GB9913458D0 - The therapeutic use of d-threo-methylphenidate - Google Patents
The therapeutic use of d-threo-methylphenidateInfo
- Publication number
- GB9913458D0 GB9913458D0 GBGB9913458.7A GB9913458A GB9913458D0 GB 9913458 D0 GB9913458 D0 GB 9913458D0 GB 9913458 A GB9913458 A GB 9913458A GB 9913458 D0 GB9913458 D0 GB 9913458D0
- Authority
- GB
- United Kingdom
- Prior art keywords
- methylphenidate
- threo
- therapeutic use
- treatment
- respond
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 229960001042 dexmethylphenidate Drugs 0.000 title 1
- DUGOZIWVEXMGBE-CHWSQXEVSA-N dexmethylphenidate Chemical compound C([C@@H]1[C@H](C(=O)OC)C=2C=CC=CC=2)CCCN1 DUGOZIWVEXMGBE-CHWSQXEVSA-N 0.000 title 1
- 230000001225 therapeutic effect Effects 0.000 title 1
- 229960001344 methylphenidate Drugs 0.000 abstract 2
- 208000006096 Attention Deficit Disorder with Hyperactivity Diseases 0.000 abstract 1
- 208000036864 Attention deficit/hyperactivity disease Diseases 0.000 abstract 1
- DUGOZIWVEXMGBE-UHFFFAOYSA-N Methylphenidate Chemical compound C=1C=CC=CC=1C(C(=O)OC)C1CCCCN1 DUGOZIWVEXMGBE-UHFFFAOYSA-N 0.000 abstract 1
- 208000015802 attention deficit-hyperactivity disease Diseases 0.000 abstract 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/445—Non condensed piperidines, e.g. piperocaine
- A61K31/4458—Non condensed piperidines, e.g. piperocaine only substituted in position 2, e.g. methylphenidate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
Landscapes
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Organic Chemistry (AREA)
- Epidemiology (AREA)
- Hospice & Palliative Care (AREA)
- Psychiatry (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Hydrogenated Pyridines (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB9913458.7A GB9913458D0 (en) | 1999-06-09 | 1999-06-09 | The therapeutic use of d-threo-methylphenidate |
| AU55432/00A AU766748B2 (en) | 1999-06-09 | 2000-06-08 | The therapeutic use of d-threo-methylphenidate for the treatment of attention-deficit hyperactivity disorder |
| AT00940504T ATE302006T1 (de) | 1999-06-09 | 2000-06-08 | Therapeutische verwendung von d-threo- methylphenidate zur behandlung von aufmerksamkeitsmangel-hyperaktivitätsstörungen |
| DE60022033T DE60022033T2 (de) | 1999-06-09 | 2000-06-08 | Therapeutische verwendung von d-threo-methylphenidate zur behandlung von aufmerksamkeitsmangel-hyperaktivitätsstörungen |
| EP00940504A EP1185268B1 (en) | 1999-06-09 | 2000-06-08 | The therapeutic use of d-threo-methylphenidate for the treatment of attention-deficit hyperactivity disorder |
| PCT/GB2000/002234 WO2000074680A1 (en) | 1999-06-09 | 2000-06-08 | The therapeutic use of d-threo-methylphenidate for the treatment of attention-deficit hyperactivity disorder |
| ES00940504T ES2243273T3 (es) | 1999-06-09 | 2000-06-08 | Utilizacion terapeutica de d-treo-metilfenidato para el tratamiento del trastorno de hperactividad y deficit de atencion. |
| JP2001501216A JP2003501387A (ja) | 1999-06-09 | 2000-06-08 | 注意欠損活動亢進障害の治療のためのd−トレオ−メチルフェニデートの治療的使用 |
| CA002376215A CA2376215A1 (en) | 1999-06-09 | 2000-06-08 | The therapeutic use of d-threo-methylphenidate for the treatment of attention-deficit hyperactivity disorder |
| DK00940504T DK1185268T3 (da) | 1999-06-09 | 2000-06-08 | Terapeutisk anvendelse af D-threo-methylphenidat til behandling af opmærksomhedsforstyrrelseshyperaktivitetstilstand |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB9913458.7A GB9913458D0 (en) | 1999-06-09 | 1999-06-09 | The therapeutic use of d-threo-methylphenidate |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| GB9913458D0 true GB9913458D0 (en) | 1999-08-11 |
Family
ID=10855048
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| GBGB9913458.7A Pending GB9913458D0 (en) | 1999-06-09 | 1999-06-09 | The therapeutic use of d-threo-methylphenidate |
Country Status (9)
| Country | Link |
|---|---|
| EP (1) | EP1185268B1 (https=) |
| JP (1) | JP2003501387A (https=) |
| AT (1) | ATE302006T1 (https=) |
| AU (1) | AU766748B2 (https=) |
| CA (1) | CA2376215A1 (https=) |
| DE (1) | DE60022033T2 (https=) |
| ES (1) | ES2243273T3 (https=) |
| GB (1) | GB9913458D0 (https=) |
| WO (1) | WO2000074680A1 (https=) |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5837284A (en) | 1995-12-04 | 1998-11-17 | Mehta; Atul M. | Delivery of multiple doses of medications |
| US6486177B2 (en) | 1995-12-04 | 2002-11-26 | Celgene Corporation | Methods for treatment of cognitive and menopausal disorders with D-threo methylphenidate |
| US6962997B1 (en) | 1997-05-22 | 2005-11-08 | Celgene Corporation | Process and intermediates for resolving piperidyl acetamide steroisomers |
| AU2006206410B2 (en) | 2005-01-20 | 2012-08-30 | Ampio Pharmaceuticals, Inc. | Methylphenidate derivatives and uses of them |
| EP2300011A4 (en) | 2008-05-27 | 2012-06-20 | Dmi Life Sciences Inc | THERAPEUTIC PROCESSES AND COMPOUNDS |
| US10662146B2 (en) | 2015-09-15 | 2020-05-26 | Praxis Bioresearch, LLC | Prodrugs of fencamfamine |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB9514451D0 (en) * | 1995-07-14 | 1995-09-13 | Chiroscience Ltd | Sustained-release formulation |
| US5922736A (en) * | 1995-12-04 | 1999-07-13 | Celegene Corporation | Chronic, bolus administration of D-threo methylphenidate |
| US5908850A (en) * | 1995-12-04 | 1999-06-01 | Celgene Corporation | Method of treating attention deficit disorders with d-threo methylphenidate |
| US5837284A (en) * | 1995-12-04 | 1998-11-17 | Mehta; Atul M. | Delivery of multiple doses of medications |
| MX9805870A (https=) * | 1996-01-22 | 1999-01-31 | ||
| US6210705B1 (en) * | 1997-12-15 | 2001-04-03 | Noven Pharmaceuticals, Nc. | Compositions and methods for treatment of attention deficit disorder and attention deficit/hyperactivity disorder with methylphenidate |
| US6025502A (en) * | 1999-03-19 | 2000-02-15 | The Trustees Of The University Of Pennsylvania | Enantopselective synthesis of methyl phenidate |
-
1999
- 1999-06-09 GB GBGB9913458.7A patent/GB9913458D0/en active Pending
-
2000
- 2000-06-08 CA CA002376215A patent/CA2376215A1/en not_active Abandoned
- 2000-06-08 DE DE60022033T patent/DE60022033T2/de not_active Expired - Fee Related
- 2000-06-08 WO PCT/GB2000/002234 patent/WO2000074680A1/en not_active Ceased
- 2000-06-08 JP JP2001501216A patent/JP2003501387A/ja active Pending
- 2000-06-08 EP EP00940504A patent/EP1185268B1/en not_active Expired - Lifetime
- 2000-06-08 AU AU55432/00A patent/AU766748B2/en not_active Ceased
- 2000-06-08 AT AT00940504T patent/ATE302006T1/de not_active IP Right Cessation
- 2000-06-08 ES ES00940504T patent/ES2243273T3/es not_active Expired - Lifetime
Also Published As
| Publication number | Publication date |
|---|---|
| DE60022033T2 (de) | 2006-03-30 |
| JP2003501387A (ja) | 2003-01-14 |
| EP1185268B1 (en) | 2005-08-17 |
| ATE302006T1 (de) | 2005-09-15 |
| AU5543200A (en) | 2000-12-28 |
| DE60022033D1 (de) | 2005-09-22 |
| WO2000074680A1 (en) | 2000-12-14 |
| EP1185268A1 (en) | 2002-03-13 |
| CA2376215A1 (en) | 2000-12-14 |
| AU766748B2 (en) | 2003-10-23 |
| ES2243273T3 (es) | 2005-12-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| IL151164A0 (en) | Azacyclic compounds for use in the treatment of serotonin related diseases | |
| SG158731A1 (en) | Novel medicament compositions, based on anticholinergically effective compounds and beta-mimetics | |
| GEP20094759B (en) | Combination therapy using 1-aminocyclohexane derivatives and acetylcholinesterase inhibitors | |
| DE50002293D1 (de) | Verwendung von csf-1-inhibitoren | |
| MY112973A (en) | Methods for inhibiting vascular smooth muscle cell migration | |
| HUP0000873A2 (hu) | A levobupivakain arcsebészeti alkalmazása | |
| MY137144A (en) | Piperidine derivatives and their use as modulators of chemokine receptor activity (especially ccr5) | |
| DK1000029T3 (da) | Norcisaprid nyttig med hensyn til 5-HT3- og 5-HT4- medierede lidelser | |
| GB9913458D0 (en) | The therapeutic use of d-threo-methylphenidate | |
| SI1697005T1 (sl) | Kombinacija flupirtina in tramadola | |
| MY103210A (en) | Arylpiperazinyl-alkylene-phenyl-heterocyclic compounds. | |
| PT783495E (pt) | Derivados de quinoxalina uteis em terapia | |
| AP2000002017A0 (en) | Salts of paroxetine. | |
| EP1152762B8 (de) | Verwendung von desoxypeganin zur behandlung von alzheimerischer demenz | |
| NZ536111A (en) | Statin therapy for enhancing cognitive maintenance | |
| TW349864B (en) | Use of N-(pyridinyl)-1H-indol-a-amines for the preparation of a medicament for the treatment of obsessive-compulsive disorders | |
| BG105984A (bg) | Използване на озанетант за приготвяне на лекарствени средства полезни за лечение на разстройства на настроението | |
| AU2003270292A1 (en) | Combined use of methylphenidate and melatonin for treating attention-deficit hyperactive disorder | |
| NO20010984L (no) | Anvendelse av R(+)-<alfa>-(2,3-dimetoksyfenyl)-1-[2-(4-fluorfenyl)etyl]-4-piperidinmetanol for behandling av sovnforstyrrelser | |
| AU7768601A (en) | Use of fibrates for the preparation of a medicament useful in the treatment of congestive heart failure | |
| AU2002226004A1 (en) | Use of factor xiii for treating hemophilia b | |
| NO20055998L (no) | Diarylmetylidenpiperidinderivater, preparater derav og anvendelse derav | |
| UA28400A (uk) | Спосіб лікування мікробної екземи | |
| MX9801680A (es) | Derivado de fenil pirimidina opticamente activo como agente analgesico. |