KR102244368B1 - Ethosomal composition with tocopheryl acetate and dexpanthenol and method for preparing the same - Google Patents
Ethosomal composition with tocopheryl acetate and dexpanthenol and method for preparing the same Download PDFInfo
- Publication number
- KR102244368B1 KR102244368B1 KR1020200038028A KR20200038028A KR102244368B1 KR 102244368 B1 KR102244368 B1 KR 102244368B1 KR 1020200038028 A KR1020200038028 A KR 1020200038028A KR 20200038028 A KR20200038028 A KR 20200038028A KR 102244368 B1 KR102244368 B1 KR 102244368B1
- Authority
- KR
- South Korea
- Prior art keywords
- hair
- composition
- group
- growth
- skin
- Prior art date
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/02—Cosmetics or similar toiletry preparations characterised by special physical form
- A61K8/14—Liposomes; Vesicles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/02—Cosmetics or similar toiletry preparations characterised by special physical form
- A61K8/11—Encapsulated compositions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/33—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing oxygen
- A61K8/34—Alcohols
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/40—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing nitrogen
- A61K8/42—Amides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/55—Phosphorus compounds
- A61K8/553—Phospholipids, e.g. lecithin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/67—Vitamins
- A61K8/673—Vitamin B group
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/67—Vitamins
- A61K8/676—Ascorbic acid, i.e. vitamin C
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/67—Vitamins
- A61K8/678—Tocopherol, i.e. vitamin E
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/10—Dispersions; Emulsions
- A61K9/127—Liposomes
- A61K9/1271—Non-conventional liposomes, e.g. PEGylated liposomes, liposomes coated with polymers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q7/00—Preparations for affecting hair growth
Abstract
Description
본 발명은 비타민과 덱스판테놀이 봉입된 에토좀을 포함하는 에토좀 조성물로서, 난용성 물질이 봉입된 에토좀 조성물을 이용하여 피부, 특히, 두피에 난용성 물질을 효과적으로 투과시켜, 발모와 양모에 효과를 가지며, 탈모를 방지할 수 있는 에토좀 조성물 및 이의 제조방법에 관한 것이다.The present invention is an etosomal composition comprising a vitamin and dexpanthen encapsulated etosomal, by using an etosomal composition encapsulated with a poorly soluble substance to effectively permeate the poorly soluble substance to the skin, particularly the scalp, and to hair growth and wool. It has an effect, it relates to an etosomal composition capable of preventing hair loss and a method for preparing the same.
인간의 머리카락은 개인 당 약 10~15만개 정도되며, 모발은 고유의 주기를 갖고 성장한다. 이 주기는 성장기(anagen), 퇴행기(catagen), 휴지기(telogen)로 나뉘며 이 주기에 따라, 모발의 성장과 탈락을 반복한다. 이 과정에서 하루 평균 100개가량의 머리카락이 탈락하는 것은 자연스러운 현상이다.Human hair is about 100,000 to 150,000 per individual, and hair grows with its own cycle. This cycle is divided into anagen, catagen, and telogen, and according to this cycle, hair growth and dropout are repeated. In this process, it is a natural phenomenon that an average of about 100 hairs per day are dropped out.
탈모는 모발이 빠져 성기거나 또는 소실한 상태를 말한다. 탈모의 기전은 아직 정확하게 밝혀지지 않았으나, 지금까지 연구된 바로는 호르몬 불균형 등 내분비계 이상, 자율신경계 및 혈액순환 장애 등의 순환계의 이상으로 생기는 과도한 피지 생성, 모근의 영양 결핍, 알레르기, 세균 감염, 유전적 요인, 노화 등을 주원인으로 추정되고 있다. Hair loss refers to a condition in which the hair has fallen out and is genital or lost. The mechanism of hair loss has not yet been accurately identified, but studies so far have shown that excessive sebum production caused by abnormalities in the circulatory system such as hormonal imbalance, autonomic nervous system and blood circulation disorders, nutrient deficiency of hair roots, allergies, bacterial infections, It is estimated that genetic factors and aging are the main causes.
또한, 최근에는 복잡한 생활환경에서 오는 정신적 스트레스, 대기 오염, 음식물 등 환경적 요인에 의한 원인설도 대두되고 있다. In addition, in recent years, the cause of environmental factors such as mental stress, air pollution, food, etc. from complex living environments has emerged.
이와 같이 외부 탈모 요인이 증가함에 따라, 과거에는 중 장년층에서 주로 나타났던 탈모는 최근 20~30대 젊은 층에서도 쉽게 찾아볼 수 있으며, 그 수 역시 증가하는 추세에 있다.As the external hair loss factors increase, hair loss, which was mainly seen in middle-aged people in the past, can be easily found in young people in their 20s and 30s in recent years, and the number is also increasing.
이에 따라, 탈모를 치료하기 위하여 많은 연구가 진행되어 왔으며, 여성 호르몬제, 혈류 촉진제 등 약물요법과 모발 이식법이 개발되었다. 현재 탈모 치료에 있어서 가장 많이 사용되는 약물로써는 FDA에서 승인받은 미녹시딜 제제(Minoxidil)와 피나스테라이드(Finasteride)가 있다.Accordingly, many studies have been conducted to treat hair loss, and drug therapy and hair transplantation methods such as female hormones and blood flow promoters have been developed. Currently, the most commonly used drugs for the treatment of hair loss are FDA-approved minoxidil and finasteride.
미녹시딜 제제는 Ca-채널의 오픈을 유도함으로써 혈관 확장 효과를 유도하고, 이를 통하여 혈류량을 증가시킴으로써 모근에 영양분을 지속적으로 공급함으로써 모발의 성장을 유도하는 약물이다. 특히, 정수리 부분의 탈모에 대해서 효과가 큰 것으로 알려져 있다. 그러나, 정수리 이외 부위의 탈모의 경우 좋은 효과를 갖지 못한 단점을 갖는다. Minoxidil is a drug that induces a vasodilating effect by inducing the opening of Ca-channels, and increases blood flow through this, thereby continuously supplying nutrients to the hair roots, thereby inducing hair growth. In particular, it is known to have a great effect on hair loss in the crown part. However, in the case of hair loss in areas other than the crown, it has a disadvantage that it does not have a good effect.
한편, 피나스테라이드는 제2형 5알파 환원효소(5α-reductase)의 기능을 억제시켜 테스토스테론(Testosterone)이 DHT(Dihydrotestosterone)으로 전환되는 것을 막아 탈모를 억제하는 효과를 갖는다. 하지만 피나스테라이드는 일부 환자에 성욕감퇴, 발기부전의 부작용을 보인다. 게다가 이러한 약물적 치료의 경우 단기간 빠른 치료는 가능하지만 치료용 약물의 사용을 중단하게 되면 즉시 탈모가 진행되는 치명적인 문제점을 가지고 있다. 그러나, 남성형 탈모 및 후기 탈모의 경우, 피나스테라이드만으로는 충분한 탈모 개선효과를 가지지 못하고, DHT inhibitor의 도움 없이는 지속적인 양모 효과가 나타나기 어려운 문제점을 가지고 있다. On the other hand, finasteride has an effect of inhibiting hair loss by inhibiting the function of
따라서, 여성형 탈모, 남성형 탈모 그리고 후기 탈모증을 극복할 수 있는 서로 다른 양모제가 필요하며, 탈모 형태에 따라 다르게 접근함으로써 효율성을 높이고, 부작용을 줄일 필요가 있다. Therefore, different woolen agents that can overcome female type alopecia, male pattern alopecia, and late alopecia are required, and there is a need to increase efficiency and reduce side effects by approaching differently depending on the type of hair loss.
유효성분의 경피전달(Transdermal delivery)를 위해서 다양한 제제화 기술이 개발되고 있으나 아직까지 유효성분을 효율적으로 전달하기에는 많은 한계점을 가지고 있다. Various formulation technologies have been developed for transdermal delivery of active ingredients, but there are still many limitations in efficiently delivering active ingredients.
본 발명의 발명자들은 수많은 실험과 반복을 거듭한 끝에, 발모와 양모에효과를 가지는 유효성분을 효율적으로 전달할 수 있는 에토좀 조성물 및 이의 제조방법을 완성하기에 이르렀다.After numerous experiments and repetitions, the inventors of the present invention have come to complete an etosomal composition capable of efficiently delivering an active ingredient having an effect on hair growth and wool, and a method for producing the same.
본 발명은 피부 보호막을 투과하여 난용성 유효성분을 효율적으로 전달할 수 있는 에토좀 조성물 및 이의 제조방법을 제공하는 것을 목적으로 한다.An object of the present invention is to provide an etosomal composition capable of efficiently delivering poorly soluble active ingredients through the skin protective film and a method for preparing the same.
본 발명은 발모/양모에 효능이 인정된 발모/양모 기능성 유효성분이 아닌, 피부 항노화, 항산화, 콜라겐 촉진 등의 효과를 가지는 피부 노화 방지 유효성분을 이용하여 두피에 효율적인 전달을 가능하게 함으로써, 발모, 양모 효과를 촉진하고, 탈모를 방지하는 조성물을 제공하는 것을 목적으로 한다.The present invention enables efficient delivery to the scalp by using an effective skin anti-aging active ingredient that has effects such as skin anti-aging, antioxidant, and collagen promotion, not a hair growth / wool functional active ingredient that is recognized as effective for hair growth / wool. It is an object of the present invention to provide a composition that promotes the wool effect and prevents hair loss.
상기와 같은 해결과제를 해결하기 위한 본 발명에 따른 에토좀 조성물은, 비타민과 덱스판테놀이 봉입된 에토좀을 포함하는 에토좀 조성물로서,The etosomal composition according to the present invention for solving the above problems is an etosomal composition comprising an etosomal encapsulated with vitamins and dexpanthen,
상기 에토좀은 에탄올, 펩티드, 포스파티틸콜린(Phosphatidyl choline), 아미노산 화합물을 포함한다.The etosomes include ethanol, peptides, phosphatidyl choline, and amino acid compounds.
상세하게는, 상기 펩티드는 pal-GHK, Pal-GQPR, Pal-KTTK, Pal-KTTKS, Biotin-GHK, PAL-KVK (Palmiotyl Tripeptide-5), Palmitoyl tripeptide-38, Palmitoyl-Tripeptide(Pal-RFK), Human Oligopeptide-20(Val-Gly-Val-Ala-Pro-Gly), GHK-Cu, (AHK)2Cu, AHK-Cu, Myristic acid-KLAKK-CONH2, Hexapeptide-11, Octapeptide-2, Palmitoyl-hexapeptide, Acetyl tetrapeptide-15, Acetyl Hexapeptide 3, Acetyl Tetrapeptide-2, Acetyl Tetrapeptide-5, Acetyl-Decapeptide-3, Ac-KGHK, rh-Oligopeptide-1(humanEGF) (NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVG YIGERCQYRDLKWWELR), Snake tripeptide(beta-Ala-Pro-Dab-NHBzl), peptide CK+(Ac-Arg-Lys-Arg-NH2), peptide CK(Arg-Lys-Arg), tripeptide-3(Ala-His-Lys.HCl), Ac-KGHK-NH2, Ac-Tyr-Arg-hexadecylester, Argireline로 이루어진 군에서 선택된 하나 이상인 것일 수 있다.Specifically, the peptide is pal-GHK, Pal-GQPR, Pal-KTTK, Pal-KTTKS, Biotin-GHK, PAL-KVK (Palmiotyl Tripeptide-5), Palmitoyl tripeptide-38, Palmitoyl-Tripeptide (Pal-RFK) , Human Oligopeptide-20(Val-Gly-Val-Ala-Pro-Gly), GHK-Cu, (AHK)2Cu, AHK-Cu, Myristic acid-KLAKK-CONH2, Hexapeptide-11, Octapeptide-2, Palmitoyl-hexapeptide , Acetyl tetrapeptide-15,
본 발명에 있어서, 상기 비타민은 비타민 E, 비타민 C, 비타민 B, 이들의 염 및 이들의 유사체로 이루어진 군에서 선택된 하나 이상인 것일 수 있다.In the present invention, the vitamin may be one or more selected from the group consisting of vitamin E, vitamin C, vitamin B, salts thereof, and analogs thereof.
본 발명에 있어서, 상기 아미노산 화합물을 아미노산 및 아미노산 유사체로 이루어진 군에서 선택된 하나 이상의 것일 수 있고, 상기 아미노산 및 아미노산 유사체는 NAC(N-Acetyl Cysteine), 아르기닌(Arginin), 로라이신, 라이신 에틸에스터, 히스티딘 및 히스티딘 에틸에스터로 이루어진 군에서 선택된 하나 이상인 것일 수 있다.In the present invention, the amino acid compound may be one or more selected from the group consisting of amino acids and amino acid analogs, and the amino acid and amino acid analogs are NAC (N-Acetyl Cysteine), arginine, lolysine, lysine ethyl ester, It may be one or more selected from the group consisting of histidine and histidine ethyl ester.
본 발명에 있어서, 상기 에토좀 조성물은 비타민 20 내지 70 mg/100ml, 덱스판테놀 150 내지 250 mg/100ml, 에탄올 5 내지 15 ml/100ml, 펩티드 0.1 내지 10 mg/100ml, 포스파티틸콜린 10 내지 1000 mg/100ml, 아미노산 화합물 10 내지 1000 mg/100ml를 포함하는 것하는 것일 수 있다.In the present invention, the ethosome composition is
본 발명에 있어서, 상기 에토좀은 평균입경이 90 내지 200 nm인 것일 수 있다.In the present invention, the etosomal may have an average particle diameter of 90 to 200 nm.
본 발명에 있어서, 상기 에토좀은 표면전하값의 절대값이 10 내지 100 mV인 것일 수 있다.In the present invention, the ethosome may have an absolute value of a surface charge of 10 to 100 mV.
본 발명은 또한, 상술한 에토좀 조성물의 제조방법으로서, The present invention also provides a method for preparing the above-described ethosome composition,
(a) 정제수에 아미노산 화합물을 가용화하는 단계;(a) solubilizing an amino acid compound in purified water;
(b) 정제수에 덱스판테놀을 가용화하는 단계;(b) solubilizing dexpanthenol in purified water;
(c) 에탄올, 비타민, 포스파티딜콜린, 페녹시에탄올을 가용화하는 단계;(c) solubilizing ethanol, vitamins, phosphatidylcholine, and phenoxyethanol;
(d) 상기 (a) 단계의 용액에 상기 (b) 단계의 용액을 첨가한 후, 혼합하는 단계;(d) adding the solution of step (b) to the solution of step (a) and then mixing the solution;
(e) 상기 (d) 단계의 용액에 상기 (c) 단계의 용액을 첨가한 후, 혼합하는 단계;(e) adding the solution of step (c) to the solution of step (d) and then mixing the solution;
(f) 상기 (e) 단계의 용액에 pH 조절제를 첨가한 후, 혼합하는 단계; 를 포함하는 에토좀 조성물의 제조방법을 제공한다.(f) adding a pH adjuster to the solution of step (e) and then mixing; It provides a method for preparing an etosomal composition comprising a.
상기 (c) 단계는 계면활성제, 기타 양모 유효성분으로 이루어진 군에서 선택된 하나 이상을 더 포함하는 것일 수 있다.The step (c) may further include at least one selected from the group consisting of surfactants and other wool active ingredients.
상기 pH 조절제는 시트르산 및 이의 염으로 이루어진 군에서 선택된 하나 이상을 포함하는 것일 수 있다.The pH adjusting agent may include one or more selected from the group consisting of citric acid and salts thereof.
상기 (a) 단계는 정제수 50 내지 70L에 아미노산 화합물을 80 내지 120g 첨가하는 것일 수 있다.The step (a) may be adding 80 to 120 g of an amino acid compound to 50 to 70 L of purified water.
상기 (b) 단계는 정제수 25 내지 35L에 덱스판테놀 100 내지 300 g을 첨가하는 것일 수 있다.The step (b) may be adding 100 to 300 g of dexpanthenol to 25 to 35L of purified water.
본 발명은 또한, 본 발명에 따른 에토좀 조성물을 포함하는 발모 및/또는 양모 촉진용 조성물을 제공한다.The present invention also provides a composition for promoting hair growth and/or wool comprising an etosomal composition according to the present invention.
본 발명은 또한, 본 발명에 따른 에토좀 조성물을 포함하는 휴지기성 탈모 방지용 조성물을 제공한다.The present invention also provides a composition for preventing telogen hair loss comprising an etosomal composition according to the present invention.
더욱 상세하게는, 상기 휴지기성 탈모 방지용 조성물은 두피 항노화 및/또는 콜라겐 생성 촉진을 통해 휴지기성 탈모를 방지하는 것일 수 있다.More specifically, the composition for preventing telogen hair loss may be to prevent telogen hair loss through scalp anti-aging and/or promoting collagen production.
본 발명은 또한, 에토좀 조성물이 올레아놀산(Oleanolic acid) 및/또는 아피제닌(Apigenin)을 더 포함하는 남성용 조성물인 것을 특징으로 하는 발모 및/또는 양모 촉진용 조성물을 제공한다.The present invention also provides a composition for promoting hair growth and / or hair growth, characterized in that the etosome composition is a male composition further comprising oleanolic acid (Oleanolic acid) and / or apigenin (Apigenin).
또한, 상기 에토좀 조성물이 올레아놀산(Oleanolic acid) 및/또는 아피제닌(Apigenin)을 더 포함하는 남성용 조성물인 것을 특징으로 하는 휴지기성 탈모 방지용 조성물을 제공한다.In addition, the etosomal composition provides a composition for preventing telogen hair loss, characterized in that the composition for men further comprises oleanolic acid and/or apigenin.
본 발명에 따르면, 피부 보호막을 투과하여 난용성 유효성분을 효율적으로 전달할 수 있다.According to the present invention, it is possible to efficiently deliver poorly soluble active ingredients through the skin protective film.
본 발명에 따르면 피부 항노화, 항산화, 콜라겐 촉진 등의 효과를 가지는 피부 노화 방지 유효성분이 두피에 효율적으로 전달되도록 함으로써, 발모, 양모 효과를 촉진하고, 탈모를 방지하는 효과를 가진다.According to the present invention, effective skin anti-aging ingredients, which have effects such as skin anti-aging, antioxidant, and collagen promotion, are efficiently delivered to the scalp, thereby promoting hair growth, hair growth, and preventing hair loss.
본 발명에 따르면 에토좀 모폴로지를 이용하여 발모 유효성분 이외에도 다양한 조성물의 효율적인 전달이 가능하게 함으로써 발모효과 증대가 가능한 효과를 가진다.According to the present invention, by using the etosomal morphology, it is possible to efficiently deliver various compositions in addition to the active ingredient for hair growth, thereby increasing the hair growth effect.
도 1은 헤어사이클을 나타낸 모식도이다;
도 2 내지 5는 실시예 1, 5, 10 및 14의 에토좀 크기 및 표면전하값을 측정한 결과이다;
도 6은 Dexpantenol의 피부 침투율을 확인 시험 결과를 나타낸 그래프이다;
도 7은 Vitamin E acetae의 피부 침투율을 확인 실험 결과를 나타낸 그래프이다;
도 8은 피부조직 두께 측정 결과를 나타낸 그래프이다;
도 9는실험예 4-1의 시험 물질 도포 후 모발을 H&E 염색한 실험군의 피부조직 사진이다;
도 10은 실험예 4-1의 실험 기간 동안 모발의 시험물질 도포 후 모발의 재성장 상태를 기록한 사진이다;
도 11은 실험예 4-2의 H&E 염색 후 피부 조직을 촬영한 사진이다;
도 12는 실험예 4-2의 실험 기간 동안 모발의 재성장 상태를 기록한 사진이다;
도13은 성장기 지속/휴지기 억제 효과 시험에서의 피부조직 두께를 나타낸 그래프이다;
도 14는 성장기 지속/휴지기 억제 효과 시험에서의 성장기 모낭비율을 나타낸 그래프이다;
도 15은 성장기 지속/휴지기 억제 효과 시험에서의 시험 시작 후 19일차에 각 그룹 간의 차이를 기록한 사진이다;
도 16는 성장기 지속/휴지기 억제 효과 실험의 성장기 유지 상태를 점수화한 그래프이다.1 is a schematic diagram showing a hair cycle;
2 to 5 are results of measuring the size and surface charge values of etosomes of Examples 1, 5, 10 and 14;
6 is a graph showing the test results confirming the skin penetration rate of Dexpantenol;
Figure 7 is a graph showing the test results confirming the skin penetration rate of Vitamin E acetae;
8 is a graph showing the result of measuring skin tissue thickness;
9 is a photograph of the skin tissue of the experimental group in which the hair was H&E dyed after application of the test substance of Experimental Example 4-1;
10 is a photograph of a regrowth state of hair after application of a test substance to the hair during the experiment period of Experimental Example 4-1;
11 is a photograph of a skin tissue after H&E staining of Experimental Example 4-2;
12 is a photograph of the regrowth state of hair during the experiment period of Experimental Example 4-2;
Figure 13 is a graph showing the thickness of the skin tissue in the growth phase sustained / resting phase inhibition effect test;
14 is a graph showing the growth phase hair follicle ratio in the growth phase sustained / resting phase inhibition effect test;
Fig. 15 is a photograph showing the difference between each group on the 19th day after the start of the test in the growth phase sustained / resting phase inhibition effect test;
FIG. 16 is a graph of scoring the growth phase maintenance state of the growth phase sustaining/resting phase inhibition effect experiment.
이하, 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있도록 본 발명의 각 구성을 보다 상세히 설명하나, 이는 하나의 예시에 불과할 뿐, 본 발명의 권리범위가 다음 내용에 의해 제한되지 아니한다.Hereinafter, each configuration of the present invention will be described in more detail so that those of ordinary skill in the art can easily implement the present invention, but this is only an example, and the scope of the present invention is based on the following contents. Is not limited.
본 발명에 따른 에토좀 조성물은 비타민과 덱스판테놀과 같은 난용성 물질을 피부에 투과시켜 효율적으로 전달하는 효과를 가진다.The etosome composition according to the present invention has an effect of efficiently transmitting a poorly soluble substance such as vitamins and dexpanthenol through the skin.
친수성 물질은 물과 같은 용매에는 잘 용해되지만, 피부는 소수성의 보호막으로 구성되어 있어 친수성의 유효성분은 피부 내로 전달되기 어려운 문제점을 가지고, 소수성 물질의 경우, 물과 같은 친수성 용매 내에서는 응집체를 형성하여 용해되지 않아 용매를 이용한 전달 효율이 떨어지는 문제가 있다.Hydrophilic substances are well soluble in solvents such as water, but the skin is composed of a hydrophobic protective film, so hydrophilic active ingredients are difficult to pass into the skin, and in the case of hydrophobic substances, aggregates are formed in hydrophilic solvents such as water. Therefore, there is a problem that the transfer efficiency using a solvent is inferior because it is not dissolved.
에토좀이란 분자의 피부 및 경피 전달에 사용되는 인지질 나노 소포로서, 발명은 이를 이용하여, 포스파티딜콜린이라는 인지질을 이용하여, 에토좀과 같은 베지클을 형성하고 베지클 내에 유효성분을 봉입한 상태로 피부 보호막으로 이동하여, 유효성분을 피부 보호막 내로 투과시켜 유효성분을 효율적으로 전달할 수 있도록 구성된다.Ethosome is a phospholipid nano vesicle used for the skin and transdermal delivery of molecules.The invention uses this to form a vesicle like an ethosome using a phospholipid called phosphatidylcholine, and the active ingredient is encapsulated in the vesicle. It is configured to move to the protective film, and to transmit the active ingredient efficiently by transmitting the active ingredient into the skin protective film.
본 발명은 특히, 발모, 양모에 효능이 있는 것으로 알려진 성분이 아닌, 피부 항노화, 항산화 및 콜라겐 촉진 등에 효과를 가지는 피부 노화 개선용 유효성분을 이용하여, 이를 두피에 효과적으로 전달함으로써, 두피의 항노화, 항산화 효과를 유발함으로써, 발모, 양모를 촉진하며, 탈모를 방지하는 효과를 가진다.In particular, the present invention uses an active ingredient for improving skin aging, which has an effect on skin anti-aging, antioxidant, and collagen promotion, not an ingredient known to be effective for hair growth and wool, and effectively delivers it to the scalp, thereby preventing the scalp. By inducing aging and antioxidant effects, it promotes hair growth and wool, and has the effect of preventing hair loss.
상기 비타민은 비타민 E, 비타민 C, 비타민 B, 이들의 염 및 이들의 유사체로 이루어진 군에서 선택된 하나 이상인 것을 사용할 수 있다. 비타민으로서 기능하는 것이면 그 형태와 무관하게 어떠한 것이든 사용할 수 있으며, 예를 들면, 비타민 E 아세테이트, 지용성 비타민 C 등과 같은 다양한 형태를 사용할 수 있다.The vitamin may be one or more selected from the group consisting of vitamin E, vitamin C, vitamin B, salts thereof, and analogs thereof. Anything that functions as a vitamin can be used irrespective of its form, and various forms such as vitamin E acetate, fat-soluble vitamin C, and the like can be used.
본 발명에 있어서, 상기 에토좀은 에탄올, 펩티드, 포스파티딜콜린, 아미노산 화합물을 포함함으로써, 에토좀 쉘(Shell)의 유연성을 향상시킴으로써, 피부 침투율을 높이고, 이로 인해, 유효성분의 효율적인 전달이 가능한 효과를 가진다.In the present invention, the ethosome includes ethanol, peptide, phosphatidylcholine, and amino acid compounds, thereby improving the flexibility of the etosomal shell, thereby increasing the skin penetration rate, thereby enhancing the effect of efficient delivery of the active ingredient. Have.
구체적으로, 상기 펩티드는 pal-GHK, Pal-GQPR, Pal-KTTK, Pal-KTTKS, Biotin-GHK, PAL-KVK (Palmiotyl Tripeptide-5), Palmitoyl tripeptide-38, Palmitoyl-Tripeptide(Pal-RFK), Human Oligopeptide-20(Val-Gly-Val-Ala-Pro-Gly), GHK-Cu, (AHK)2Cu, AHK-Cu, Myristic acid-KLAKK-CONH2, Hexapeptide-11, Octapeptide-2, Palmitoyl-hexapeptide, Acetyl tetrapeptide-15, Acetyl Hexapeptide 3, Acetyl Tetrapeptide-2, Acetyl Tetrapeptide-5, Acetyl-Decapeptide-3, Ac-KGHK, rh-Oligopeptide-1(humanEGF) (NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVG YIGERCQYRDLKWWELR), Snake tripeptide(beta-Ala-Pro-Dab-NHBzl), peptide CK+(Ac-Arg-Lys-Arg-NH2), peptide CK(Arg-Lys-Arg), tripeptide-3(Ala-His-Lys.HCl), Ac-KGHK-NH2, Ac-Tyr-Arg-hexadecylester, Argireline로 이루어진 군에서 선택된 하나 이상의 것을 사용할 수 있다. 상기 펩티드는 피부 항산화 등에 효능을 가지는 것으로는 알려져 있기는 하나, 발모, 양모 효과 등에는 효과가 있는 것으로 알려진 성분은 아니나, 본 발명에서는, 해당 성분을 두피 내로 충분히 효율적으로 전달함으로써, 두피의 항산화/항노화 효과를 극대화시켜 모발의 성장 주기를 조절하여 휴지기를 짧게 하고, 성장기를 지속시킴으로써, 발모, 양모 효과를 유발한다. 상기 펩티드는 바람직하게는, pal-GHK일 수 있다.Specifically, the peptides are pal-GHK, Pal-GQPR, Pal-KTTK, Pal-KTTKS, Biotin-GHK, PAL-KVK (Palmiotyl Tripeptide-5), Palmitoyl tripeptide-38, Palmitoyl-Tripeptide (Pal-RFK), Human Oligopeptide-20(Val-Gly-Val-Ala-Pro-Gly), GHK-Cu, (AHK)2Cu, AHK-Cu, Myristic acid-KLAKK-CONH2, Hexapeptide-11, Octapeptide-2, Palmitoyl-hexapeptide, Acetyl tetrapeptide-15,
상기 포스파티딜 콜린은 레시틴의 하나로서, 레시틴은 인산, 콜린, 지방산, 글리세롤, 당지질, 트리글리세라이드, 인지질로 구성된 동식물 조직에서 발생하는 지방 물질군을 지칭하는 것이다.The phosphatidyl choline is one of lecithin, and lecithin refers to a group of fatty substances occurring in animal and plant tissues consisting of phosphoric acid, choline, fatty acids, glycerol, glycolipids, triglycerides, and phospholipids.
이 중에서 포스파티딜 콜린은 헤드 라인으로서 콜린을 포함하는 인지질 클래스로서, 이는 피부 보호막과 같은 인지질로 이루어짐에 따라, 유효성분의 전달 시 피부막을 투과하기 용이한 장점을 가진다.Among them, phosphatidyl choline is a class of phospholipids containing choline as a headline, and as it is made of phospholipids such as a skin protective film, it has the advantage of being easy to penetrate the skin membrane when the active ingredient is delivered.
상기 아미노산 화합물은 아미노산 및 아미노산 유사체로 이루어진 군에서 선택된 하나 이상의 것일 수 있고, 상기 아미노산 및 아미노산 유사체는 구체적으로, NAC(N-Acetyl Cysteine), 아르기닌(Arginin) 및 라이신, 라이신 에틸에스터, 히스티딘, 히스티딘 에틸에스터로 이루어진 군에서 선택된 하나 이상인 것을 포함할 수 있다.The amino acid compound may be one or more selected from the group consisting of amino acids and amino acid analogs, and the amino acid and amino acid analogs are specifically, NAC (N-Acetyl Cysteine), arginine and lysine, lysine ethyl ester, histidine, histidine. It may include one or more selected from the group consisting of ethyl ester.
본 발명에 있어서, 상기 에토좀 조성물은 비타민 20 내지 70 mg/100ml, 덱스판테놀 150 내지 250 mg/100ml, 에탄올 5 내지 15 ml/100ml, 펩티드 0.1 내지 10 mg/100ml, 포스파티틸콜린 10 내지 1000 mg/100ml, 아미노산 화합물 10 내지 1000 mg/100ml를 포함하는 것일 수 있다.In the present invention, the ethosome composition is
상기 비타민은 바람직하게는, 30 내지 60 mg/100ml으로 포함될 수 있고, 상기 함량보다 과량으로 첨가되는 경우, 장기 보관시 비타민이 석출되는 문제가 있고, 상기 함량보다 소량으로 첨가되는 경우에는, 높은 피부 침투율에도 불구하고 충분한 효과를 나타내기 어렵다는 문제가 있다.The vitamin may preferably be contained in an amount of 30 to 60 mg/100ml, and when added in excess of the content, there is a problem that vitamins are precipitated during long-term storage, and when added in a small amount than the content, high skin There is a problem that it is difficult to exhibit a sufficient effect despite the penetration rate.
상기 덱스판테놀은 바람직하게는, 120 내지 220 mg/100ml로 포함될 수 있는데, 상기 함량보다 과량으로 첨가되는 경우에는, 가용화가 어렵고 안정성이 떨어지는 문제가 있고, 상기 함량보다 소량으로 첨가되는 경우에는, 유효성분이 발휘하는 효과가 미미한 문제가 있다.The dexpanthenol may preferably be contained in an amount of 120 to 220 mg/100ml, but when added in excess of the content, solubilization is difficult and stability is poor, and when added in a small amount than the content, effectiveness There is a problem that the effect exerted by the person is negligible.
상기 에탄올은 바람직하게는, 7 내지 12 mg/100ml로 포함될 수 있는데, 상기 함량보다 과량으로 첨가되는 경우에는, 에토좀을 형성하지 못하고 용해가 된 상태가 되는 문제점이 있고, 상기 함량보다 소량으로 첨가되는 경우에는, 에토좀이 형성되지 않아 난용성 물질의 제형의 안정성이 떨어지는 문제가 있다.The ethanol may preferably be contained in an amount of 7 to 12 mg/100ml, and if it is added in excess of the content, there is a problem that it cannot form an etosomal and becomes dissolved, and is added in a small amount than the content. In this case, there is a problem that the stability of the formulation of the poorly soluble substance is poor because the etosomes are not formed.
한편, 상기 펩티드는 바람직하게는, 0.1 내지 10 mg/100ml로 포함될 수 있는데, 상기 함량보다 과량으로 첨가되는 경우에는, 제조/생산 단가가 증가하는 문제가 있고, 상기 함량보다 소량으로 첨가되는 경우에는, 높은 피부 침투율에도 불구하고 충분한 효과를 나타내기 어렵다는 문제가 있다.On the other hand, the peptide may preferably be contained in an amount of 0.1 to 10 mg/100ml, and if it is added in excess of the content, there is a problem of increasing the manufacturing/production unit cost, and if it is added in a small amount than the above content, In spite of the high skin penetration rate, there is a problem that it is difficult to exhibit sufficient effects.
상기 포스파티딜콜린은 바람직하게는, 10 내지 1000 mg/100ml로 포함될 수 있는데, 상기 함량보다 과량으로 첨가되는 경우에는, 에토좀 형성에 참여하지 않는 과량의 물질이 잔류하여 탁도에 심각한 문제가 있고, 상기 함량보다 소량으로 첨가되는 경우에는, 유효물질을 에토좀화 시키는데 문제가 있다.The phosphatidylcholine may preferably be contained in an amount of 10 to 1000 mg/100ml, and if it is added in an excess of the amount, there is a serious problem with turbidity due to the remaining excess material that does not participate in the formation of ethosomes. When added in a smaller amount, there is a problem in etosomeizing the active substance.
상기 아미노산 화합물의 경우, 10 내지 1000 mg/100ml로 포함될 수 있는데, 상기 함량보다 과량으로 첨가되는 경우에는, pH에 상승하거나 낮아지는 문제가 있고, 상기 함량보다 소량으로 첨가되는 경우에는, 이후 pH 조절제를 과량으로 첨가해야 하는 문제가 있다.In the case of the amino acid compound, it may be included in an amount of 10 to 1000 mg/100ml, and when added in excess of the content, there is a problem of raising or lowering the pH, and when it is added in a smaller amount than the content, a pH adjuster There is a problem in that it has to be added in excess.
상기와 같은 함량을 만족하도록 첨가됨으로써, 에토좀 조성물의 유효성분 전달 효과가 특히 우수한 효과를 가지며, 특히, 본 발명에 있어서는, 두비에의 효과적인 전달을 통해 모발의 성장 주기를 조절하여 휴지기를 짧게 하고, 성장기를 지속시킴으로써 발모, 양모 효과를 가지는 것을 특징으로 한다.By being added to satisfy the above content, the effective ingredient delivery effect of the ethosome composition has a particularly excellent effect.In particular, in the present invention, the period of rest is shortened by controlling the growth cycle of the hair through effective delivery to the head , It is characterized by having a hair growth, wool effect by sustaining the growth period.
본 발명에 있어서, 상기 에토좀 조성물에 포함되는 상기 에토좀은 평균 입경이 90 내지 200 nm인 것일 수 있다. 바람직하게는, 100 내지 150 nm인 평균 입경을 가짐으로써, 입자들의 크기가 균일한 효과를 가지며, 안정적인 에토좀 조성물을 유지함에 따라 유효성분 전달에 더욱 유리한 효과를 가진다.In the present invention, the etosomal contained in the etosomal composition may have an average particle diameter of 90 to 200 nm. Preferably, by having an average particle diameter of 100 to 150 nm, the size of the particles has a uniform effect, and has a more advantageous effect on the delivery of an active ingredient by maintaining a stable etosomal composition.
상기 에토좀은 또한, 표면 전하값의 절대값이 10 내지 100 mV인 것일 수 있다. 상기 범위를 가질 때, 에토좀이 서로 뭉치지 않고 균일하게 용액 내에 분산될 수 있다.The etosomal may also have an absolute value of a surface charge of 10 to 100 mV. When it has the above range, the etosomes do not clump together and may be uniformly dispersed in the solution.
본 발명에 따른 에토좀 조성물의 제조방법은, (a) 정제수에 아미노산 화합물을 가용화하는 단계;The method for preparing an etosomal composition according to the present invention comprises the steps of: (a) solubilizing an amino acid compound in purified water;
(b) 정제수에 덱스판테놀을 가용화하는 단계;(b) solubilizing dexpanthenol in purified water;
(c) 에탄올, 비타민, 포스파티딜콜린, 페녹시에탄올을 가용화하는 단계; (d) 상기 (a) 단계의 용액에 상기 (b) 단계의 용액을 첨가한 후, 혼합하는 단계; (e) 상기 (d) 단계의 용액에 상기 (c) 단계의 용액을 첨가한 후, 혼합하는 단계; (f) 상기 (e) 단계의 용액에 pH 조절제를 첨가한 후, 혼합하는 단계; 를 포함한다.(c) solubilizing ethanol, vitamins, phosphatidylcholine, and phenoxyethanol; (d) adding the solution of step (b) to the solution of step (a) and then mixing the solution; (e) adding the solution of step (c) to the solution of step (d) and then mixing the solution; (f) adding a pH adjuster to the solution of step (e) and then mixing; Includes.
구체적으로, 상기 (c) 단계는 계면활성제, 기타 양모 유효성분으로 이루어진 군에서 선택된 하나 이상을 더 포함할 수 있다. 상기 계면활성제는 예를 들어, Poloxamer 188, Poloxamer 407, Poloxamer F-127, PEG 60(hydrogenated cateroil), Polysorbate 80, tween 20, tween 60, tween 80 등의 계면활성제를 사용할 수 있다.Specifically, step (c) may further include one or more selected from the group consisting of surfactants and other wool active ingredients. As the surfactant, for example, a surfactant such as Poloxamer 188, Poloxamer 407, Poloxamer F-127, PEG 60 (hydrogenated cateroil),
상기 기타 양모 유효성분으로는, 어떠한 것이든 특별히 제한되지 않고 사용이 가능하며, 예를 들면, 멜라토닌, 청포 추출물 등과 같은 천연추출물과 화합물 등의 종류를 가리지 않고 필요에 따라 적절히 첨가할 수 있다.As the other active ingredients for wool, any active ingredient may be used without any particular limitation, and for example, natural extracts such as melatonin and blueberry extract and types of compounds may be appropriately added as needed.
상기 pH 조절제는 시트르산 및 이의 염으로 이루어진 군에서 선택된 하나 이상을 포함하는 것일 수 있다.The pH adjusting agent may include one or more selected from the group consisting of citric acid and salts thereof.
상기 (a) 단계는 정제수 50 내지 70L에 아미노산 화합물을 80 내지 120g 첨가하는 것일 수 있다. 바람직하게는, 55 내지 65L의 정제수에 90 내지 110g의 아미노산 화합물을 첨가하는 것일 수 있다.The step (a) may be adding 80 to 120 g of an amino acid compound to 50 to 70 L of purified water. Preferably, it may be to add 90 to 110 g of amino acid compound to 55 to 65L of purified water.
상기 함량보다 과량으로 첨가되면, 정제수에 충분히 용해되지 못하고, 석출되는 문제가 있고, 상기 함량보다 소량으로 첨가되면, 과량의 pH 조절제를 사용해야 하는 문제가 있다.If it is added in excess of the above content, it is not sufficiently dissolved in purified water and there is a problem of precipitation, and if it is added in a small amount than the above content, there is a problem that an excessive amount of a pH adjuster must be used.
한편, 상기 (b) 단계는 정제수 25 내지 35L에 덱스판테놀 100 내지 300 g을 첨가하는 것일 수 있고, 바람직하게는, 27 내지 32 L의 정제수에 덱스판테놀 150 내지 250g을 첨가하는 것일 수 있다.On the other hand, the step (b) may be adding 100 to 300 g of dexpanthenol to 25 to 35L of purified water, and preferably, 150 to 250g of dexpanthenol to 27 to 32L of purified water.
이 경우, 상기 함량보다 과량으로 첨가되면, 정제수에 충분히 용해되지 못하거나 가용화 시간이 길어지며, 석출되는 문제가 있고, 상기 함량보다 소량으로 첨가되면, 상기 에토좀 조성물을 도포하더라도 효과가 미미한 문제가 있다.In this case, if it is added in excess than the above content, it is not sufficiently dissolved in purified water or the solubilization time is long, there is a problem of precipitation, and if it is added in a small amount than the above content, the effect is insignificant even if the etosomal composition is applied. have.
본 발명에 따른 상기 에토좀 조성물은 발모 및/또는 양모 촉진용 조성물로 사용될 수 있는데, 상술한 바와 같이 피부 노화 개선, 노화 방지 효능을 가지는 유효성분을 상기 에토좀 조성물을 이용하여 두피에 효과적으로 투과 시킴으로써, 두피의 노화 개선 효과를 유발하여 휴지기성 탈모를 방지하고, 성장기를 지속 시킴으로써 발모 및/또는 양모 효과를 유발한다.The ethosome composition according to the present invention can be used as a composition for promoting hair growth and/or wool. As described above, by effectively permeating the active ingredient having the effect of improving skin aging and preventing aging into the scalp using the etosome composition. , Prevents telogen hair loss by inducing the aging improvement effect of the scalp, and induces hair growth and/or wool effects by sustaining the growth period.
마찬가지로, 본 발명에 따른 에토좀 조성물을 이용하여, 휴지기성 탈모를 방지할 수 있는 휴지기성 탈모 방지용 조성물을 제공한다.Likewise, it provides a composition for preventing telogen hair loss capable of preventing telogen hair loss by using the etosomal composition according to the present invention.
본 발명에 따른 상기 조성물을 발모, 양모를 유도하거나, 탈모를 개선하거나 방지하는데 사용할 수 있다.The composition according to the present invention can be used to induce hair growth, wool, or to improve or prevent hair loss.
한편, 본 발명은 특히, 사용자의 성별에 따라 최적화된 발모 및/또는 양모 촉진용 조성물과 휴지기성 탈모 방지용 조성물을 제공할 수 있다.On the other hand, the present invention can provide a composition for promoting hair growth and/or wool and a composition for preventing telogen hair loss, which is optimized according to the user's gender.
상술한 에토좀 조성물은 여성과 남성의 구별없이 사용될 수 있으나, 남성에게는 추가적으로, 올레아놀산 및/또는 아피제닌을 더 포함하도록 구성함으로써, 남성 사용자에 특히 적합한 조성물을 제공할 수 있다.The above-described etosomal composition may be used without distinction between a female and a male, but by configuring to further include oleanolic acid and/or apigenin for males, a composition particularly suitable for male users can be provided.
상기 올레아놀산은 트리테르페노이드 사포닌으로서, 펜타사이클릭 트리테르페노이드이다. 이를 사용함으로써, 남성에게 특히 적합한 조성물을 제공할 수 있다.The oleanolic acid is a triterpenoid saponin, which is a pentacyclic triterpenoid. By using this, it is possible to provide a composition particularly suitable for men.
이하, 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있도록 본 발명의 실시예에 대하여 상세히 설명하나, 이는 하나의 예시에 불과할 뿐, 본 발명의 권리범위가 다음 내용에 의해 제한되지 아니한다.Hereinafter, embodiments of the present invention will be described in detail so that those of ordinary skill in the art can easily implement the present invention, but this is only an example, and the scope of the present invention is based on the following content. Is not limited.
[제조예][Production Example]
표 1 내지 3의 성분표를 참고하여 다음과 같은 순서로 실시예와 비교예를 제조하였다.Examples and comparative examples were prepared in the following order with reference to the component tables of Tables 1 to 3.
1. 정제수에 아르기닌(Arginin)을 투입/가용화1.Injection/solubilization of arginine in purified water
2. 정제수, NAC, 판테놀 교반/가용화2. Purified water, NAC, panthenol stirring/solubilization
3. 상기 1의 혼합물에 상기 2의 혼합물을 첨가한 후 혼합3. Mixing after adding the mixture of 2 to the mixture of 1
4. 에탄올, 비타민 E 아세테이트, 폴록사머 F-127, 포스파티딜콜린, 페녹시에탄올, 올레아놀산, 아피제닌 교반/가용화4. Ethanol, vitamin E acetate, poloxamer F-127, phosphatidylcholine, phenoxyethanol, oleanolic acid, apigenin stirring/solubilization
5. 상기 3의 혼합물에 상기 4의 혼합물을 첨가한 후 혼합5. Mixing after adding the mixture of 4 to the mixture of 3
6. 정제수, 시트르산, 소듐시트르산염 교반/가용화(pH=7.0)6. Purified water, citric acid, sodium citrate agitation/solubilization (pH=7.0)
7. 상기 5의 혼합물에 상기 6의 혼합물을 첨가한 후 혼합7. Mix after adding the mixture of 6 to the mixture of 5
[실험예 1: 에토좀(Ethosome) 크기 및 표면전하 측정][Experimental Example 1: Ethosome size and surface charge measurement]
1) 장비: Marlvern Nano ZS1) Equipment: Marlvern Nano ZS
2) 실험방법: 시험물질을 증류수를 이용하여 0.2% 용액으로 희석한 후 측정하였으며, Disposable cell을 이용하여 측정하였다.2) Experimental method: The test material was diluted with a 0.2% solution using distilled water and then measured, and measured using a Disposable cell.
실시예 1, 5, 10 및 14에 대해 에토좀 크기와 표면전하를 측정한 결과를 도 2 내지 5에 나타냈다.For Examples 1, 5, 10 and 14, the results of measuring the size and surface charge of the etosomes are shown in FIGS. 2 to 5.
에토좀(Ethosome)의 경우 난용성 물질 및 현탁화제로 인해 100 nm 대의 입도 분포를 갖기 어려운 경우들도 있으나 본 발명의 실시예는 1, 5, 10, 14의 경우 아래 도면과 같이 균일한 입도 분포와 상대적으로 높은 표면 전하를 띄고 있음을 확인할 수 있다.In the case of ethosomes, it may be difficult to have a particle size distribution in the 100 nm range due to poorly soluble substances and suspending agents, but in the case of 1, 5, 10, and 14 of the present invention, uniform particle size distribution as shown in the figure below. It can be seen that and have a relatively high surface charge.
표면전하값의 경우 절대값이 20 mV 이상일 경우 용액 내 안정성을 유지할 수 있는 것으로 알려져 있다. 실험 결과 -40 ~ -20 mV의 값을 갖는 것을 확인하였는 바, 이로부터 제형의 장기안정성(long term stability)이 우수함을 확인하였다.In the case of the surface charge value, it is known that the stability in the solution can be maintained when the absolute value is 20 mV or more. As a result of the experiment, it was confirmed that it had a value of -40 to -20 mV, and from this, it was confirmed that the formulation has excellent long term stability.
[실험예 2: 안정성 시험][Experimental Example 2: Stability Test]
1) 실험 방법1) Experiment method
- 실험예 1과 같은 실험 방법으로 입도 및 표면전하의 변화를 0일, 1일, 1주, 4주, 8주, 12주, 그리고 24주를 실험을 진행하였다. -In the same experimental method as in Experimental Example 1, changes in particle size and surface charge were tested for 0 days, 1 day, 1 week, 4 weeks, 8 weeks, 12 weeks, and 24 weeks.
- 각 시료는 37도씨 습도 70% 조건에서 보관하고, 미리 예정된 시간에 시료를 채취하여 희석하여 측정하였다.-Each sample was stored at 37°C and 70% humidity, and the samples were collected at a predetermined time, diluted and measured.
ZnO가 첨가되지 않은 실시예 중 1~5와 10~14에 대한 안정성 측정 결과를 아래 표 4에 나타냈다. 제조 공정에 따라 제조된 실시예의 입도 분포는 Z-average size를 기준으로 약 100 nm ~ 160 nm의 입도 분포가 매우 고른 제형이 완성되었으며, Zeta potential의 경우 실시예 3, 실시예 14가 가장 낮은 전하값을 갖는 결과가 나왔으며, 이는 제형의 장기 보관 안정성이 뛰어남을 시사한다. 실시예 1과 10의 경우 시간이 지날수록 입도 분포의 변화는 없으나, 표면전하 값이 증가함을 확인할 수 있었으며, 이는 초기보다는 1~2일 이상 지나고 나서 에토좀의 안정성이 증가하게 됨을 뜻한다.The stability measurement results for 1 to 5 and 10 to 14 of Examples to which ZnO was not added are shown in Table 4 below. The particle size distribution of the examples prepared according to the manufacturing process was a formulation having a very even particle size distribution of about 100 nm to 160 nm based on the Z-average size, and in the case of Zeta potential, Examples 3 and 14 had the lowest charge. Results with values were obtained, suggesting that the formulation has excellent long-term storage stability. In the case of Examples 1 and 10, there was no change in the particle size distribution as time passed, but it was confirmed that the surface charge value increased, which means that the stability of the etosomes increased after 1 to 2 days or more than the initial stage.
[실험예 3: 피부 투과 시험][Experimental Example 3: Skin penetration test]
1) 장비: Biotek사의 Epoch 21) Equipment: Biotek's
2) 분석 파장: 260 nm2) Analysis wavelength: 260 nm
3) Test kit: Pion사의 skin pmapa test kit 사용. 3) Test kit: Pion's skin pmapa test kit is used.
4) 실험 방법: 32℃ incubator를 이용하여 donor 쪽에 시료를 주입(pH=5.4)하고, aceeptor(pH=7.4) 쪽으로 침투된 시료의 량을 microplate reader를 이용하여 측정하였다. 4) Experimental method: A sample was injected into the donor (pH=5.4) using a 32°C incubator, and the amount of the sample penetrated toward the aceeptor (pH=7.4) was measured using a microplate reader.
5) 실험 시간: 실험 시간은 6hr을 기준으로 6시간 동안 acceptor쪽으로 이동한 target 물질의 량을 microplate를 이용하여 측정하거나 HPLC를 이용하여 측정하였다. 아래 수식을 이용하여 계산하였다. 5) Experiment time: The experiment time was measured using a microplate or HPLC for the amount of target material that moved toward the acceptor for 6 hours based on 6 hours. It was calculated using the following formula.
6) 계산: 침투율을 아래 수식을 이용하여 계산하였으며, 대표 예시로 ascorbic acid를 이용한 계산법을 넣었다.6) Calculation: The penetration rate was calculated using the formula below, and a calculation method using ascorbic acid was included as a representative example.
Penetration (%) = [(Ascorbic acid amount in acceptor)/(Ascorbic acid amount in donor)] * 100Penetration (%) = [(Ascorbic acid amount in acceptor)/(Ascorbic acid amount in donor)] * 100
7) 실험군의 구성: 측정하고자 하는 물질을 Pion 사에서 제공한 buffer solution에 첨가한 실험군을 대조군으로 선정하고, 실험군은 실시예에 해당하는 제형을 사용하여 비교 분석하였다.7) Composition of Experimental Group: An experimental group in which a substance to be measured was added to a buffer solution provided by Pion was selected as a control group, and the experimental group was compared and analyzed using the formulation corresponding to the example.
상기의 시험법을 이용한 측정한 실험 결과를 도 6 및 7에 나타냈다. 결과는 대조군의 침투율을 100%로 산정하고, 이에 대한 상대적인 침투율을 나타냈다. 도 6은 친수성 물질인 dexpantenol에 대한 피부 침투율을 확인한 실험 결과이며, 수용성 물질임에도 불구하고 ethosomal formulation을 이용하는 경우 에토좀의 높은 penetration rate에 의해 침투율이 올라감을 확인할 수 있었다.The experimental results measured using the above test method are shown in FIGS. 6 and 7. As a result, the penetration rate of the control group was calculated as 100%, and the relative penetration rate was shown. 6 is an experiment result of confirming the skin penetration rate for dexpantenol, which is a hydrophilic substance, and even though it is a water-soluble substance, it was confirmed that the penetration rate increased due to the high penetration rate of the etosomal when using the ethosomal formulation.
[실험예 4-1: 양모 효과 시험][Experimental Example 4-1: Wool Effect Test]
1) 시험군 구성1) Test group composition
2) 제모: 시험물질의 발모 효능을 평가하기 위해, 등쪽 피부의 색이 pink color를 보이는 42일령의 수컷 C57bl/6 마우스를 사용하였다. Animal clipper(Panasonic ER1431p, Japan)를 이용하여 조심스럽게 등쪽 털을 제거하고 1일간의 안정화 기간을 두었다. 이후 28일 동안 파이펫을 사용하여 200μL/head의 시험물질을 제모 부위에 도포하였다. 양성 대조군으로는 2% 미녹시딜 (ROGAINE SOLUTION 2%)을 동량 도포하였다.2) Hair removal: To evaluate the hair growth efficacy of the test substance, 42-day-old male C57bl/6 mice showing a pink color of the back skin were used. The back hair was carefully removed using an Animal clipper (Panasonic ER1431p, Japan) and a stabilization period of 1 day was given. After 28 days, a test material of 200 μL/head was applied to the hair removal area using a pipette. As a positive control, 2% minoxidil (
3) 시험방법3) Test method
3.1) 사진 촬영 및 모발성장주기 변화 관찰3.1) Photographing and observation of changes in the hair growth cycle
시험물질 도포 시작 후 매일 육안관찰을 실시하여 각 개체별로 피부색 변화(연한 분홍색에서 파란색을)로 대표되는 성장기 도입시기와 모발이 관찰되기 시작하는 모발개시기를 산출하였으며 주기적인 사진 촬영을 실시하였다. 각 군의 모발성장 정도는 scoring system에 의해 각 동물별로 육안적으로 판정하였으며 발모 정도에 따라 0%는 0점, 1~25%는 1점, 26~50%는 2점, 51~75%는 3점, 76~100%는 4점으로 구분하였다.Visual observation was conducted every day after the application of the test substance was started to calculate the period of introduction of the growth phase, which is represented by a change in skin color (from light pink to blue), for each individual, and the period of time when the hair begins to be observed, and periodic photographing was performed. The degree of hair growth of each group was visually determined for each animal by the scoring system. According to the degree of hair growth, 0% was 0, 1-25% was 1, 26-50% was 2, and 51-75% was 3 points and 76~100% were divided into 4 points.
3.2) 조직학적 검사3.2) Histological examination
조직학적 관찰을 위해 피부조직을 적출하여 filter paper에 부착한 상태로 10% 중성포르말린에 48시간 이상 고정하였다. 고정이 완료된 조직은 머리에서 꼬리 방향으로, 두께 5 ~ 10 mm 두께로 삭정한 후 alcohol, xylene, paraffin의 일반적인 조직처리 과정을 거쳤다. 파리핀으로 포매한 후 회전식박절기를 사용하여 4 μm의 박절편을 만들어 hematoxylin and eosin(H&E) 염색을 실시하였다. 광학현미경으로 관찰하면서 피부조직의 두께(dermis + epidermis)를 측정하였으며 각 동물 당 100개의 모낭 중 성장기 모낭과 휴지기 모낭의 비율을 산출하였다.For histological observation, the skin tissue was removed and fixed in 10% neutral formalin for 48 hours or more while attached to filter paper. After fixation was completed, the tissue was cut from the head to the tail to a thickness of 5 to 10 mm, and then subjected to general tissue treatment of alcohol, xylene, and paraffin. After embedding with Parisin, a 4 μm thin section was made using a rotary thinner and stained with hematoxylin and eosin (H&E). While observing with an optical microscope, the thickness of the skin tissue (dermis + epidermis) was measured, and the ratio of growing and resting hair follicles among 100 hair follicles per animal was calculated.
4) 결과4) result
4.1) 사진 촬영 및 모발성장주기 변화 관찰4.1) Photographing and observation of changes in the hair growth cycle
본 실험에서 사용된 C57BL/6 마우스는 멜라닌 생성주기와 모낭의 성장기 도입시기가 일치하기 때문에 육안으로 피부색 변화를 관찰하는 것 만으로도 모낭의 성장기 도입 여부를 판단할 수 있다는 장점을 가지고 있다. 따라서 본 실험에서는 시험물질의 발모 촉진효과를 확인하기 위하여 시험물질 도포를 시작한 직후부터 매일 피부색 변화와 모발이 최초로 관찰되기 시작하는 시점을 측정하였다.The C57BL/6 mice used in this experiment have the advantage of being able to determine whether or not the hair follicle has been introduced to the growth stage simply by observing the change in skin color with the naked eye because the melanin production cycle and the period of introduction of the hair follicle growth phase coincide. Therefore, in this experiment, in order to confirm the hair growth promoting effect of the test substance, every day immediately after application of the test substance was started, the time when the skin color change and hair were first observed was measured.
도 9는 실험예 4-1의 시험 물질 도포 후 모발을 H&E 염색한 실험군의 피부조직 사진이고, 도 10은 실험예 4-1의 실험 기간 동안 모발의 시험물질 도포 후 모발의 재성장 상태를 기록한 사진이다.9 is a photograph of the skin tissue of the experimental group in which the hair was H&E dyed after applying the test substance of Experimental Example 4-1, and FIG. 10 is a photograph of the regrowth state of the hair after applying the test substance to the hair during the experiment period of Experimental Example 4-1. to be.
C57BL/6 마우스의 피부는 성장기 5기(anagen 5)에 진입하면서 회색 빛에서 검은색으로 바뀌기 시작하며 이어 모발의 재성장이 나타나는 것으로 알려져 있다. 본 실험에서는 양성대조군인 Rogaine군 (24.00 ± 7.38)과 비교하여 5군, 7군, 11군, 12군에서 빠른 성장기 이행 속도를 나타냈다. 특히 6군과 7 군에서는 비교하여 평균 7.62일, 4.87일 빠른 성장기 이행 속도를 나타내어 가장 뚜렷한 발모 촉진효과를 나타냈다. 모발의 재성장 시기 관찰 결과에서는 Rogaine군 (26.00 ± 7.37)과 비교하여 6군, 11군에서 평균 8.12일, 4.12일 빠른 효과를 나타냈다. It is known that the skin of C57BL/6 mice begins to change from gray to black as it enters the growth stage 5 (anagen 5), followed by regrowth of hair. In this experiment, compared to the positive control, Rogaine group (24.00 ± 7.38), the 5, 7, 11, and 12 groups showed a faster transition rate to the growth phase. In particular,
이러한 결과는 성장기 도입 동물 수를 백분율로 변환하여 표기한 결과에서도 유사한 경향을 나타냄을 확인할 수 있었다. 6군 (100%), 11군 (75%), 12군(75%)군에서 Rogaine군 (60%) 보다 높은 비율의 성장기 도입 동물이 관찰되었다.These results were confirmed to show a similar trend in the results expressed by converting the number of animals introduced in the growth phase to a percentage. In groups 6 (100%), 11 (75%), and 12 (75%) groups, a higher percentage of animals introduced into the growth phase than in the Rogaine group (60%) were observed.
4.2) 모발 재성장 면적 비교4.2) Comparison of hair regrowth area
모발 재성장 면적을 비교하기 위하여 매일 육안으로 관찰하면서 재성장 면적을 점수화 하여 시험군 간의 차이를 비교하였다. 그 결과 6군 (3.00 + 0.46점)과 12군 (2.13 + 0.61점)에서 Rogaine (1.80 + 0.92점)군보다 높은 점수를 보였다. 또한 7 (1.63+ 0.56)군과 11 (1.75 + 0.31)군에서 Rogaine군과 비슷한 점수를 보였다.In order to compare the hair regrowth area, the difference between the test groups was compared by scoring the regrowth area by visual observation every day. As a result, groups 6 (3.00 + 0.46 points) and 12 groups (2.13 + 0.61 points) showed higher scores than the Rogaine (1.80 + 0.92 points) group. In addition, groups 7 (1.63 + 0.56) and 11 (1.75 + 0.31) showed similar scores to those of the Rogaine group.
4.3) 조직학적 검사4.3) Histological examination
모낭의 성장주기에 따라 피부조직에는 많은 변화가 나타나게 되는데 성장기가 되면 피부색이 검은색으로 바뀌며 피부색의 변화 외에도 두께의 변화를 동반한다. 모낭이 성장기가 되면 특히 subcutis층의 두께가 증가하며 epidermis층의 두께 또한 증가하게 된다. 따라서 시험물질의 발모 촉진 효과를 확인하기 위하여 조직학적 변화를 관찰하였다. 시험물질 도포 28일차에 피부조직을 채취하여 H&E염색을 실시한 후 성장기 모낭의 비율, 피부조직의 두께 변화를 측정하였다. 모낭의 성장기 비율은 각 동물별로 총 100개의 모낭을 확인한 후 비율을 산출하였다.According to the growth cycle of the hair follicle, many changes appear in the skin tissue. In the growing season, the skin color changes to black, and in addition to the change in skin color, the thickness is accompanied by a change. When the hair follicle grows, in particular, the thickness of the subcutis layer increases, and the thickness of the epidermis layer also increases. Therefore, histological changes were observed to confirm the hair growth promoting effect of the test substance. On the 28th day of application of the test substance, skin tissue was collected and H&E stained, and then the proportion of hair follicles in the growth phase and the change in the thickness of the skin tissue were measured. The rate of growth of hair follicles was calculated after checking a total of 100 hair follicles for each animal.
그 결과 negative군에서는 4.9 ± 3.3%의 성장기 모낭이 관찰된 반면 Rogaine군에서는 45.5 ± 21.6%로 성장기 모낭 비율의 뚜렷한 증가를 확인할 수 있었다. 시험물질군에서는 6군 (61.4 + 14.1%)과 11군 (48.9 + 13.1%)에서 Rogaine 군보다 높은 성장기 모낭 비율이 확인되었다. As a result, 4.9 ± 3.3% of growing hair follicles were observed in the negative group, whereas 45.5 ± 21.6% of the growth phase hair follicles were observed in the Rogaine group. In the test chemical group, the proportion of hair follicles during growth was higher in groups 6 (61.4 + 14.1%) and 11 (48.9 + 13.1%) than in the Rogaine group.
피부조직의 두께 측정 결과를 도 9에 나타냈다. negative군에서는 264.8 ± 17.3 μm인 반면 Rogaine군에서는 476.4 ± 95.3 μm로 뚜렷한 피부두께 증가를 확인할 수 있었다. 시험물질군에서는 6군 (569.9 ± 54.5 μm) Rogaine 군보다 높은 피부 두께가 확인되었다.Fig. 9 shows the results of measuring the thickness of the skin tissue. In the negative group, it was 264.8 ± 17.3 μm, whereas in the Rogaine group, it was 476.4 ± 95.3 μm, indicating a distinct increase in skin thickness. In the test substance group, the skin thickness was higher than that of the group 6 (569.9 ± 54.5 μm) Rogaine group.
[실험예 4-2: 양모 효과 시험][Experimental Example 4-2: Wool Effect Test]
1) 실험방법1) Experiment method
1.1) 사진 촬영 및 모발성장주기 변화 관찰1.1) Photographing and observation of changes in the hair growth cycle
시험물질 도포 시작 후 매일 육안관찰을 실시하여 각 군별로 피부색 변화(연한 분홍색에서 파란색을)로 대표되는 성장기 도입기와 모발이 관찰되기 시작하는 모발개시기를 산출하였으며 주기적인 사진 촬영을 실시하였다. 또한 각 군의 모발성장 정도는 scoring system에 의해 각 동물별로 육안적으로 판정하였으며 발모 정도에 따라 0%는 0점, 1~25%는 1점, 26~50%는 2점, 51~75%는 3점, 76~100%는 4점으로 구분하였다.Visual observation was conducted every day after the application of the test substance was started to calculate the introduction of the growth phase, which is represented by a change in skin color (from light pink to blue), for each group, and the hair growth period at which the hair starts to be observed, and periodic photographing was performed. In addition, the degree of hair growth of each group was visually determined for each animal by the scoring system, and according to the degree of hair growth, 0% was 0 points, 1-25% was 1 point, 26-50% was 2 points, and 51-75%. Was divided into 3 points, and 76~100% was divided into 4 points.
1.2) 피부 조직의 조직학적 검사1.2) Histological examination of skin tissue
조직학적 관찰을 위해 피부조직을 적출한 후 10% 중성포르말린에 고정한 다음 24시간 후 흐르는 물에 수세하고 alcohol, xylene, paraffin으로 탈수, 투명, 침투과정을 거쳐 파라핀에 포매하였다. 포매된 조직을 4 μm의 박절편을 만들어 hematoxylin and eosin(H&E) 염색한 후 광학현미경으로 관찰하였다.For histological observation, skin tissues were removed, fixed in 10% neutral formalin, washed with running water after 24 hours, dehydrated with alcohol, xylene, and paraffin, and embedded in paraffin after transparence and infiltration. The embedded tissue was made into a 4 μm thin section, stained with hematoxylin and eosin (H&E), and observed with an optical microscope.
1.3) 성장기 지속기간 측정1.3) Measuring the duration of the growth period
시험물질의 성장기 지속기간을 측정하였다. 측정방법은 피부색이 분홍색에서 회색 또는 검정색 등 색소침착이 나타나는 시기를 성장기 도입시기로 하고 이후 모발성장이 일어난 후 매일 1회 피부색 변화를 관찰하여 최초 피부색 변화부위가 다시 분홍색으로 변화하는 시기를 성장기 종료시기로 하여 그 차이(day)를 비교하였다.The duration of the growth phase of the test substance was measured. As for the measurement method, the period when pigmentation such as skin color appears from pink to gray or black is the period of introduction of the growth period, and after hair growth occurs, the change in skin color is observed once a day, and the period when the first skin color change area changes back to pink is terminated. The difference (day) was compared with the time period.
모발 재성장 면적을 비교하기 위하여 매일 육안으로 관찰하면서 재성장 면적을 점수화 하여 시험군 간의 차이를 비교하였다. 그 결과 모든 시험물질 도포군에서 음성대조군과 비교하여 높은 점수를 보였다.In order to compare the hair regrowth area, the difference between the test groups was compared by scoring the regrowth area by visual observation every day. As a result, all test substance applied groups showed higher scores compared to the negative control group.
도 11은 실험예 4-2의 H&E 염색 후 피부 조직을 촬영한 사진이고, 도 12는 실험예 4-2의 실험 기간 동안 모발의 재성장 상태를 기록한 사진이다.11 is a photograph of a skin tissue after H&E staining of Experimental Example 4-2, and FIG. 12 is a photograph of a regrowth state of hair during the experimental period of Experimental Example 4-2.
실험예 4-1과의 비교를 위해 실시예 1을 실험군 3군에 배치하여 실험을 진행하였다. 그 결과, 4, 5, 8 그리고 12군에서 특히 높은 점수를 보였다. 빠른 성장기 이행 속도를 보인 8군, 12군에서는 각각 24일, 21일째부터 모발이 관찰되기 시작하였으며 양성대조물질인 현대약품 마이녹실을 도포한 시험군에서는 23일째부터 모발이 관찰되기 시작하였다. 이후 도포 32일째까지 진행된 평가결과4군은 평균 3.1 ± 0.7점, 12군은 2.5 ± 0.7점 이상으로 현대약품 마이녹실 2.8 ± 1.3점 보다 높은 점수를 나타냈다. For comparison with Experimental Example 4-1, Example 1 was placed in
이와 같은 결과를 보다 객관적으로 제시하기 위하여 시험물질 도포 후 일정한 간격으로 모발의 재성장 상태를 사진으로 기록하였으며, 사진촬영 결과를 도 10에 나타냈다. 에서는 4군에서 편차 없이 균일하게 모발이 관찰되어 양성대조군인 마이녹실군 보다 12군(실시예 18번)군의 시험물질을 도포한 군에서 균일하고 넓은 면적에서 모발이 관찰됨을 확인할 수 있었다.In order to more objectively present these results, the regrowth state of the hair was recorded as a photograph at regular intervals after application of the test substance, and the photographic results are shown in FIG. 10. In the 4 group, hair was uniformly observed without any deviation, and it was confirmed that hair was observed in a uniform and wide area in the group to which the test material of group 12 (Example 18) was applied than in the positive control group Myoxyl group.
[실험예 5: 성장기 지속/휴지기 억제 효과 시험][Experimental Example 5: Growth period sustained / resting period inhibition effect test]
1) 시험군 구성1) Test group composition
2) 시험방법2) Test method
피부 색이 pink color를 보이는 42일령의 수컷 C57BL/6 mouse의 등 부위를 Animal clipper(Panasonic ER1431p, Japan)를 이용하여 조심스럽게 C57BL/6 mouse 등의 털을 제거한 후 제모크림을 도포하여 잔털을 모두 제거하였다. 제모 후 5일이 경과되며 피부색이 연한 검정색(성장기 도입)으로 변하기 시작하는 시점부터 dexamethasone을 격일로 5회 도포하여 인위적인 퇴행기를 유도하였다. 시험군은 시험 물질과 dexamethasone을 제모 후 4일째부터 같이 도포하여 인위적인 퇴행기 유도 억제/성장기 지속 효과를 확인하였다.Carefully remove the hairs of the C57BL/6 mouse on the back of a 42-day-old male C57BL/6 mouse with a pink skin color using an Animal clipper (Panasonic ER1431p, Japan), and then apply a depilatory cream to remove all fine hair. Removed. After 5 days of hair removal, dexamethasone was applied 5 times every other day from the point when the skin color began to change to light black (introduction of the growth phase) to induce an artificial regression. In the test group, the test substance and dexamethasone were applied together from the 4th day after hair removal to confirm the artificial degenerative induction inhibition/growth sustaining effect.
3) 평가항목3) Evaluation items
3.1) 사진 촬영 및 모발성장주기 변화 관찰3.1) Photographing and observation of changes in the hair growth cycle
성장기 이행 촉진 효과를 판단하기 위하여 시험물질 도포 시작 후 매일 육안관찰을 실시하여 각 군별로 피부색 변화(연한 분홍색에서 파란색을)로 대표되는 성장기를 산출하였으며 주기적인 사진 촬영을 실시하였다. 또한 퇴행기억제 효과 확인을 위하여 특정시점에서 사진촬영을 실시하여 피부색 변화 상태를 관찰하였다.In order to determine the effect of promoting the transition to the growth phase, visual observation was conducted every day after application of the test substance, and the growth phase represented by the change in skin color (from pale pink to blue) for each group was calculated, and periodic photographing was performed. In addition, in order to confirm the degenerative memory suppression effect, a photo was taken at a specific time point to observe the change in skin color.
3.2) 피부 조직의 조직학적 검사3.2) Histological examination of skin tissue
조직학적 관찰을 위해 피부조직을 적출한 후 10% 중성포르말린에 고정한 다음 24시간 후 흐르는 물에 수세하고 alcohol, xylene, paraffin으로 탈수, 투명, 침투과정을 거쳐 파라핀에 포매하였다. 포매된 조직을 4 μm의 박절편을 만들어 hematoxylin and eosin(H&E) 염색한 후 광학현미경으로 관찰하면서 성장기 모낭과 휴지기 모낭의 비율 및 피부조직의 두께 변화를 측정하였다. For histological observation, skin tissues were removed, fixed in 10% neutral formalin, washed with running water after 24 hours, dehydrated with alcohol, xylene, and paraffin, and embedded in paraffin after transparence and infiltration. The embedded tissue was made into a 4 μm thin section, stained with hematoxylin and eosin (H&E), and observed with an optical microscope to measure the ratio of the growing and resting hair follicles and the change in the thickness of the skin tissue.
본 실험의 목적은 실시예의 성장기 지속/휴지기 억제 효과에 대한 효과를 확인하기 위해서 진행된 실험이다. The purpose of this experiment is an experiment conducted in order to confirm the effect on the sustaining/resting effect of the Example.
도 13은 성장기 지속/휴지기 억제 효과 시험에서의 피부조직 두께를 나타낸 그래프이고, 도 14는 성장기 지속/휴지기 억제 효과 시험에서의 성장기 모낭비율을 나타낸 그래프이다.13 is a graph showing the thickness of the skin tissue in the growth period sustained / resting period inhibition effect test, Figure 14 is a graph showing the growth period hair follicle ratio in the growth period sustained / resting period inhibition effect test.
도 15은 성장기 지속/휴지기 억제 효과 시험에서의 시험 시작 후 19일차에 각 그룹 간의 차이를 기록한 사진이고, 도 16는 성장기 지속/휴지기 억제 효과 실험의 성장기 유지 상태를 점수화한 그래프이다.FIG. 15 is a photograph showing the difference between each group on the 19th day after the start of the test in the growth period sustaining/resting period inhibition effect test, and FIG. 16 is a graph scoring the growth period maintenance state of the growing period sustaining/resting period suppression effect experiment.
이를 확인하기 위해서 steroid 계열의 약물인 Dexamethasone을 도포하여 빠른 휴지기 도입을 유도하는 동물 모델을 이용하였다. 모발 재성장 면적을 비교하기 위하여 매일 육안으로 관찰하면서 재성장 면적을 점수화 하여 시험군 간의 차이를 비교하여 그 결과를 도 15에 나타냈다. 그 결과 시험물질 도포군에서 약물 처리한 군에 비해 빠른 양모 효과를 나타냄을 확인하였다. 특히 성장기 모낭의 비율은 매우 높은 비율을 나타냄을 확인할 수 있었다. To confirm this, an animal model was used to induce rapid resting phase introduction by applying Dexamethasone, a steroid-based drug. In order to compare the hair regrowth area, the regrowth area was scored while observing with the naked eye every day, and the differences between the test groups were compared, and the results are shown in FIG. 15. As a result, it was confirmed that the test substance applied group showed a faster wool effect than the drug-treated group. In particular, it was confirmed that the proportion of hair follicles during growth was very high.
이와 같은 결과를 보다 객관적으로 제시하기 위하여 시험 물질 도포 후 사진결과를 도면에 나타냈다. 실시예를 처리한 실험군과 처리하지 않은 군의 사진을 통한 육안 비교 시 피부색이 변색이 발생한 시험물질 도포군이 성장기 진입이 오래동안 지속됨을 확인할 수 있었다.In order to more objectively present these results, the photographic results after application of the test substance are shown in the drawings. When comparing with the naked eye through photographs of the experimental group treated with the example and the non-treated group, it was confirmed that the test substance application group in which the skin color was discolored had a long-lasting entry into the growth phase.
Claims (17)
상기 에토좀은 에탄올, 펩티드, 포스파티틸콜린(Phosphatidyl choline), 아미노산 화합물을 포함하는 발모 및/또는 양모 촉진용 조성물의 제조방법으로서,
(a) 정제수에 아미노산 화합물을 가용화하는 단계;
(b) 정제수에 덱스판테놀을 가용화하는 단계;
(c) 에탄올, 비타민, 포스파티딜콜린, 페녹시에탄올을 가용화하는 단계;
(d) 상기 (a) 단계의 용액에 상기 (b) 단계의 용액을 첨가한 후, 혼합하는 단계;
(e) 상기 (d) 단계의 용액에 상기 (c) 단계의 용액을 첨가한 후, 혼합하는 단계;
(f) 상기 (e) 단계의 용액에 pH 조절제를 첨가한 후, 혼합하는 단계; 를 포함하는 발모 및/또는 양모 촉진용 조성물의 제조방법.
Contains vitamins and dexpanthen enclosed etosomes,
The etosomal is a method for preparing a composition for promoting hair growth and/or hair comprising ethanol, a peptide, phosphatidyl choline, and an amino acid compound,
(a) solubilizing an amino acid compound in purified water;
(b) solubilizing dexpanthenol in purified water;
(c) solubilizing ethanol, vitamins, phosphatidylcholine, and phenoxyethanol;
(d) adding the solution of step (b) to the solution of step (a) and then mixing the solution;
(e) adding the solution of step (c) to the solution of step (d) and then mixing the solution;
(f) adding a pH adjuster to the solution of step (e) and then mixing; A method for producing a composition for promoting hair growth and/or wool comprising a.
상기 (c) 단계는 계면활성제, 기타 양모 유효성분 및 트리테르페노이드 사포닌으로 이루어진 군에서 선택된 하나 이상을 더 포함하는 것을 특징으로 하는 발모 및/또는 양모 촉진용 조성물의 제조방법.
The method of claim 8,
The step (c) further comprises at least one selected from the group consisting of surfactants, other wool active ingredients, and triterpenoid saponins.
상기 pH 조절제는 시트르산 및 이의 염으로 이루어진 군에서 선택된 하나 이상을 포함하는 것을 특징으로 하는 발모 및/또는 양모 촉진용 조성물의 제조방법.
The method of claim 8,
The method for producing a composition for promoting hair growth and/or wool, wherein the pH adjusting agent comprises at least one selected from the group consisting of citric acid and salts thereof.
상기 (a) 단계는 정제수 50 내지 70L에 아미노산 화합물을 80 내지 120g 첨가하는 것을 특징으로 하는 발모 및/또는 양모 촉진용 조성물의 제조방법.
The method of claim 8,
The step (a) is a method for producing a composition for promoting hair growth and/or wool, characterized in that 80 to 120 g of an amino acid compound is added to 50 to 70L of purified water.
상기 (b) 단계는 정제수 25 내지 35L에 덱스판테놀 100 내지 300 g을 첨가하는 것을 특징으로 하는 발모 및/또는 양모 촉진용 조성물의 제조방법.
The method of claim 8,
The step (b) is a method for producing a composition for promoting hair growth and/or wool, characterized in that 100 to 300 g of dexpanthenol is added to 25 to 35L of purified water.
Priority Applications (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2020389480A AU2020389480A1 (en) | 2020-03-30 | 2020-03-30 | Ethosomal composition including ethosomes encapsulating vitamin and dexpanthenol and method for preparing the same |
PCT/KR2020/004318 WO2021201310A1 (en) | 2020-03-30 | 2020-03-30 | Ethosome composition having vitamin and dexpanthenol encapsulated therein, and preparation method therefor |
KR1020200038028A KR102244368B1 (en) | 2020-03-30 | 2020-03-30 | Ethosomal composition with tocopheryl acetate and dexpanthenol and method for preparing the same |
KR1020210043282A KR20210122201A (en) | 2020-03-30 | 2021-04-02 | Ethosomal composition with tocopheryl acetate and dexpanthenol and method for preparing the same |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020200038028A KR102244368B1 (en) | 2020-03-30 | 2020-03-30 | Ethosomal composition with tocopheryl acetate and dexpanthenol and method for preparing the same |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020210043282A Division KR20210122201A (en) | 2020-03-30 | 2021-04-02 | Ethosomal composition with tocopheryl acetate and dexpanthenol and method for preparing the same |
Publications (1)
Publication Number | Publication Date |
---|---|
KR102244368B1 true KR102244368B1 (en) | 2021-04-27 |
Family
ID=75725888
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020200038028A KR102244368B1 (en) | 2020-03-30 | 2020-03-30 | Ethosomal composition with tocopheryl acetate and dexpanthenol and method for preparing the same |
KR1020210043282A KR20210122201A (en) | 2020-03-30 | 2021-04-02 | Ethosomal composition with tocopheryl acetate and dexpanthenol and method for preparing the same |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020210043282A KR20210122201A (en) | 2020-03-30 | 2021-04-02 | Ethosomal composition with tocopheryl acetate and dexpanthenol and method for preparing the same |
Country Status (3)
Country | Link |
---|---|
KR (2) | KR102244368B1 (en) |
AU (1) | AU2020389480A1 (en) |
WO (1) | WO2021201310A1 (en) |
Citations (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR100352088B1 (en) | 1999-06-21 | 2002-09-12 | 한미약품공업 주식회사 | Dermal emulsion composition comprising minoxidil |
JP2003531832A (en) * | 2000-03-28 | 2003-10-28 | コグニス・イベリア・ソシエダッド・リミターダ | Proliposomal encapsulated preparation (IV) |
KR100445146B1 (en) * | 1998-05-27 | 2004-08-18 | 유로-셀띠끄 소시에떼 아노님 | Preparations for the application of anti-inflammatory, especially antiseptic agents and/or agents promoting the healing of wounds, to the lower respiratory tract |
KR20100060754A (en) * | 2008-11-28 | 2010-06-07 | (주)아모레퍼시픽 | External composition for enhancing hair growth through transdermal absorption |
KR20150044029A (en) | 2012-08-31 | 2015-04-23 | 바이오랩 세너스 팔마씨우티카 엘티디에이. | Polymeric finasteride and minoxidil nanoparticles, method for preparing same, aqueous suspension containing same, pharmaceutical composition and use thereof |
KR101810160B1 (en) * | 2017-06-30 | 2018-01-25 | 주식회사 셀리제코스메틱 | Generating method for ethosome with bioactive compounds, ethosome and cosmetic composition including ethosome |
KR20180094008A (en) * | 2015-12-10 | 2018-08-22 | 루브리졸 어드밴스드 머티어리얼스, 인코포레이티드 | Compounds useful in the treatment and / or care of skin, hair, nails, and / or mucosa |
KR101907902B1 (en) * | 2017-02-23 | 2018-12-10 | 김현성 | Liposome composition containing peptide |
KR102025923B1 (en) * | 2011-11-04 | 2019-09-26 | 리포텍 에스.에이. | Peptides which inhibit activated receptors and their use in cosmetic or pharmaceutical compositions |
-
2020
- 2020-03-30 AU AU2020389480A patent/AU2020389480A1/en active Pending
- 2020-03-30 WO PCT/KR2020/004318 patent/WO2021201310A1/en active Application Filing
- 2020-03-30 KR KR1020200038028A patent/KR102244368B1/en active IP Right Grant
-
2021
- 2021-04-02 KR KR1020210043282A patent/KR20210122201A/en unknown
Patent Citations (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR100445146B1 (en) * | 1998-05-27 | 2004-08-18 | 유로-셀띠끄 소시에떼 아노님 | Preparations for the application of anti-inflammatory, especially antiseptic agents and/or agents promoting the healing of wounds, to the lower respiratory tract |
KR100352088B1 (en) | 1999-06-21 | 2002-09-12 | 한미약품공업 주식회사 | Dermal emulsion composition comprising minoxidil |
JP2003531832A (en) * | 2000-03-28 | 2003-10-28 | コグニス・イベリア・ソシエダッド・リミターダ | Proliposomal encapsulated preparation (IV) |
KR20100060754A (en) * | 2008-11-28 | 2010-06-07 | (주)아모레퍼시픽 | External composition for enhancing hair growth through transdermal absorption |
KR102025923B1 (en) * | 2011-11-04 | 2019-09-26 | 리포텍 에스.에이. | Peptides which inhibit activated receptors and their use in cosmetic or pharmaceutical compositions |
KR20150044029A (en) | 2012-08-31 | 2015-04-23 | 바이오랩 세너스 팔마씨우티카 엘티디에이. | Polymeric finasteride and minoxidil nanoparticles, method for preparing same, aqueous suspension containing same, pharmaceutical composition and use thereof |
KR20180094008A (en) * | 2015-12-10 | 2018-08-22 | 루브리졸 어드밴스드 머티어리얼스, 인코포레이티드 | Compounds useful in the treatment and / or care of skin, hair, nails, and / or mucosa |
KR101907902B1 (en) * | 2017-02-23 | 2018-12-10 | 김현성 | Liposome composition containing peptide |
KR101810160B1 (en) * | 2017-06-30 | 2018-01-25 | 주식회사 셀리제코스메틱 | Generating method for ethosome with bioactive compounds, ethosome and cosmetic composition including ethosome |
Also Published As
Publication number | Publication date |
---|---|
AU2020389480A1 (en) | 2021-10-14 |
KR20210122201A (en) | 2021-10-08 |
WO2021201310A1 (en) | 2021-10-07 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8729052B2 (en) | Composition for the prevention and treatment of alopecia, or for hair growth | |
BRPI0619967A2 (en) | skin care compositions | |
EP1089704B1 (en) | Trichological lotion for topical use | |
US9248167B2 (en) | Exfoliative hair retention-promoting formulation | |
CN111329832B (en) | Nanometer lipid carrier microneedle for treating alopecia and application thereof | |
KR20090088275A (en) | Pharmaceutical solution containing minoxidil with enhanced dermal retention and hair growing effect | |
CN110200838A (en) | A kind of complex polypeptide nano vesicle and its preparation method and application | |
JP2010501551A (en) | Use of rare earth elements for hair improvement | |
EP2255782A1 (en) | Composition for the prevention or treatment of hair loss, and method of preparation | |
EP0771555B1 (en) | Agent for external application with nutrient and protective properties | |
KR102244368B1 (en) | Ethosomal composition with tocopheryl acetate and dexpanthenol and method for preparing the same | |
KR20010024317A (en) | Method and composition for causing skin lightening | |
FR3018449A1 (en) | COSMETIC USE OF A MIRABILIS JALAPA EXTRACT, ACTIVE INGREDIENT AND CORRESPONDING COSMETIC COMPOSITION | |
US20180207078A1 (en) | Combination of natural substances comprising at least one glycyrrhetinic acid and at least one guggulsterone, and use thereof for cosmetic applications | |
CN114642733A (en) | Composition for treating androgenetic alopecia and preparation method thereof | |
JPH1192343A (en) | Agent for prolonging hair growth period | |
JP3495261B2 (en) | Hair restorer | |
JPH11199444A (en) | Prophylactic and therapeutic agent for gray hair | |
CN1249678A (en) | Aqueous composition comprising biotin-contg. liposomes | |
KR20220020635A (en) | External preparation composition for promoting hair growth or preventing hair loss | |
CN114796120A (en) | Liposome for preventing hair loss and growing hair as well as preparation method and application thereof | |
KR20200080499A (en) | External preparation composition for promoting hair growth or preventing hair loss comprising caffeic acid derivatives | |
CN116327704A (en) | Preparation method and application of licochalcone A-containing nano liquid crystal carrier | |
CN114931517A (en) | Whitening body and preparation method and application thereof | |
CN116687780A (en) | Polypeptide-containing targeted osmotic composition and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
E701 | Decision to grant or registration of patent right | ||
A107 | Divisional application of patent | ||
GRNT | Written decision to grant |