KR102621026B1 - Method for purification of a protein - Google Patents
Method for purification of a protein Download PDFInfo
- Publication number
- KR102621026B1 KR102621026B1 KR1020220132531A KR20220132531A KR102621026B1 KR 102621026 B1 KR102621026 B1 KR 102621026B1 KR 1020220132531 A KR1020220132531 A KR 1020220132531A KR 20220132531 A KR20220132531 A KR 20220132531A KR 102621026 B1 KR102621026 B1 KR 102621026B1
- Authority
- KR
- South Korea
- Prior art keywords
- target protein
- supernatant
- culture medium
- protein
- centrifugation
- Prior art date
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 95
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 89
- 238000000034 method Methods 0.000 title claims abstract description 30
- 238000000746 purification Methods 0.000 title claims description 8
- 239000006228 supernatant Substances 0.000 claims abstract description 54
- 239000006143 cell culture medium Substances 0.000 claims abstract description 18
- 239000001963 growth medium Substances 0.000 claims abstract description 17
- 229920001184 polypeptide Polymers 0.000 claims abstract description 16
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 16
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 16
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 13
- 238000001914 filtration Methods 0.000 claims abstract description 8
- 238000012258 culturing Methods 0.000 claims abstract description 6
- 238000005119 centrifugation Methods 0.000 claims description 46
- 239000000706 filtrate Substances 0.000 claims description 13
- 108020003175 receptors Proteins 0.000 claims description 9
- 102000005962 receptors Human genes 0.000 claims description 9
- 238000001471 micro-filtration Methods 0.000 claims description 7
- 101000629318 Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein Proteins 0.000 claims description 6
- 239000004094 surface-active agent Substances 0.000 claims description 6
- 239000002105 nanoparticle Substances 0.000 claims description 3
- 241000699802 Cricetulus griseus Species 0.000 claims description 2
- 210000001672 ovary Anatomy 0.000 claims description 2
- 238000004519 manufacturing process Methods 0.000 abstract description 15
- 230000014616 translation Effects 0.000 abstract description 5
- 238000005516 engineering process Methods 0.000 abstract description 3
- 210000004027 cell Anatomy 0.000 description 65
- 239000012535 impurity Substances 0.000 description 21
- 241001678559 COVID-19 virus Species 0.000 description 10
- 238000004113 cell culture Methods 0.000 description 8
- 230000035772 mutation Effects 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- 230000008859 change Effects 0.000 description 6
- 239000013598 vector Substances 0.000 description 6
- 241000700605 Viruses Species 0.000 description 5
- 210000004102 animal cell Anatomy 0.000 description 5
- 108091007433 antigens Proteins 0.000 description 5
- 102000036639 antigens Human genes 0.000 description 5
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 208000015181 infectious disease Diseases 0.000 description 5
- 239000001301 oxygen Substances 0.000 description 5
- 229910052760 oxygen Inorganic materials 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 229960005486 vaccine Drugs 0.000 description 5
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 239000000178 monomer Substances 0.000 description 4
- 239000011148 porous material Substances 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- 230000009385 viral infection Effects 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 108010076504 Protein Sorting Signals Proteins 0.000 description 3
- 239000012930 cell culture fluid Substances 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- -1 etc.) Proteins 0.000 description 3
- 239000007789 gas Substances 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 150000007523 nucleic acids Chemical group 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 239000013636 protein dimer Substances 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 238000004904 shortening Methods 0.000 description 3
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 3
- 238000002255 vaccination Methods 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 241001212789 Dynamis Species 0.000 description 2
- 241000204031 Mycoplasma Species 0.000 description 2
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 2
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 2
- 108091081024 Start codon Proteins 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 239000001569 carbon dioxide Substances 0.000 description 2
- 229910002092 carbon dioxide Inorganic materials 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- 239000012531 culture fluid Substances 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 230000002349 favourable effect Effects 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000011081 inoculation Methods 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- UMCMPZBLKLEWAF-BCTGSCMUSA-N 3-[(3-cholamidopropyl)dimethylammonio]propane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 UMCMPZBLKLEWAF-BCTGSCMUSA-N 0.000 description 1
- GUQQBLRVXOUDTN-XOHPMCGNSA-N 3-[dimethyl-[3-[[(4r)-4-[(3r,5s,7r,8r,9s,10s,12s,13r,14s,17r)-3,7,12-trihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]pentanoyl]amino]propyl]azaniumyl]-2-hydroxypropane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CC(O)CS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 GUQQBLRVXOUDTN-XOHPMCGNSA-N 0.000 description 1
- 102000053723 Angiotensin-converting enzyme 2 Human genes 0.000 description 1
- 108090000975 Angiotensin-converting enzyme 2 Proteins 0.000 description 1
- 238000009020 BCA Protein Assay Kit Methods 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 241000008904 Betacoronavirus Species 0.000 description 1
- 208000025721 COVID-19 Diseases 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 102000007644 Colony-Stimulating Factors Human genes 0.000 description 1
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 1
- 244000289527 Cordyline terminalis Species 0.000 description 1
- 235000009091 Cordyline terminalis Nutrition 0.000 description 1
- 241000711573 Coronaviridae Species 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N DMSO Substances CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- QRLVDLBMBULFAL-UHFFFAOYSA-N Digitonin Natural products CC1CCC2(OC1)OC3C(O)C4C5CCC6CC(OC7OC(CO)C(OC8OC(CO)C(O)C(OC9OCC(O)C(O)C9OC%10OC(CO)C(O)C(OC%11OC(CO)C(O)C(O)C%11O)C%10O)C8O)C(O)C7O)C(O)CC6(C)C5CCC4(C)C3C2C QRLVDLBMBULFAL-UHFFFAOYSA-N 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 238000008157 ELISA kit Methods 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000003951 Erythropoietin Human genes 0.000 description 1
- 108090000394 Erythropoietin Proteins 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 101710114810 Glycoprotein Proteins 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 229940096437 Protein S Drugs 0.000 description 1
- 102000004278 Receptor Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000873 Receptor Protein-Tyrosine Kinases Proteins 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 208000037847 SARS-CoV-2-infection Diseases 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 241000235088 Saccharomyces sp. Species 0.000 description 1
- 241001678561 Sarbecovirus Species 0.000 description 1
- UIIMBOGNXHQVGW-DEQYMQKBSA-M Sodium bicarbonate-14C Chemical compound [Na+].O[14C]([O-])=O UIIMBOGNXHQVGW-DEQYMQKBSA-M 0.000 description 1
- 101710167605 Spike glycoprotein Proteins 0.000 description 1
- 101710198474 Spike protein Proteins 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 1
- 108050006628 Viral movement proteins Proteins 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 238000010370 cell cloning Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 239000013530 defoamer Substances 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- KXGVEGMKQFWNSR-LLQZFEROSA-N deoxycholic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 KXGVEGMKQFWNSR-LLQZFEROSA-N 0.000 description 1
- UVYVLBIGDKGWPX-KUAJCENISA-N digitonin Chemical compound O([C@@H]1[C@@H]([C@]2(CC[C@@H]3[C@@]4(C)C[C@@H](O)[C@H](O[C@H]5[C@@H]([C@@H](O)[C@@H](O[C@H]6[C@@H]([C@@H](O[C@H]7[C@@H]([C@@H](O)[C@H](O)CO7)O)[C@H](O)[C@@H](CO)O6)O[C@H]6[C@@H]([C@@H](O[C@H]7[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O7)O)[C@@H](O)[C@@H](CO)O6)O)[C@@H](CO)O5)O)C[C@@H]4CC[C@H]3[C@@H]2[C@@H]1O)C)[C@@H]1C)[C@]11CC[C@@H](C)CO1 UVYVLBIGDKGWPX-KUAJCENISA-N 0.000 description 1
- UVYVLBIGDKGWPX-UHFFFAOYSA-N digitonine Natural products CC1C(C2(CCC3C4(C)CC(O)C(OC5C(C(O)C(OC6C(C(OC7C(C(O)C(O)CO7)O)C(O)C(CO)O6)OC6C(C(OC7C(C(O)C(O)C(CO)O7)O)C(O)C(CO)O6)O)C(CO)O5)O)CC4CCC3C2C2O)C)C2OC11CCC(C)CO1 UVYVLBIGDKGWPX-UHFFFAOYSA-N 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 239000002532 enzyme inhibitor Substances 0.000 description 1
- 229940105423 erythropoietin Drugs 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 102000005396 glutamine synthetase Human genes 0.000 description 1
- 108020002326 glutamine synthetase Proteins 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 238000013095 identification testing Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 239000012499 inoculation medium Substances 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 238000011031 large-scale manufacturing process Methods 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 230000031787 nutrient reservoir activity Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 238000011110 re-filtration Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 102220002645 rs104894309 Human genes 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 235000017557 sodium bicarbonate Nutrition 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 102000003390 tumor necrosis factor Human genes 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/14—Extraction; Separation; Purification
- C07K1/34—Extraction; Separation; Purification by filtration, ultrafiltration or reverse osmosis
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20051—Methods of production or purification of viral material
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Virology (AREA)
- Gastroenterology & Hepatology (AREA)
- Engineering & Computer Science (AREA)
- Water Supply & Treatment (AREA)
- Analytical Chemistry (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 출원에 의해 개시되는 기술의 일 양태에 따르면, 서열번호 1로 표시되는 아미노산 서열로 표시되는 폴리펩타이드 또는 이와 75% 이상 서열 상동성을 갖는 폴리펩타이드인 목적 단백질을 발현하는 세포 배양액의 정제 방법으로서, 상기 목적 단백질을 발현하는 세포주를 배양하는 단계 이후에, (a) 상기 세포 배양액을 원심분리하여 상층액을 회수하는 단계; 및 (b) 상기 회수된 배양액을 여과하는 단계를 포함하는, 정제 방법을 제공한다. 또한, 본 발명에 따른 목적 단백질을 발현하는 세포 배양액의 정제 방법은 단백질 생산공정을 개선하고, 단백질 생산비용을 절감하면서도, 상기 단백질을 대량생산하는데 사용될 수 있다.According to one aspect of the technology disclosed by the present application, a method for purifying a cell culture medium expressing a target protein, which is a polypeptide represented by the amino acid sequence shown in SEQ ID NO: 1 or a polypeptide having at least 75% sequence homology thereto, , after culturing the cell line expressing the target protein, (a) centrifuging the cell culture medium to recover the supernatant; and (b) filtering the recovered culture medium. In addition, the method for purifying a cell culture medium expressing a target protein according to the present invention can be used to mass-produce the protein while improving the protein production process and reducing protein production costs.
Description
본 발명은 목적 단백질을 대량 생산하면서도 생산 비용을 절감할 수 있는 상기 단백질을 발현하는 세포 배양액의 정제 방법으로서, 특히, SARS-CoV-2 (Severe Acute Respiratory Syndrome-Coronavirus-2) 감염을 예방하고/하거나 감염시 발현되는 증상을 완화하는 목적으로 사용되는 백신의 항원 단백질을 발현하는 세포 배양액을 정제하는 방법에 관한 것이다.The present invention is a method for purifying a cell culture medium expressing a target protein that can mass-produce the target protein while reducing production costs, and in particular, prevents SARS-CoV-2 (Severe Acute Respiratory Syndrome-Coronavirus-2) infection/ It relates to a method of purifying a cell culture medium expressing an antigen protein of a vaccine used for the purpose of alleviating symptoms that occur during infection.
2019년 12월 이후 팬데믹 감염이 보고된 SARS-CoV-2 바이러스는 Coronaviridae family, Betacoronavirus genus Sarbecovirus subgenus에 속하는 바이러스로서, 바이러스 표면의 삼량체 (trimer) 당단백질 (즉, 스파이크 (Spike) 단백질) 상단의 수용체 결합 도메인 (Receptor Binding Domain, RBD)이 인체 세포 표면의 ACE2 수용체 단백질에 결합함으로써 감염을 일으키는 것으로 알려져 있다. 스파이크 당단백질 단량체 (monomer)는 숙주세포 단백질 분해효소 (protease)에 의하여 S1 서브유닛 및 S2 서브유닛으로 분리된다. The SARS-CoV-2 virus, with which pandemic infections have been reported since December 2019, is a virus belonging to the Coronaviridae family, Betacoronavirus genus Sarbecovirus subgenus, and is located at the top of the trimer glycoprotein (i.e., Spike protein) on the surface of the virus. It is known that the Receptor Binding Domain (RBD) causes infection by binding to the ACE2 receptor protein on the surface of human cells. The spike glycoprotein monomer is separated into S1 subunit and S2 subunit by host cell protease.
상기 SARS-CoV-2 바이러스 감염의 주된 전파경로는 감염자의 비말과의 밀접접촉인 것으로 알려져 있다. 그러나, 감염자와 직접 접촉하거나 또는 감염자의 비말 등에 의하여 오염된 물품과 같은 매개체를 만진 후, 손을 씻지 않은 채 눈, 코, 입 등을 만짐으로써 바이러스 전파가 이루어질 수도 있다고 알려져 있다. It is known that the main transmission route for the SARS-CoV-2 virus infection is close contact with droplets from an infected person. However, it is known that the virus can be transmitted through direct contact with an infected person or by touching a medium such as an item contaminated by droplets of an infected person and then touching the eyes, nose, mouth, etc. without washing hands.
한편, 2020년 SARS-CoV-2 바이러스 감염으로 인한 사회경제적 피해가 심화되면서 미국, 유럽 등 다양한 국가에서 SARS-CoV-2 바이러스 감염에 따른 증세를 완화하는 효과를 갖는 백신 사용에 대한 긴급승인과 함께 전세계적으로 여러 국가에서 백신 접종이 개시되었다. 그러나, 상기 백신을 접종하였더라도 백신 접종자에서의 SARS-CoV-2 바이러스 감염을 원천 차단하지는 못한다. Meanwhile, as the socioeconomic damage caused by SARS-CoV-2 virus infection intensifies in 2020, various countries, including the United States and Europe, have granted emergency approval for the use of vaccines that have the effect of alleviating symptoms caused by SARS-CoV-2 virus infection. Vaccination has begun in many countries around the world. However, even if the above vaccine has been administered, it cannot prevent SARS-CoV-2 virus infection in the vaccinated person.
더욱이, 알파변이, 베타 변이, 감마 변이, 엡실론 변이, 델타 변이, 카파 변이, 에타 변이와 같은 SARS-CoV-2 바이러스 변이가 계속 보고되고 있으며, 백신 접종자에서의 이러한 변이된 SARS-CoV-2 바이러스 감염이 계속적으로 발생하고 있다. 따라서, 체내 유효 항체 수치를 유지하기 위한 목적으로 백신 접종자를 대상으로 한 추가 백신 접종이 권고되고 있는 실정이다. 나아가, 각국 정부는 SARS-CoV-2 감염이 사회경제에 미치는 영향을 고려하여 SARS-CoV-2 백신 접종 대상을 청소년 층까지 확대하고 있는바, SARS-CoV-2 감염 예방 백신 및 상기 백신에 사용될 수 있는 항원 단백질 생산 수요가 급증하고 있다. 식물에서 목적 단백질을 대량 생산하는 방법에 대해서는 이미 공지되어 있으나(공개특허 제10-2021-0117808호), 동물성 세포에서 목적 단백질을 대량 생산하는 방법에 대해서는 아직 연구가 부족한 실정이다. 따라서, 단기간 내 동물성 세포에서 백신 항원 단백질을 대량생산할 수 있는 제조 방법의 개발이 요구된다. Moreover, SARS-CoV-2 virus mutations such as alpha mutation, beta mutation, gamma mutation, epsilon mutation, delta mutation, kappa mutation, and eta mutation continue to be reported, and these mutated SARS-CoV-2 viruses in vaccinated people Infections continue to occur. Therefore, additional vaccination is being recommended for vaccinated people in order to maintain effective antibody levels in the body. Furthermore, considering the impact of SARS-CoV-2 infection on the socioeconomics, governments in each country are expanding the scope of SARS-CoV-2 vaccination to include adolescents. Demand for the production of antigen proteins is rapidly increasing. Methods for mass producing target proteins in plants are already known (Patent Publication No. 10-2021-0117808), but there is still a lack of research on methods for mass producing target proteins in animal cells. Therefore, there is a need to develop a manufacturing method that can mass produce vaccine antigen proteins from animal cells within a short period of time.
본 발명자들은 백신의 항원 단백질의 생산 단가를 절감하는 방법에 대한 연구를 진행하던 중, 바이오리액터에서 배양한 목적 단백질을 발현하는 세포 배양액을 회수하고 목적 단백질을 정제하는 과정에서 원심분리기에 배양액이 공급되는 속도인 공급유속 (feed flow)을 변화시킴에 따라 공정에 소요되는 시간 단축 및 원심분리 상층액 내 불순물 감소효과를 얻을 수 있고, 원심분리 이후 공정에서 불순물 감소를 위하여 사용되는 필터 수량이 달라짐으로써 생산 공정을 개선하고 단백질 생산 단가를 절감할 수 있다는 점을 발견하여 본 발명을 완성하였다. While conducting research on a method of reducing the production cost of vaccine antigen proteins, the present inventors recovered cell culture fluid expressing the target protein cultured in a bioreactor and supplied the culture fluid to a centrifuge in the process of purifying the target protein. By changing the feed flow, it is possible to shorten the time required for the process and reduce impurities in the centrifugation supernatant, and by changing the quantity of filters used to reduce impurities in the post-centrifugation process. The present invention was completed by discovering that the production process could be improved and the protein production cost could be reduced.
본 출원에 의해 개시되는 기술의 일 양태에 따르면, 목적 단백질을 발현하는 세포 배양액의 정제 방법으로서, 상기 목적 단백질을 발현하는 세포주를 배양하는 단계 이후에, (a) 상기 세포 배양액을 원심분리하여 상층액을 회수하는 단계; 및 (b) 상기 회수된 배양액을 여과하는 단계를 포함하는 정제 방법을 제공한다. According to one aspect of the technology disclosed by the present application, as a method of purifying a cell culture fluid expressing a target protein, after culturing a cell line expressing the target protein, (a) centrifuging the cell culture fluid to separate the upper layer; recovering the liquid; and (b) filtering the recovered culture medium.
본 발명에 따른 목적 단백질을 발현하는 세포 배양액의 정제 방법은 단백질 생산 공정을 개선하고 단백질 생산비용을 절감하면서도, 상기 단백질을 대량생산하는데 사용될 수 있다.The method for purifying cell culture expressing a target protein according to the present invention can be used to mass-produce the protein while improving the protein production process and reducing protein production costs.
도 1은 서열번호 1의 목적 단백질을 코딩하는 염기서열을 포함하는 벡터의 구조를 나타낸 것이다.
도 2는 목적 단백질을 발현하는 세포 배양액 2000 L를 원심분리하는 과정에서 공급유속을 각각 200 L/h, 300 L/h 또는 400 L/h로 하여 얻은 (i) 원심분리 상층액 내 목적 단백질 함량, (ii) 상기 원심분리 상층액에 A1HC 심층필터를 적용하여 여과하였을 때 여과액 내 목적 단백질 함량 및 (iii) 상기 A1HC 심층필터 여과액에 0.5/0.2 ㎛ 필터를 적용하여 여과하였을 때 여과액 내 목적 단백질 함량을 SDS-PAGE로 측정한 결과를 나타낸 것이다.
도 3은 목적 단백질을 발현하는 세포 배양액 2000 L를 200 L/h의 공급유속으로 원심분리하여 얻은 (i) 원심분리 상층액 내 목적 단백질 함량, (ii) 상기 원심분리 상층액에 0.45 ㎛ 필터를 적용하여 여과하였을 때 여과액 내 목적 단백질 함량 및 (iii) 상기 0.45 ㎛ 필터 여과액에 0.2 ㎛ 필터를 적용하여 여과하였을 때 여과액 내 목적 단백질 함량을 SDS-PAGE로 측정한 결과를 나타낸 것이다. Figure 1 shows the structure of a vector containing the base sequence encoding the target protein of SEQ ID NO: 1.
Figure 2 shows the target protein content in (i) centrifugation supernatant obtained by centrifuging 2000 L of cell culture expressing the target protein at a feed flow rate of 200 L/h, 300 L/h, or 400 L/h, respectively. , (ii) the target protein content in the filtrate when the centrifuged supernatant was filtered using an A1HC depth filter, and (iii) the content of the target protein in the filtrate when the A1HC depth filter filtrate was filtered using a 0.5/0.2 ㎛ filter. This shows the results of measuring the target protein content using SDS-PAGE.
Figure 3 shows (i) the target protein content in the centrifuged supernatant obtained by centrifuging 2000 L of a cell culture medium expressing the target protein at a feed flow rate of 200 L/h, (ii) a 0.45 ㎛ filter in the centrifuged supernatant. The results show the results of measuring the target protein content in the filtrate when applied and filtered and (iii) the target protein content in the filtrate when the 0.45 μm filter filtrate was applied and filtered through a 0.2 μm filter using SDS-PAGE.
이하, 본 발명을 보다 구체적으로 설명한다. Hereinafter, the present invention will be described in more detail.
본 발명의 일 측면은, 목적 단백질을 발현하는 세포 배양액의 정제 방법으로서, 상기 목적 단백질을 발현하는 세포주를 배양하는 단계 이후에, (a) 상기 세포 배양액을 원심분리하여 상층액을 회수하는 단계; 및 (b) 상기 회수된 배양액을 여과하는 단계를 포함하는 정제 방법을 제공한다. One aspect of the present invention is a method of purifying a cell culture medium expressing a target protein, comprising: (a) centrifuging the cell culture medium to recover the supernatant after culturing a cell line expressing the target protein; and (b) filtering the recovered culture medium.
상기 "목적 단백질"은 세포가 발현 가능한 모든 종류의 외래 산물 단백질이다. 대표적으로, 인슐린, 사이토카인(인터루킨, 종양괴사인자, 인터페론, 콜로니자극인자, 케모카인 등등), 에리트로포이에틴, 항원, 항체, 항체 단편, 구조 단백질, 조절단백질, 전사인자, 독소 단백질, 호르몬, 호르몬 유사체, 효소, 효소 저해제, 수송단백질, 리셉터 (예컨대, 티로신 키나아제 수용체 등), 리셉터의 단편, 생체방어 유도물질, 저장단백질, 이동단백질(movement protein), 익스플로이티브 프로틴(exploitive protein), 리포터 단백질, 성장 인자 등이 있으며, 이러한 목적 단백질은 세포주에서의 발현을 위한 벡터에 상기 목적 단백질을 코딩하는 유전자를 삽입할 수 있도록 하는 제한 효소 인지 또는 절단 부위가 도입되어 있는 핵산 서열인 "클로닝 부위" 를 포함할 수 있다. The “target protein” is any type of foreign product protein that can be expressed by cells. Typically, insulin, cytokines (interleukin, tumor necrosis factor, interferon, colony-stimulating factor, chemokine, etc.), erythropoietin, antigen, antibody, antibody fragment, structural protein, regulatory protein, transcription factor, toxin protein, hormone, hormone. Analogs, enzymes, enzyme inhibitors, transport proteins, receptors (e.g., tyrosine kinase receptors, etc.), fragments of receptors, biodefense inducers, storage proteins, movement proteins, exploitive proteins, reporter proteins, growth factors, etc., and these target proteins contain a "cloning site" which is a nucleic acid sequence into which a restriction enzyme recognition or cleavage site is introduced that allows insertion of the gene encoding the target protein into a vector for expression in cell lines. can do.
본 발명에서 상기 목적 단백질은 국제특허공보 제2021-163438호의 청구항 1에 기재된 폴리펩타이드 중 하나이거나, 국제특허공보 제2019-169120호, 미국 특허공보 제9630994호, 국제특허공보 제WO2021-163481호, 국제특허공보 제WO2021-163438호, 또는 국제출원 제PCT/US2021/037341호의 명세서에 개시된 폴리펩타이드 중 하나일 수 있다. 바람직하게는, 상기 목적 단백질에서 RBD 및 링커 부분을 제외한 단백질은 국제특허공보 제2019-169120호에 개시된 서열번호 7, 29, 30, 31, 또는 39로 표시되는 아미노산 서열을 갖는 폴리펩타이드이거나, 상기 국제특허공보 제2019-169120호에 개시된 폴리펩타이드의 아미노산 서열과 85% 이상 서열 상동성을 갖는 폴리펩타이드일 수 있다. In the present invention, the target protein is one of the polypeptides described in claim 1 of International Patent Publication No. 2021-163438, or International Patent Publication No. 2019-169120, US Patent Publication No. 9630994, International Patent Publication No. WO2021-163481, It may be one of the polypeptides disclosed in the specification of International Patent Publication No. WO2021-163438 or International Application No. PCT/US2021/037341. Preferably, the protein of interest excluding the RBD and linker portion is a polypeptide having an amino acid sequence represented by SEQ ID NO: 7, 29, 30, 31, or 39 disclosed in International Patent Publication No. 2019-169120, or It may be a polypeptide having at least 85% sequence homology to the amino acid sequence of the polypeptide disclosed in International Patent Publication No. 2019-169120.
본 발명의 일 구체예에서, 상기 목적 단백질은 SARS-CoV-2 스파이크 단백질의 수용체 결합 도메인(Receptor Binding Domain) 및 나노입자의 구조체인 I53-50A를 포함하는 단백질일 수 있다. 또한, 본 발명의 일 실시양태에서, 상기 목적 단백질은 SARS-CoV-2 스파이크 단백질의 수용체 결합 도메인, 및 I53-50A, SARS-CoV-2 스파이크 단백질의 수용체 결합 도메인과 I53-50A를 연결하는 링커를 포함하는 단백질일 수 있다. 나아가, 본 발명의 다른 실시양태에서, 상기 목적 단백질은 SARS-CoV-2 스파이크 단백질의 수용체 결합 도메인, I53-50A, SARS-CoV-2 스파이크 단백질의 수용체 결합 도메인과 I53-50A를 연결하는 링커 및 N-말단 포스파타제 시그널 펩타이드를 포함하는 단백질일 수 있다. 이때, 상기 나노입자의 구조체인 I53-50A의 아미노산 서열은 KMEELFKKHKIVAVLRANSVEEAIEKAVAVFAGGVHLIEITFTVPDADTVIKALSVLKEKGAIIGAGTVTSVEQARKAVESGAEFIVSPHLDEEISQFAKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVAEWFKAGVLAVGVGSALVKGTPDEVREKAKAFVEKIRGATE일 수 있으며, 상기 링커의 아미노산 서열은 GGSGGSGSGGSGGSGSEKAAKAEEAAR일 수 있고, 상기 N-말단 포스파타제 시그널 펩타이드의 아미노산 서열은 MGILPSPGMPALLSLVSLLSVLLMGCVAETGT일 수 있다. In one embodiment of the present invention, the target protein may be a protein containing the receptor binding domain of the SARS-CoV-2 spike protein and I53-50A, which is a nanoparticle structure. In addition, in one embodiment of the present invention, the target protein is a receptor binding domain of the SARS-CoV-2 spike protein, and I53-50A, a linker connecting the receptor binding domain of the SARS-CoV-2 spike protein and I53-50A. It may be a protein containing. Furthermore, in another embodiment of the present invention, the target protein includes the receptor binding domain of the SARS-CoV-2 spike protein, I53-50A, a linker connecting the receptor binding domain of the SARS-CoV-2 spike protein and I53-50A, and It may be a protein containing an N-terminal phosphatase signal peptide. At this time, the amino acid sequence of I53-50A, which is the structure of the nanoparticle, is KMEELFKKHKIVAVLRANSVEEAIEKAVAVFAGGVHLIEITFTVPDADTVIKALSVLKEKGAIIGAGTVTSVEQARKAVESGAEFIVSPHLDEEISQFAKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVAEWFKAGVLAVG It may be VGSALVKGTPDEVREKAKAFVEKIRGATE, the amino acid sequence of the linker may be GGSGGSGSGGSGGSGSEKAAKAEEAAR, and the amino acid sequence of the N-terminal phosphatase signal peptide may be MGILPSPGMPALLSLVSLLSVLLMGCVAETGT.
본 발명의 다른 구체예에서, 상기 목적 단백질은 서열번호 1로 표시되는 아미노산 서열로 이루어진 폴리펩타이드이거나, 상기 서열번호 1로 표시되는 아미노산 서열과 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상 또는 99% 이상 서열 상동성을 갖는 폴리펩타이드일 수 있다. 상기 목적 단백질은 서열번호 2로 표시되는 염기서열로 이루어진 유전자에 의해 코딩되거나, 상기 서열번호 2로 표시되는 염기서열과 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상 또는 99% 이상 서열 상동성을 갖는 염기 서열에 의하여 코딩될 수 있다. In another embodiment of the present invention, the target protein is a polypeptide consisting of the amino acid sequence represented by SEQ ID NO: 1, or at least 70%, 75%, 80%, or 85% of the amino acid sequence represented by SEQ ID NO: 1. It may be a polypeptide having sequence homology of at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%. there is. The target protein is encoded by a gene consisting of the base sequence shown in SEQ ID NO: 2, or contains at least 70%, 75%, 80%, 85%, 90%, or more of the base sequence shown in SEQ ID NO: 2, respectively. It may be encoded by a base sequence having sequence homology of more than 91%, more than 92%, more than 93%, more than 94%, more than 95%, more than 96%, more than 97%, more than 98%, or more than 99%.
상기 목적 단백질을 생산하는 세포주는 서열번호 1로 표시되는 아미노산 서열로 표시되는 폴리펩타이드 또는 이와 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상 또는 99% 이상 서열 상동성을 갖는 폴리펩타이드를 코딩하는 유전자를 포함하는 발현 벡터를 갖는 세포주일 수 있다. 본 발명의 일 구체예에서, 상기 발현 벡터는 플라스미드 벡터일 수 있으나, 세포에 서열번호 1로 표시되는 아미노산 서열로 표시되는 폴리펩타이드 또는 이와 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상 또는 99% 이상 서열 상동성을 갖는 폴리펩타이드를 코딩하는 유전자를 형질감염하기에 적합한 벡터라면 제한없이 사용될 수 있다. The cell line producing the target protein is a polypeptide represented by the amino acid sequence shown in SEQ ID NO: 1 or more than 70%, more than 75%, more than 80%, more than 85%, more than 90%, more than 91%, more than 92%. , It may be a cell line having an expression vector containing a gene encoding a polypeptide having sequence homology of at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%. . In one embodiment of the present invention, the expression vector may be a plasmid vector, but the cell contains a polypeptide represented by the amino acid sequence shown in SEQ ID NO: 1 or at least 70%, 75%, 80%, or 85% thereof. , encoding a polypeptide having at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence homology. Any vector suitable for transfecting a gene can be used without limitation.
한편, 본 발명에서 서열번호 1로 표시되는 아미노산 서열로 표시되는 단백질을 코딩하는 유전자를 포함하는 발현 벡터는 서열번호 3으로 표시되는 DNA 서열을 가질 수 있다.Meanwhile, in the present invention, an expression vector containing a gene encoding a protein represented by the amino acid sequence represented by SEQ ID NO: 1 may have a DNA sequence represented by SEQ ID NO: 3.
본 발명에서 사용된 용어, "벡터"는 숙주세포에 도입되어 숙주세포 유전체 내로 재조합 및 삽입될 수 있거나, 또는 에피좀 (episome)으로 자발적으로 복제될 수 있는 뉴클레오티드 서열을 포함하는 핵산 수단을 말한다. 적합한 발현 벡터는 프로모터, 개시코돈, 종결코돈, 폴리아데닐화 신호 및 인핸서 같은 발현 조절 요소 (element) 외에도 막 표적화 또는 분비를 위한 신호서열 또는 리더서열을 포함하며, 목적에 따라 다양하게 제조될 수 있다. 개시코돈 및 종결코돈을 표적 단백질을 암호화하는 유전자 작제물이 투여되었을 때 개체에서 반드시 작용을 나타내야 하며 암호화 서열과 인프레임 (in frame)에 있어야 한다.As used in the present invention, the term "vector" refers to a nucleic acid vehicle containing a nucleotide sequence that can be introduced into a host cell and recombined and inserted into the host cell genome, or can be spontaneously replicated as an episome. A suitable expression vector includes expression control elements such as a promoter, start codon, stop codon, polyadenylation signal, and enhancer, as well as a signal sequence or leader sequence for membrane targeting or secretion, and can be manufactured in various ways depending on the purpose. . When a genetic construct encoding a target protein is administered, the start codon and stop codon must be effective in the subject and must be in frame with the coding sequence.
본 발명의 일 구체예에 따른 폴리뉴클레오티드 또는 벡터는 게놈 외부의 독립적 분자, 구체적으로는 복제할 수 있는 분자로서 유전적으로 변형된 숙주세포 또는 비-인간 숙주개체 내에 존재할 수 있거나, 또는 숙주세포 또는 비-인간 숙주개체의 게놈으로 안정적으로 삽입될 수 있다. A polynucleotide or vector according to one embodiment of the present invention is an independent molecule outside the genome, specifically a molecule capable of replicating, and may exist in a genetically modified host cell or non-human host organism, or may be present in a host cell or non-human host organism. -Can be stably inserted into the genome of a human host organism.
본 발명의 일 구체예에 따른 목적 단백질을 발현하는 세포주의 숙주세포는 진핵세포이다. 상기 진핵세포는 진균세포 (fungus), 식물세포 또는 동물세포를 포함한다. 진균세포의 예로는 효모, 구체적으로는 사카로마이세스 속(Saccharomyces sp.)의 효모, 더욱 구체적으로는 사카로마이세스 세레비지애 (S. cerevisiae)일 수 있다. 또한, 동물세포의 예로는 곤충세포 또는 포유동물 세포가 있고, 구체적인 동물세포의 예로는 HEK293, 293T, NSO, 중국 햄스터 난소 세포(CHO), MDCK, U2-OSHela, NIH3T3, MOLT-4, Jurkat, PC-12, PC-3, IMR, NT2N, Sk-n-sh, CaSki, C33A 등이 있다. 또한, 통상의 기술분야에 잘 알려져 있는 적당한 세포주들은 ATCC (American Type Culture Collection)와 같은 세포주 기탁기관으로부터 수득할 수 있다. The host cell of the cell line expressing the target protein according to one embodiment of the present invention is a eukaryotic cell. The eukaryotic cells include fungus cells, plant cells, or animal cells. Examples of fungal cells include yeast, specifically yeast of the genus Saccharomyces ( Saccharomyces sp .), and more specifically S. cerevisiae . In addition, examples of animal cells include insect cells or mammalian cells, and specific examples of animal cells include HEK293, 293T, NSO, Chinese hamster ovary cells (CHO), MDCK, U2-OSHela, NIH3T3, MOLT-4, Jurkat, These include PC-12, PC-3, IMR, NT2N, Sk-n-sh, CaSki, C33A, etc. Additionally, suitable cell lines well known in the art can be obtained from cell line depositories such as ATCC (American Type Culture Collection).
본 발명의 일 구체에에 따른 목적 단백질을 발현하는 세포주의 숙주세포는 중국 햄스터 난소 (CHO) 세포일 수 있으며, 바람직하게는 재조합 아데노-관련 바이러스 (recombinant Adeno-Associated Virus, rAAV)에 의하여 Glutamine Synthetase 유전자의 6번 엑손이 넉아웃 (Knock-out)된 HD-BIOP3 세포를 사용할 수 있다. The host cell of the cell line expressing the target protein according to one embodiment of the present invention may be Chinese hamster ovary (CHO) cells, and is preferably activated by Glutamine Synthetase by recombinant Adeno-Associated Virus (rAAV). HD-BIOP3 cells in which exon 6 of the gene has been knocked out can be used.
상기 숙주세포에 목적 단백질을 코딩하는 유전 서열을 갖는 발현 벡터를 도입하기 위해서는 핵산을 세포 내로 도입하는 어떤 방법이든 사용할 수 있고, 숙주세포에 따라 통상의 기술분야에 공지된 기술을 사용할 수 있다. 예를 들어, 열충격법 (Heat Shock), 전기천공법 (Electroporation), 인산칼슘 (CaPO4) 침전, 염화칼슘 (CaCl2) 침전, 미세주입법 (microinjection), 폴리에틸렌글리콜 (PEG)법, DEAE-덱스트란법, 양이온 리포좀법, 및 초산 리튬-DMSO법 등이 있으나, 이에 제한되지 않는다. In order to introduce an expression vector having a genetic sequence encoding a target protein into the host cell, any method for introducing nucleic acid into the cell can be used, and techniques known in the art can be used depending on the host cell. For example, heat shock, electroporation, calcium phosphate (CaPO 4 ) precipitation, calcium chloride (CaCl 2 ) precipitation, microinjection, polyethylene glycol (PEG) method, DEAE-dextran. method, cationic liposome method, and lithium acetate-DMSO method, etc., but are not limited thereto.
본 발명의 일 구체예에서, 플라스크 또는 바이오리액터 (bioreactor)에서 목적 단백질을 발현하는 세포주를 배양할 수 있다. In one embodiment of the present invention, a cell line expressing the target protein can be cultured in a flask or bioreactor.
바이오리액터를 이용한 배양은 플라스크와 달리 DO, 글루코스 함량, pH와 같은 배양조건을 조절 및 유지할 수 있어서 세포 배양을 유리한 조건에서 수행할 수 있고 대량 배양이 가능하다. 상기 플라스크 및 바이오리액터의 종류 및 배양 조건은 당업자가 통상적으로 조절 가능한 범위 내에서 변경할 수 있다. Unlike flasks, culture using a bioreactor can control and maintain culture conditions such as DO, glucose content, and pH, so cell culture can be performed under favorable conditions and mass culture is possible. The types and culture conditions of the flask and bioreactor can be changed within a range that can be normally controlled by a person skilled in the art.
본 발명의 일 구체예에서, 플라스크 또는 바이오리액터 (bioreactor)에서 목적 단백질을 발현하는 세포주를 배양할 수 있다. 바이오리액터를 이용한 배양은 플라스크와 달리 DO, 글루코스 함량, pH와 같은 배양조건을 조절 및 유지할 수 있어서 세포 배양을 유리한 조건에서 수행할 수 있고 대량 배양이 가능하다. In one embodiment of the present invention, a cell line expressing the target protein can be cultured in a flask or bioreactor. Unlike flasks, culture using a bioreactor can control and maintain culture conditions such as DO, glucose content, and pH, so cell culture can be performed under favorable conditions and mass culture is possible.
상기 플라스크 및 바이오리액터의 종류 및 배양 조건은 당업자가 통상적으로 조절 가능한 범위 내에서 변경할 수 있다. The types and culture conditions of the flask and bioreactor can be changed within a range that can be normally controlled by a person skilled in the art.
예를 들어, 목적 단백질을 발현하는 세포주를 엘렌메이어 플라스크 (Elenmeyer Flask)에 접종하여 부유배양한 뒤 계대 배양하여 바이오리액터에 접종할 최소 세포수를 확보하고, 계대배양한 세포주를 일회용 세포배양백이 장착된 바이오리액터에 접종하여 유가식배양을 실시하여 목적 단백질을 생산할 수 있다. For example, a cell line expressing the target protein is inoculated into an Elenmeyer Flask, cultured in suspension, subcultured to secure the minimum number of cells to be inoculated into the bioreactor, and the subcultured cell line is placed in a disposable cell culture bag. The target protein can be produced by inoculating a bioreactor and performing fed-batch culture.
본 발명의 또 다른 구체예에서, 배양 기간은 6일 이상일 수 있다. 바람직하게는 배양 기간이 6일, 7일, 8일, 9일, 10일, 11일, 12일, 13일, 14일, 15일, 16일, 17일, 18일, 19일 또는 20일일 수 있다. 보다 바람직하게는 배양 기간이 10일일 수 있다. In another embodiment of the invention, the culture period may be 6 days or more. Preferably the incubation period is 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 days. You can. More preferably, the culture period may be 10 days.
상기 (a) 세포 배양액을 원심분리하여 상층액을 회수하는 단계는, 일반적인 단백질 분리 방법을 이용하여 실시될 수 있다. The step (a) of centrifuging the cell culture medium and recovering the supernatant may be performed using a general protein separation method.
본 발명의 일 구체예에서, 상기 (a) 세포 배양액을 원심분리하여 상층액을 회수하는 단계는, 본 발명이 속한 기술분야에서 일반적으로 사용되는 원심분리기를 이용할 수 있다. 예를 들어, 고정각 앵글로터를 사용하는 원심분리기, 스윙 로터를 사용하는 원심 분리기, 연속 원심분리기 등을 사용할 수 있다. 바람직하게는, 상기 (a) 세포 배양액을 원심분리하여 상층액을 회수하는 단계는, 연속 원심분리기를 이용하여 수행될 수 있다. 상기 연속 원심분리기는 GEA사의 westfalia continuous centrifuge일 수 있다. In one embodiment of the present invention, the step (a) of centrifuging the cell culture medium to recover the supernatant may use a centrifuge commonly used in the technical field to which the present invention pertains. For example, a centrifuge using a fixed angle angle rotor, a centrifuge using a swing rotor, a continuous centrifuge, etc. can be used. Preferably, the step (a) of centrifuging the cell culture medium and recovering the supernatant may be performed using a continuous centrifuge. The continuous centrifuge may be GEA's westfalia continuous centrifuge.
본 발명의 다른 구체예에서, 상기 (a) 세포 배양액을 원심분리하여 상층액을 회수하는 단계에서, 원심분리시 g-force는 8000x g 초과 20000x g 이하일 수 있다. 또한, 상기 원심분리시 g-force가 8000x g 초과 19000x g 이하일 수 있으며, 바람직하게는 15000x g 이상 20000x g이하, 16000x g 이상 20000x g이하, 17000x g 이상 20000x g이하, 18000x g 이상 20000x g이하, 19000x g 이상 2000x g 이하, 15000x g 이상 19000x g이하, 16000x g 이상 19000x g이하, 17000x g 이상 19000x g이하, 또는 18000x g 이상 19000x g 이하일 수 있으나, 이러한 수치로 제한되지 않는다. In another embodiment of the present invention, in the step (a) of recovering the supernatant by centrifuging the cell culture, the g-force during centrifugation may be greater than 8000x g and less than or equal to 20000x g. In addition, during the centrifugation, the g-force may be more than 8000x g and less than 19000x g, preferably more than 15000x g and less than 20000x g, more than 16000x g and less than 20000x g, more than 17000x g and less than 20000x g, more than 18000x g and less than 20000x g, It may be 19000x g or more and 2000x g or less, 15000x g or more and 19000x g or less, 16000x g or more and 19000x g or less, 17000x g or more and 19000x g or less, or 18000x g or more and 19000x g or less, but is not limited to these values.
본 발명의 또다른 구체예에서, 상기 (a) 세포 배양액을 원심분리하여 상층액을 회수하는 단계에서, 원심분리 용기속도가 8000 rpm 초과 13000 rpm 이하일 수 있다. 또한, 상기 원심분리 용기속도가 8000 rpm 초과 12000 rpm 이하일 수 있으며, 바람직하게는 10000 rpm 이상 13000 rpm 이하, 11000 rpm 이상 13000 rpm 이하, 12000 rpm 이상 13000 rpm 이하, 10000 rpm 이상 12000 rmp 이하, 또는 11000 rpm 이상 12000 rpm 이하일 수 있나, 이러한 수치로 제한되지 않는다. In another embodiment of the present invention, in the step (a) of centrifuging the cell culture medium and recovering the supernatant, the centrifugation vessel speed may be greater than 8000 rpm and less than 13000 rpm. In addition, the centrifugal separation vessel speed may be more than 8000 rpm and less than 12000 rpm, preferably more than 10000 rpm and less than 13000 rpm, more than 11000 rpm and less than 13000 rpm, more than 12000 rpm and less than 13000 rpm, more than 10000 rpm and less than 12000 rpm, or 11000 rpm. It can be above 12000 rpm and below 12000 rpm, but is not limited to these values.
본 발명의 다른 구체예에서, 상기 (a) 세포 배양액을 원심분리하여 상층액을 회수하는 단계에서, 원심분리기로 배양액이 공급되는 공급속도인 공급유속 (feed flow)이 200 L/h 내지 400 L/h, 200 L/h 내지 300 L/h, 210 L/h 내지 300 L/h, 220 L/h 내지 300 L/h, 230 L/h 내지 300 L/h, 또는 240 L/h 내지 300 L/h일 수 있다. 바람직하게는, 상기 공급유속이 250 L/h일 수 있으나, 이에 제한되지는 않는다. In another embodiment of the present invention, in the step (a) of centrifuging the cell culture medium and recovering the supernatant, the feed flow, which is the feed rate at which the culture medium is supplied to the centrifuge, is 200 L/h to 400 L /h, 200 L/h to 300 L/h, 210 L/h to 300 L/h, 220 L/h to 300 L/h, 230 L/h to 300 L/h, or 240 L/h to 300 It can be L/h. Preferably, the supply flow rate may be 250 L/h, but is not limited thereto.
본 발명의 또 다른 구체예에서, 상기 (a) 세포 배양액을 원심분리하여 상층액을 회수하는 단계에서 원심분리시 배출간격 (ejection interval)이 100 내지 250 초, 120 내지 240 초, 120 내지 230초, 140 내지 230 초, 160 내지 220초, 180 내지 210 초, 또는 190 내지 210초일 수 있다. 또한, 바람직하게는 상기 원심분리시 배출간격은 190 내지 210 초이거나 201초일수 있으나, 이러한 수치로 제한되는 것은 아니다. 상기 회수된 배양액을 대상으로 무균 시험, 마이코플라스마 검출 시험, 세포배양 접종법을 통한 외래성 인자 확인 시험, 미세 마우스 바이러스 (Mouse Minute virus) 검출 시험 및 결핵균 검출시험을 시행할 수 있다. 상기 회수된 배양액에는 균이 없으며, 마이코플라스마, 외래성 인자, 미세 마우스 바이러스 및 결핵균이 검출되지 않는다. 본 발명의 일 구체예에서, 상기 원심분리로 회수된 배양액 내 불순물을 제거하기 위하여 필터를 사용하여 여과할 수도 있다. 이때, 여과에 사용하는 필터의 공극 직경은 1 ㎛ 이하, 0.5 ㎛ 이하, 0.45 ㎛ 이하, 0.3 ㎛ 이하, 0.25 ㎛ 이하, 0.22 ㎛ 이하 또는 0.2 ㎛이하일 수 있으며, 다양한 공극 직경을 갖는 필터를 조합하여 사용할 수도 있다. 또한, 상기 여과시 전도도는 10 내지 20 mS/cm, 10 내지 19 mS/cm, 10 내지 18 mS/cm, 10 내지 17 mS/cm, 또는 10 내지 16 mS/cm일 수 있으나, 이러한 조건으로 제한되지 않는다. In another embodiment of the present invention, in the step (a) of centrifuging the cell culture medium and recovering the supernatant, the ejection interval during centrifugation is 100 to 250 seconds, 120 to 240 seconds, and 120 to 230 seconds. , 140 to 230 seconds, 160 to 220 seconds, 180 to 210 seconds, or 190 to 210 seconds. Also, preferably, the discharge interval during centrifugation may be 190 to 210 seconds or 201 seconds, but is not limited to these values. A sterility test, mycoplasma detection test, adventitious agent identification test through cell culture inoculation method, Mouse Minute virus detection test, and Mycobacterium tuberculosis detection test can be performed on the recovered culture medium. There are no bacteria in the recovered culture, and no mycoplasma, adventitious agents, micromouse virus, or tuberculosis bacillus are detected. In one embodiment of the present invention, the culture medium recovered by centrifugation may be filtered using a filter to remove impurities. At this time, the pore diameter of the filter used for filtration may be 1 ㎛ or less, 0.5 ㎛ or less, 0.45 ㎛ or less, 0.3 ㎛ or less, 0.25 ㎛ or less, 0.22 ㎛ or less, or 0.2 ㎛ or less, and filters with various pore diameters may be combined. You can also use it. Additionally, the conductivity during filtration may be 10 to 20 mS/cm, 10 to 19 mS/cm, 10 to 18 mS/cm, 10 to 17 mS/cm, or 10 to 16 mS/cm, but is limited to these conditions. It doesn't work.
본 발명의 다른 구체예에서, 상기 (b) 회수된 배양액을 여과하는 단계는 정밀여과필터를 이용하여 수행될 수 있다. 상기 정밀여과필터의 기능은 예컨대, ＜20 리터(l)/㎡의 피드 로드인 압력 한계, 또는 탁도 감소에 기초하여 평가될 수 있다. 또한, 상기 정밀여과필터의 비제한적인 예로는 정밀여과 멤브레인, 밀리포어(Millipore), COHC, A1HC, BIHC, XOHC 심층 필터, CUNO 60ZA, 및 CUNO 90ZA가 있다. 바람직하게는, 상기 정밀여과필터가 심층필터일 수 있고, 보다 바람직하게는 A1HC 심층 필터일 수 있으나 이러한 필터로 제한되지는 않는다. In another embodiment of the present invention, the step (b) of filtering the recovered culture fluid may be performed using a microfiltration filter. The function of the microfiltration filter can be evaluated based on, for example, pressure limit, feed load of <20 liters (l)/m2, or turbidity reduction. Additionally, non-limiting examples of the microfiltration filter include microfiltration membrane, Millipore, COHC, A1HC, BIHC, XOHC depth filter, CUNO 60ZA, and CUNO 90ZA. Preferably, the microfiltration filter may be a depth filter, and more preferably, it may be an A1HC depth filter, but is not limited to this filter.
본 발명의 또 다른 구체예에서, 상기 원심분리로 회수된 배양액에 필터를 적용하여 여과한 뒤 계면활성제를 추가로 처리하여 반응시킬 수 있다. 상기 계면활성제는 도데실황산 나트륨 (SDS), 디옥시콜산 나트륨, Triton X-100 (상표명, Rohm and Hass사 제조), Nodiet P-40 (상표명, Shell사 제조), Tween-80, Tween-20, CHAPS, Chapso, 디기토닌 (digitonin), 유레아 (urea) 및 이들의 혼합물 등에서 선택될 수 있으나, 이러한 성분으로 제한되는 것은 아니다. 바람직하게는, 상기 계면활성제는 Triton X-100일 수 있다. 또한, 상기 계면활성제를 처리하여 반응시키는 시간은 30분 이상일 수 있으나, 이러한 조건으로 제한되는 것은 아니다. In another embodiment of the present invention, the culture solution recovered by centrifugation may be filtered using a filter and then further treated with a surfactant for reaction. The surfactants include sodium dodecyl sulfate (SDS), sodium deoxycholate, Triton , CHAPS, Chapso, digitonin, urea, and mixtures thereof, but are not limited to these ingredients. Preferably, the surfactant may be Triton X-100. Additionally, the time for treating and reacting the surfactant may be 30 minutes or more, but is not limited to these conditions.
본 발명의 일 구체예에서, 상기 계면활성제를 처리한 필터 여과액을 재여과할 수 있다. 상기 재여과에 사용하는 필터의 공극 직경은 1 ㎛ 이하, 0.5 ㎛ 이하, 0.45 ㎛ 이하, 0.3 ㎛ 이하, 0.25 ㎛ 이하, 0.22 ㎛ 이하 또는 0.2 ㎛이하일 수 있으며, 다양한 공극 직경을 갖는 필터를 조합하여 사용할 수도 있다. 실시예 In one embodiment of the present invention, the filter filtrate treated with the surfactant may be refiltered. The pore diameter of the filter used for re-filtration may be 1 ㎛ or less, 0.5 ㎛ or less, 0.45 ㎛ or less, 0.3 ㎛ or less, 0.25 ㎛ or less, 0.22 ㎛ or less, or 0.2 ㎛ or less, and filters with various pore diameters may be combined. You can also use it. Example
이하, 본 발명을 하기 실시예에 의하여 더욱 상세하게 설명한다. 단, 하기 실시예는 본 발명을 예시하기 위한 것일 뿐, 본 발명의 범위가 이들만으로 한정되는 것은 아니다.Hereinafter, the present invention will be explained in more detail by the following examples. However, the following examples are only for illustrating the present invention, and the scope of the present invention is not limited to these only.
제조예 1. 목적 단백질을 발현하는 세포주의 제작 Preparation Example 1. Production of cell lines expressing target protein
서열번호 1의 아미노산 서열로 표시되는 폴리펩타이드를 발현하는 세포주를 제작하기 위하여 영국 HORIZON Discovery 사에서 분양 받은 HD-BIOP3 세포주를 숙주세포로 사용하였다. Donor plasmid (pJV145)에 SalI/NotI 제한 효소 반응을 이용해 Genscript사에서 합성한 cDNA를 삽입하여 재조합 발현 벡터 plasmid (M-2560)를 제작하였다 (도 1). 상기 M-2560 벡터는 서열번호 3으로 표시되는 DNA 서열을 갖는다. To create a cell line expressing the polypeptide represented by the amino acid sequence of SEQ ID NO: 1, the HD-BIOP3 cell line purchased from HORIZON Discovery, UK was used as a host cell. A recombinant expression vector plasmid (M-2560) was created by inserting cDNA synthesized by Genscript into the donor plasmid (pJV145) using SalI/NotI restriction enzyme reaction (Figure 1). The M-2560 vector has a DNA sequence represented by SEQ ID NO: 3.
상기 HD-BIOP3 세포주에 재조합 발현 벡터 plasmid (M-2560)를 형질주입하였다. 형질주입된 세포 중 안정적인 single cell cloning이 가능한 세포를 선별하여 충분한 장기 계대 안정성을 갖는 연구용 세포은행(Research cell bank; RCB)을 제조하였다. 상기 RCB를 SK바이오사이언스 안동공장으로 이관하여 GMP 기준에 적합하게 제조용 세포은행(Working Cell Bank; WCB)를 제조하였다. The recombinant expression vector plasmid (M-2560) was transfected into the HD-BIOP3 cell line. Among the transfected cells, cells capable of stable single cell cloning were selected to prepare a research cell bank (RCB) with sufficient long-term passage stability. The RCB was transferred to SK Bioscience's Andong factory, and a working cell bank (WCB) was manufactured in compliance with GMP standards.
WCB(Working Cell Bank) 1 바이알을 37 ℃ 항온수조 (water bath)에서 녹이고 CD OptiCHO 배지로 희석한 후 원심분리를 하여 펠렛 (pellet)을 CD OptiCHO 배지로 재부유시켰다. 10 L 바이오리액터에서 5 x 105 cells/mL 농도로 6 L 배양, 50 L 바이오리액터에서 5 x 105 cells/mL 농도로 30 L 배양, 200 L 바이오리액터에서 5 x 105 cells/mL 농도로 200 L 배양, 2000 L 바이오리액터에서 8 x 105 cells/mL 농도로 1600 L 배양할 수 있도록 확장 계대 배양하였다.1 vial of Working Cell Bank (WCB) was dissolved in a water bath at 37°C, diluted with CD OptiCHO medium, centrifuged, and the pellet was resuspended in CD OptiCHO medium. 6 L culture in a 10 L bioreactor at a concentration of 5 200 L culture, subculture was expanded to allow 1600 L culture at a concentration of 8 x 10 5 cells/mL in a 2000 L bioreactor.
제조예 2. 목적 단백질을 발현하는 세포주의 2000 L 바이오리액터에서의 배양 Preparation Example 2. Cultivation of cell line expressing target protein in 2000 L bioreactor
일회용 세포 배양백을 2000 L 바이오리액터에 장착하고 가동 준비를 한 뒤, 1400 L의 Dynamis 배지를 주입하고 8.0 x 105 cells/mL의 농도로 WCB를 접종하여 배양하였다. 배양 시, DO 조절은 기체 및 산소를 통해 진행하며, pH 조절은 8 % 탄산수소나트륨 및 이산화탄소 가스를 사용하여 진행하였다. A disposable cell culture bag was placed in a 2000 L bioreactor and prepared for operation, then 1400 L of Dynamis medium was injected and WCB was inoculated and cultured at a concentration of 8.0 x 10 5 cells/mL. During cultivation, DO control was carried out using gas and oxygen, and pH control was carried out using 8% sodium bicarbonate and carbon dioxide gas.
접종 직후부터 매일 샘플링을 하여 세포수를 측정하고 미생물 오염 여부 및 배양액 내 glucose 농도 등을 확인하였으며, 바이오리액터 내 거품이 condenser에 장착된 air filter의 하단까지 올라오면 ADCF 소포제를 처리하였다. 이와 같은 과정을 배양 종료까지 반복적으로 진행하였다. 배양시 사용되는 배양 조건은 하기 표 1과 같다. Immediately after inoculation, sampling was performed every day to measure the number of cells and check for microbial contamination and glucose concentration in the culture medium. When the foam in the bioreactor reached the bottom of the air filter mounted on the condenser, ADCF defoamer was applied. This process was repeated repeatedly until the end of culture. The culture conditions used during culture are shown in Table 1 below.
실험예 1. 원심분리 공급유속 (feed flow) 차이에 따른 목적 단백질의 회수량 및 불순물의 변화 Experimental Example 1. Changes in recovery amount and impurities of target protein according to differences in centrifugation feed flow
다량의 목적 단백질을 신속하게 생산하기 위하여 대규모 바이오리액터를 사용하거나 또는 배양액 부피를 증가시킬 수 있으나, 소규모 바이오리액터 또는 적은 부피로 배양하는 경우보다 배양액을 회수하는 과정에서 배양액의 원심분리기로의 투입시간 및 원심분리기 내 대기 시간이 증가하기 때문에 생산기간이 증가하는 단점이 존재하였다. In order to quickly produce a large amount of the target protein, a large-scale bioreactor can be used or the volume of the culture medium can be increased. However, it takes longer to input the culture medium to the centrifuge during the recovery process than when culturing in a small-scale bioreactor or a small volume. There was a disadvantage in that the production period increased because the waiting time in the centrifuge increased.
이에, 단백질의 대규모 생산에 사용되는 바이오리액터 (2000L)에서 1400L의 배지를 채워 용존산소량 및 pH 등의 배양 조건을 칼리브레이션한 뒤 1600L의 배지로 목적 단백질을 발현하는 세포의 배양을 개시하고 목적 단백질의 생산을 위한 배양 첨가물들을 배양 과정에서 첨가함으로써 배양 10일차 배양부피가 2000 L의 배양부피가 되도록 배양하였다. 산업용 연속 원심분리기 (2000L 이상 분리가능, westfalia continuous centrifuge, GEA)를 사용하여 원심분리하며, 이때 100% output(full performance) 조건으로 설정하여 원심분리를 수행하되, 배양액이 원심분리기로 공급되는 공급 유속을 증가시킴으로써 원심분리에 소요되는 시간을 단축하고자 하였다. 이 때, 원심분리에 소요되는 시간 단축이 원심분리 후 회수되는 목적 단백질의 수율 및 불순물 함량에 미치는 영향을 확인하기 위하여 상층액 내 목적 단백질의 농도, 수율, 상층액 내 불순물 및 상층액의 탁도를 측정하였다. 상기 100% output(full performance) 조건은 11,800 rpm의 용기 속도 또는 18,300 g-force에 대응되는 조건이다.Accordingly, in a bioreactor (2000L) used for large-scale production of proteins, 1400L of medium was filled, culture conditions such as dissolved oxygen and pH were calibrated, and then culture of cells expressing the target protein was started with 1600L of medium. Culture additives for production were added during the culture process so that the culture volume on day 10 was 2000 L. Centrifugation is performed using an industrial continuous centrifuge (capable of separating 2000L or more, westfalia continuous centrifuge, GEA). At this time, centrifugation is performed by setting the condition to 100% output (full performance), and the supply flow rate at which the culture medium is supplied to the centrifuge. An attempt was made to shorten the time required for centrifugation by increasing . At this time, in order to determine the effect of shortening the time required for centrifugation on the yield and impurity content of the target protein recovered after centrifugation, the concentration of the target protein in the supernatant, yield, impurities in the supernatant, and turbidity of the supernatant were measured. Measured. The 100% output (full performance) condition corresponds to a container speed of 11,800 rpm or 18,300 g-force.
상층액 내 전체 단백질 농도는 써모피셔 사이언티픽사 (ThermoFisher Scientific)에서 제공하는 피어스 (상표명) BCA 단백질 분석 키트 (카탈로그 번호 23225)를 이용한 BCA 분석법을 통해 측정되었다. 또한, 상층액 내 목적 단백질의 농도는 HIC-HPLC를 이용하여 측정하였다.Total protein concentration in the supernatant was measured using the BCA assay using the Pierce™ BCA protein assay kit (catalog number 23225) provided by ThermoFisher Scientific. Additionally, the concentration of the target protein in the supernatant was measured using HIC-HPLC.
상층액 내 불순물 함량은 상층액 내 숙주세포 단백질 및 숙주세포 유래 DNA를 측정하여 확인하였다. 이때, 상층액 내 숙주세포 단백질 농도는 시그너스 테크놀로지사 (Cygnus Technologies)의 중국 햄스터 난소 세포 (CHO) 숙주세포 단백질 (Host Cell Protein, HCP) ELISA 키트 (카탈로그 번호: F550-1)를 이용한 ELISA 분석을 통해 측정하였다. 나아가, 상층액 내 숙주세포 유래 DNA (Host Cell Derived DNA, HCD) 농도는 써모피셔 사이언티픽사의 어플라이드 바이오시스템 (상표명 Applied Biosystems) resDNASEQ 정량 CHO DNA 키트 (카탈로그 번호: 4402085)를 이용한 RT-PCR을 통해 분석하였다. 또한, 상층액의 탁도는 탁도계 (Naphelometer)를 이용하여 측정하였다. The content of impurities in the supernatant was confirmed by measuring host cell proteins and host cell-derived DNA in the supernatant. At this time, the host cell protein concentration in the supernatant was determined by ELISA analysis using the Chinese hamster ovary cell (CHO) Host Cell Protein (HCP) ELISA kit (catalog number: F550-1) from Cygnus Technologies. It was measured through. Furthermore, the concentration of host cell derived DNA (HCD) in the supernatant was determined by RT-PCR using Thermo Fisher Scientific's Applied Biosystems (trade name: Applied Biosystems) resDNASEQ quantitative CHO DNA kit (catalog number: 4402085). It was analyzed through. Additionally, the turbidity of the supernatant was measured using a turbidity meter (Naphelometer).
배양액이 원심분리기로 공급되는 공급 유속 변화에 따른 상층액 내 전체 단백질 농도, 목적 단백질 농도, 목적 단백질의 수율 및 상층액 내 불순물과 상층액의 탁도 측정 결과를 표 2에 나타내었다. Table 2 shows the total protein concentration in the supernatant, target protein concentration, yield of target protein, impurities in the supernatant, and turbidity measurement results in the supernatant according to changes in the feed flow rate at which the culture medium is supplied to the centrifuge.
(L/h)supply flow rate
(L/h)
(μg/ml) Total protein concentration in supernatant
(μg/ml)
(HCD) (ng/ml)host cell derived DNA
(HCD) (ng/ml)
(NTU)Turbidity
(NTU)
원심분리시 공급유속이 200L/h 인 경우 2000L의 배양액의 원심분리시간이 10시간인데 반해, 공급유속이 300L/h로 증가될 경우 2000L 배양액을 원심분리하는데 약 6.7 시간이 소요되었다. 또한, 공급유속이 400L/h인 경우 2000L 배양액을 원심분리하는데 소요되는 시간이 약 5시간으로 단축되었다. When the feed flow rate during centrifugation was 200 L/h, the centrifugation time for 2000 L of culture medium was 10 hours, whereas when the feed flow rate was increased to 300 L/h, it took about 6.7 hours to centrifuge 2000 L culture medium. In addition, when the feed flow rate was 400 L/h, the time required to centrifuge 2000 L culture medium was shortened to about 5 hours.
한편, 원심분리시 공급유속이 200L/h에서 300L/h 또는 400L/h로 증가하더라도 회수되는 상층액 내 목적 단백질의 함량은 크게 달라지지 않는 것으로 나타났다. 또한, 원심분리시 공급유속이 200L/h에서 300L/h로 증가하더라도 상층액 내 불순물인 숙주세포 단백질 및 숙주 세포 유래 DNA가 크게 증가하거나 감소하지 않는 것으로 나타났다. 비록, 원심분리시 공급유속이 200 L/h에서 300L/h로 증가되면, 상층액 내 탁도가 증가하였으나, 이러한 탁도 증가는 원심 분리로 얻은 상층액에 심층필터 (Depth filter)를 적용함으로써 개선되는 것으로 확인되었다. Meanwhile, even if the feed flow rate during centrifugation increased from 200 L/h to 300 L/h or 400 L/h, the content of the target protein in the recovered supernatant did not appear to change significantly. In addition, even when the feed flow rate increased from 200 L/h to 300 L/h during centrifugation, host cell proteins and host cell-derived DNA, which are impurities in the supernatant, did not appear to significantly increase or decrease. Although, when the feed flow rate during centrifugation increased from 200 L/h to 300 L/h, the turbidity in the supernatant increased, but this increase in turbidity was improved by applying a depth filter to the supernatant obtained by centrifugation. It was confirmed that
나아가, 원심분리시 공급유속이 200L/h에서 400L/h로 증가하면 숙주세포 단백질 및 숙주세포 유래 DNA가 증가하는 경향을 보였으나, 원심 분리 이후 심층필터를 사용함으로써 숙주세포 단백질 및 숙주세포 유래 DNA가 상당수 제거되었고, 탁도가 현저하게 낮아지는 것으로 확인되었다. Furthermore, when the feed flow rate during centrifugation increased from 200 L/h to 400 L/h, host cell proteins and host cell-derived DNA tended to increase, but by using a depth filter after centrifugation, host cell proteins and host cell-derived DNA increased. It was confirmed that a significant number of was removed and turbidity was significantly lowered.
한편, 원심분리시 공급유속이 200L/h보다 낮으면 원심분리시간이 10시간 이상으로 증가하여 생산기간이 지연되는 문제가 발생할 수 밖에 없다. 또한, 원심분리시 공급유속이 400L/h보다 높은 경우 공급유속이 200L/h인 경우보다 원심분리 시간이 절반 미만으로 단축될 수 있으나, 상층액 내 불순물 및 탁도가 증가함으로써 불순물 제거를 위하여 사용하여야 하는 필터의 수가 급격히 늘어나는 문제가 발생하였다. On the other hand, if the supply flow rate during centrifugation is lower than 200 L/h, the centrifugation time increases to 10 hours or more, which inevitably causes the problem of delayed production period. In addition, if the supply flow rate during centrifugation is higher than 400 L/h, the centrifugation time can be reduced to less than half compared to when the supply flow rate is 200 L/h, but as impurities and turbidity in the supernatant increase, it must be used to remove impurities. A problem arose as the number of filters used increased rapidly.
따라서, 목적 단백질을 발현하는 세포주의 배양액을 원심분리할 때 공급유속이 200L/h 내지 400L/h이면, 상층액 내 목적 단백질 농도에 영향을 주지 않으면서도 생산기간 단축 및 생산비용 절감효과를 달성하는 것으로 확인되었다. Therefore, if the supply flow rate is 200 L/h to 400 L/h when centrifuging the culture medium of a cell line expressing the target protein, the effect of shortening the production period and reducing production costs is achieved without affecting the concentration of the target protein in the supernatant. It was confirmed that
실험예 2. 원심분리 공급유속 (feed flow) 차이에 따른 탁도 변화 Experimental Example 2. Turbidity change according to difference in centrifugation feed flow
2000L 바이오 리액터에서 1600 L 배지로 목적 단백질을 발현하는 세포의 배양을 개시하고, 목적 단백질의 생산을 위한 배양 첨가물들을 배양 과정에서 첨가함으로써 배양 10일차 배양부피가 2000 L가 되도록 배양한뒤, 산업용 연속 원심분리기(westfalia continuous centrifuge, GEA)를 사용하여 상층액을 회수하였다. 상층액 회수시 100% output(full performance) 조건으로 설정하여 원심분리를 하였으며, 상기 100% output(full performance) 조건은 11,800 rpm의 용기 속도 또는 18,300x g에 대응되는 조건이다. 공급 유속이 200 L/h, 250 L/h 또는 300 L/h이고 배출간격이 각각 252초, 201초 또는 168초로 원심분리하여 얻은 상층액의 탁도를 탁도계를 이용하여 측정하였고, 측정 결과를 표 3에 기재하였다. Start culturing cells expressing the target protein with 1600 L medium in a 2000 L bioreactor, and add culture additives for production of the target protein during the culture process so that the culture volume is 2000 L on the 10th day of culture, and then industrially continuous. The supernatant was recovered using a centrifuge (westfalia continuous centrifuge, GEA). When recovering the supernatant, centrifugation was performed by setting 100% output (full performance) conditions, and the 100% output (full performance) condition corresponds to a vessel speed of 11,800 rpm or 18,300x g. The turbidity of the supernatant obtained by centrifugation with a supply flow rate of 200 L/h, 250 L/h, or 300 L/h and a discharge interval of 252 seconds, 201 seconds, or 168 seconds, respectively, was measured using a turbidity meter, and the measurement results are shown in Table. It is described in 3.
원심분리시 공급유속이 200 L/h에서 250L/h로 증가되더라도, 상층액 내 탁도는 거의 변하지 않았으며, 공급유속이 200 L/h에서 300L/h로 증가하더라도 탁도의 변화폭은 약 30 수준이어서 실험예 1에서 공급유속이 200 L/h에서 300L/h로 증가되었을 때 나타난 변화폭(약 20)과 크게 차이 나지 않는 것으로 확인되었다.Even if the feed flow rate increased from 200 L/h to 250 L/h during centrifugation, the turbidity in the supernatant hardly changed, and even if the feed flow rate increased from 200 L/h to 300 L/h, the change in turbidity was about 30 L/h. It was confirmed that there was not much difference from the change range (about 20) that occurred when the supply flow rate was increased from 200 L/h to 300 L/h in Experimental Example 1.
비록, 원심분리시 공급유속이 400 L/h인 경우의 탁도를 측정하지는 않았으나, 상기 200 L/h 및 300 L/h에서의 탁도를 고려할 때, 상기 실험예 1에서 측정된 것과 유사한 양상을 띄어, 300 L/h에서의 탁도보다 더 높은 탁도를 보일 것으로 예상되었다. Although the turbidity was not measured when the feed flow rate during centrifugation was 400 L/h, considering the turbidity at 200 L/h and 300 L/h, it showed a similar pattern to that measured in Experimental Example 1. , it was expected to show higher turbidity than that at 300 L/h.
단백질을 발현하는 세포의 상업적 배양시 배양 부피가 증가됨에 따라 공급유속도 증가시키게 된다. 공급유속을 증가시킴에 따라 필터의 수량을 더 추가할 경우, 생산기간을 단축하면서도 불순물이 적어 탁도가 낮은 상층액을 얻을 수 있는 것으로 확인되었다. During commercial cultivation of cells expressing proteins, the feed flow rate also increases as the culture volume increases. It was confirmed that by increasing the supply flow rate and adding more filters, it was possible to obtain a supernatant with low turbidity due to the small amount of impurities while shortening the production period.
실험예 3. 원심분리 상층액의 여과시 사용되는 필터의 사용에 따른 목적 단백질의 정제 및 불순물의 제거 Experimental Example 3. Purification of target protein and removal of impurities according to the use of filters used in filtration of centrifugal supernatant.
상기 실험예 1에서 수득한 원심분리 상층액에 필터를 적용하여 여과하였을 때 여과액 내 목적 단백질의 함량 변화 및 불순물 감소 효과 여부를 확인하였다. When the centrifuged supernatant obtained in Experimental Example 1 was filtered using a filter, the change in the content of the target protein in the filtrate and the effect of reducing impurities were confirmed.
상기 실험예 1에서와 같이 원심분리시 공급 유속이 증가될 경우, 원심분리에 소요되는 시간이 짧다는 장점이 있으나 상층액에 불순물의 함량이 증가된다는 단점이 있다. 그러한 불순물을 제거하기 위해서는 더 많은 필터를 적용해야 하는바, 추가의 필터를 적용함에 따라 상층액 내 불순물 양에 미치는 영향을 확인하고자 하였다. When the feed flow rate is increased during centrifugation as in Experimental Example 1, there is an advantage that the time required for centrifugation is short, but there is a disadvantage that the content of impurities in the supernatant increases. In order to remove such impurities, more filters must be applied, so we sought to determine the effect of applying additional filters on the amount of impurities in the supernatant.
상기 실험예 1에서 수득한 (i) 원심분리 상층액, (ii) 상기 상층액에 A1HC 심층필터를 적용한 여과액, (iii) 상기 여과액에 0.5/0.2 ㎛ 필터를 적용한 여과액 내 목적 단백질의 함량 및 불순물 양을 SDS-PAGE 분석을 통해 확인하였다. (i) the centrifuged supernatant obtained in Experimental Example 1, (ii) the filtrate obtained by applying an A1HC depth filter to the supernatant, (iii) the target protein in the filtrate obtained by applying a 0.5/0.2 ㎛ filter to the filtrate. The content and amount of impurities were confirmed through SDS-PAGE analysis.
원심분리 상층액에 필터를 적용하였을 때 여과액 내 목적 단백질 함량은 필터를 적용하지 않은 원심분리 상층액에서의 목적 단백질 함량과 유사하여 목적 단백질 단량체 및 목적 단백질 이량체 밴드 크기가 유사함으로써 목적 단백질 함량이 유지되는 것으로 나타났다 (도 2 및 3 참조). When a filter is applied to the centrifugation supernatant, the target protein content in the filtrate is similar to the target protein content in the centrifugation supernatant without applying a filter, and the target protein monomer and target protein dimer band sizes are similar, thereby increasing the target protein content. was found to be maintained (see Figures 2 and 3).
한편, 원심분리 상층액에 필터를 적용한 경우 불순물이 감소하여, 목적 단백질 단량체 및 목적 단백질 이량체 밴드가 필터를 적용하지 않은 원심분리 상층액에서 관찰되는 목적 단백질 단량체 및 목적 단백질 이량체 밴드보다 뚜렷하였고, 그 외의 밴드 (즉, 목적 단백질이 아닌 다른 단백질인 불순물)의 선명도가 줄어듦으로써 상대적으로 흐릿하게 관찰되는 것으로 나타났다 (도 2 및 3 참조). On the other hand, when a filter was applied to the centrifugation supernatant, impurities were reduced, and the target protein monomer and target protein dimer bands were more distinct than the target protein monomer and target protein dimer bands observed in the centrifugation supernatant without a filter. , the clarity of other bands (i.e., impurities that are proteins other than the target protein) was reduced, and they were observed to be relatively blurry (see Figures 2 and 3).
Claims (10)
상기 목적 단백질은 SARS-CoV-2 스파이크 단백질의 수용체 결합 도메인(Receptor Binding Domain) 및 나노입자의 구조체인 I53-I50A를 포함하는 단백질로서, 서열번호 1로 표시되는 아미노산 서열로 표시되는 폴리펩타이드 또는 이와 95% 이상 서열 상동성을 갖는 폴리펩타이드이며,
상기 목적 단백질을 발현하는 세포주로서, 중국 햄스터 난소(Chinese Hamster Ovary, CHO) 세포에서 유래한 세포주를 배양하는 단계 이후에,
(a) 상기 세포 배양액을 원심분리하여 상층액을 회수하는 단계로서, 원심분리시 공급유속(feed flow)은 200 L/h 내지 250 L/h이고, 원심분리시 g-force가 15000x g 이상 20000x g 이하이며, 원심분리 용기속도가 8000 rpm 초과 13000 rpm 이하이고, 원심분리시 배출간격(ejection interval)이 201 내지 252 초인 단계; 및
(b) 상기 회수된 배양액을 정밀여과필터로서 심층필터(Depth filter)를 이용하여 여과하는 단계
를 포함하는, 정제 방법.A method for purifying a cell culture medium expressing a target protein, comprising:
The target protein is a protein containing the receptor binding domain of the SARS-CoV-2 spike protein and I53-I50A, a nanoparticle structure, and is a polypeptide represented by the amino acid sequence shown in SEQ ID NO: 1 or the same. It is a polypeptide with more than 95% sequence homology,
As a cell line expressing the target protein, after culturing a cell line derived from Chinese Hamster Ovary (CHO) cells,
(a) A step of centrifuging the cell culture medium to recover the supernatant, wherein the feed flow during centrifugation is 200 L/h to 250 L/h, and the g-force during centrifugation is 15,000x g or more and 20,000x g or less, the centrifugation vessel speed is greater than 8000 rpm and less than 13000 rpm, and the ejection interval during centrifugation is 201 to 252 seconds; and
(b) filtering the recovered culture medium using a depth filter as a microfiltration filter.
Including, purification method.
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR20210137835 | 2021-10-15 | ||
| KR1020210137835 | 2021-10-15 | ||
| KR1020220066095A KR20230054247A (en) | 2021-10-15 | 2022-05-30 | Method for purification of a protein |
| KR1020220066095 | 2022-05-30 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| KR20230055966A KR20230055966A (en) | 2023-04-26 |
| KR102621026B1 true KR102621026B1 (en) | 2024-01-09 |
Family
ID=86099547
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| KR1020220132531A KR102621026B1 (en) | 2021-10-15 | 2022-10-14 | Method for purification of a protein |
Country Status (1)
| Country | Link |
|---|---|
| KR (1) | KR102621026B1 (en) |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006007459A1 (en) * | 2004-06-21 | 2006-01-19 | Biogen Idec Ma Inc. | Use of depth filtration in series with continuous centrifugation to clarify mammalian cell cultures |
| WO2021163438A1 (en) | 2020-02-14 | 2021-08-19 | University Of Washington | Polypeptides, compositions, and their use to treat or limit development of an infection |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR102643810B1 (en) | 2020-03-20 | 2024-03-06 | 포항공과대학교 산학협력단 | A method of mass production of target gene in plants |
-
2022
- 2022-10-14 KR KR1020220132531A patent/KR102621026B1/en active IP Right Grant
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006007459A1 (en) * | 2004-06-21 | 2006-01-19 | Biogen Idec Ma Inc. | Use of depth filtration in series with continuous centrifugation to clarify mammalian cell cultures |
| WO2021163438A1 (en) | 2020-02-14 | 2021-08-19 | University Of Washington | Polypeptides, compositions, and their use to treat or limit development of an infection |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20230055966A (en) | 2023-04-26 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Schmittt et al. | K28, a unique double-stranded RNA killer virus of Saccharomyces cerevisiae | |
| JP6230158B2 (en) | A novel high-functional enzyme that converts the substrate specificity of human β-hexosaminidase B and imparts protease resistance | |
| CN112225814A (en) | Novel coronavirus RBD fusion protein subunit vaccine and preparation method and application thereof | |
| CN112390863B (en) | Modified new coronavirus Spike protein extracellular domain and application thereof | |
| CN113845576A (en) | Recombinant feline herpesvirus type 1 gB-gD protein and application thereof | |
| EP3394243A1 (en) | Improved protein expression strains | |
| CN102112601B (en) | New fusion rotein and the purposes for the preparation of the vaccine for hepatitis C thereof | |
| CN113896773B (en) | Recombinant FCV antigen and feline calicivirus genetic engineering subunit vaccine | |
| KR102621026B1 (en) | Method for purification of a protein | |
| EP4180521A1 (en) | Method for production of varicella zoster virus surface protein antigen | |
| CN112679616B (en) | Paralichthys rhabdovirus genetic engineering subunit vaccine | |
| KR20080026085A (en) | Recombinant e-selectin made in insect cells | |
| CN114075567B (en) | Optimized nucleotide sequence for expressing novel coronavirus antigen and application thereof | |
| CN107325188A (en) | The construction method of the Chinese hamster ovary celI strain of pig blood Albumin Fusion pig circular ring virus Cap2 albumen and its application | |
| RU2586511C1 (en) | RECOMBINANT Hansenula polymorpha YEAST STRAIN - PRODUCER OF HEPATITIS B VIRUS SURFACE ANTIGEN SEROTYPE "ayw" | |
| CN105646701A (en) | Recombinant human endostatin protein with different amino acid structures, method for preparing recombinant human endostatin protein and application thereof | |
| WO2013177153A1 (en) | Trichoderma hydrophobin production | |
| RU2546240C1 (en) | RECOMBINANT STRAIN OF YEAST Hansenula polymorpha - PRODUCER OF MAJOR CAPSID PROTEIN L1 OF HUMAN PAPILLOMAVIRUS OF TYPE 56 | |
| CN111032871A (en) | Improved protein expressing strains | |
| CN111732667B (en) | Peste des petits ruminants virus genetic engineering subunit vaccine | |
| Cui et al. | The codon-optimized capsid gene of duck circovirus can be highly expressed in yeast and self-assemble into virus-like particles | |
| CN108424459A (en) | The fusion protein and its preparation method and application of human serum albumins and people's saltant type hepatocyte growth factor | |
| CN105693845A (en) | Expression and purification, and applications of CD40 extracellular region | |
| KR20230035657A (en) | Method for producing rhabdovirus purified from cell culture | |
| CN101189263A (en) | Recombinant E-selectin made in insect cells |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AMND | Amendment | ||
| E601 | Decision to refuse application | ||
| X091 | Application refused [patent] | ||
| AMND | Amendment | ||
| X701 | Decision to grant (after re-examination) |