conjugate is an antibody. 제 4항에 있어서, 상기 검출 마커는 발색효소, 형광물질 및 방사선물질로 구성된 군으로부터 선택되는 것을 특징으로 하는 방법.The method of claim 4, wherein the detection marker is selected from the group consisting of chromophores, fluorescent materials, and radioactive materials.
KR10-2004-0010973A 2004-02-19 2004-02-19 Kit for Diagnosis of Foot-and-Mouth Disease Containing Peptide of 2C and 3B Nonstructural Protein of Foot-and-Mouth Disease Virus KR100536848B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR10-2004-0010973A KR100536848B1 (en) 2004-02-19 2004-02-19 Kit for Diagnosis of Foot-and-Mouth Disease Containing Peptide of 2C and 3B Nonstructural Protein of Foot-and-Mouth Disease Virus

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR10-2004-0010973A KR100536848B1 (en) 2004-02-19 2004-02-19 Kit for Diagnosis of Foot-and-Mouth Disease Containing Peptide of 2C and 3B Nonstructural Protein of Foot-and-Mouth Disease Virus

Publications (2)

Publication Number Publication Date
KR20050082512A true KR20050082512A (en) 2005-08-24
KR100536848B1 KR100536848B1 (en) 2005-12-19

Family

ID=37268915

Family Applications (1)

Application Number Title Priority Date Filing Date
KR10-2004-0010973A KR100536848B1 (en) 2004-02-19 2004-02-19 Kit for Diagnosis of Foot-and-Mouth Disease Containing Peptide of 2C and 3B Nonstructural Protein of Foot-and-Mouth Disease Virus

Country Status (1)

Country Link
KR (1) KR100536848B1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR100817264B1 (en) * 2005-10-31 2008-03-27 주식회사 제노바이오텍 3 Novel specific detection method for antibody against nonstructural protein in FMDV infected animal using 3AB protein and monoclonal antibody combination
KR101535555B1 (en) * 2012-12-24 2015-07-10 대한민국 Recombinant foot and mouth disease viruses using the vaccine strain, O manisa strain for protection of ME-SA topotype of O serotyp

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR100817264B1 (en) * 2005-10-31 2008-03-27 주식회사 제노바이오텍 3 Novel specific detection method for antibody against nonstructural protein in FMDV infected animal using 3AB protein and monoclonal antibody combination
KR101535555B1 (en) * 2012-12-24 2015-07-10 대한민국 Recombinant foot and mouth disease viruses using the vaccine strain, O manisa strain for protection of ME-SA topotype of O serotyp

Also Published As

Publication number Publication date
KR100536848B1 (en) 2005-12-19

Similar Documents

Publication Publication Date Title
CN111474345A (en) SARS-CoV-2 antibody detection method
CN112011544B (en) High-expression gene in schistosoma japonicum schistosomulum and coding protein and application thereof
CN112080506B (en) High-expression gene in schistosoma japonicum schistosomulum and coding protein and application thereof
CN115873079B (en) Canine infectious hepatitis virus hexon protein antigen, truncated body and application thereof
KR101667122B1 (en) Improved vaccine diagnostics
EP1144639A2 (en) Compounds and methods for the diagnosis and treatment of ehrlichia infection
CN106596966A (en) Chemiluminescent detection kit for bovine foot-and-mouth disease 3ABC antibody
KR20210106181A (en) Antigen protein composition for diagnosing infection of African Swan Fever and use thereof
JP4104665B2 (en) H. pylori diagnostic agent
CN102533663B (en) Foot-and-mouth disease hybridoma cell line, monoclonal antibody, detection reagent and test kit
US6696562B1 (en) Avian astrovirus
KR102086089B1 (en) Akabane viruses blocking ELISA using monoclonal antibodies against recombinant N protein
JP7213507B2 (en) Recombinant porcine parvovirus antigen protein and use thereof
KR100536848B1 (en) Kit for Diagnosis of Foot-and-Mouth Disease Containing Peptide of 2C and 3B Nonstructural Protein of Foot-and-Mouth Disease Virus
JP4830106B2 (en) Trichinella species-specific antigen and method for testing Trichinella infection using the antigen
KR102550527B1 (en) Recombinant antibody specific for white spot syndrome virus and use thereof
KR100430934B1 (en) Diagnostic methods of Foot-and-Mouth Disease using recombinant 3ABC non-structural protein expressed in insect cells and monoclonal antibody
KR102339120B1 (en) Method of detection of schmallenberg virus (sbv) and kit
KR20100105974A (en) Rift valley fever competition elisa using monoclonal antibodies against recombinant n protein
KR102254697B1 (en) Kit of detection for Foot and mouth disease virus with immono-polymerase chain reaction and method thereof
JPH11346768A (en) Protein having antigenicity of canine distemper virus nucleocapsid protein and reagent for assaying anti-canine distemper virus nucleocapsid protein antibody
CN112213493A (en) Peste des petits ruminants detection kit capable of distinguishing vaccine immunity from natural infection
KR102485291B1 (en) Detection kit for PEDV-specific IgA comprising recombinant spike protein of PEDV
KR100454727B1 (en) Diagnostic kit of hemorrhagic fever with renal syndrome using Baculovirus expressed nucleocapsid protein derived from Hantann virus 91011
KR100430935B1 (en) A diagnostic method of Foot-and-Mouth Disease using recombinant 3ABC non-structural protein expressed in E.coli and monoclonal antibody

Legal Events

Date Code Title Description
A201 Request for examination
E701 Decision to grant or registration of patent right
GRNT Written decision to grant