FR2954138A1 - COSMETIC TREATMENT PROCESS FOR BODY ODORS USING BACTERIOCIN COMPOSITION - Google Patents

Abstract

The invention relates to cosmetic compositions and methods for treating body odors, in particular axillary odors, the processes comprising the application to keratin materials of a composition comprising, in a cosmetically acceptable medium, at least one bacteriocin.

Description

The invention relates to cosmetic compositions and methods for treating body odors, in particular axillary odors, the processes comprising the application to keratin materials of a composition comprising, in a cosmetically acceptable medium, at least one bacteriocin.

In the field of cosmetics, it is well known to use, in topical application, deodorant products containing active substances of the anti-perspirant or bactericidal type in order to reduce or even eliminate body odors, in particular axillary odors, which are generally unpleasant.

The antiperspirant substances have the effect of limiting the flow of sweat. They generally consist of aluminum salts which, on the one hand, have a potential irritant for the skin and which, on the other hand, reduce the flow of sweat by modifying the cutaneous physiology, which is not satisfactory. Bactericidal substances inhibit the development of cutaneous flora responsible for axillary odors. Of the bactericidal products, the most commonly used is Triclosan (2,4,4'-trichloro-2'-hydroxydiphenyl ether), which has the disadvantage of significantly modifying the ecology of the skin flora 20 and being inhibited by certain compounds, such as nonionic surfactants, commonly used in the formulation of cosmetic compositions.

The axillary microflora is mainly composed of Gram + bacteria, such as staphylococci (eg, S.epidermidis, S.hominis, etc.), coryneforms (more particularly C.xerosis), micrococci (eg, M.Luteus), Brevibacteries and Propionibacteries.

The axillary bad odors are attributed to the microbial biotransformation of natural secretions, without odor, in odorous volatile products. Strong axillary odors are mainly related to the presence of C. xerosis in this area.

The bactericidal products conventionally used to obtain a good deodorant efficacy result in the destruction without distinction of the total cutaneous flora. In order to obtain a more targeted deodorant efficacy, active ingredients are sought which have a more specific action against the germs responsible for bad odors, and moreover respectful of beneficial germs not responsible for these inconveniences. US Patent 5,318,778 proposes the use of lantibiotics in deodorant compositions.

There remains, however, the need to find improved treatments for bad body odors related to human perspiration, including axillary odors.

The Applicant has surprisingly and unexpectedly discovered that by using a Class II bacteriocin in a composition, effective deodorant activity can be achieved. This discovery is the basis of the invention.

The subject of the present invention is therefore a cosmetic process for treating body odors, in particular axillary odors, comprising the application to the keratin materials of a composition comprising, in a cosmetically acceptable medium, at least one class II bacteriocin.

The present invention also relates to the use as a deodorant agent of a class II bacteriocin. Other objects of the invention will appear in the following description.

By "cosmetically acceptable" is meant compatible with the skin and / or its integuments or mucous membranes which has a pleasant color, odor and feel and which does not generate unacceptable discomfort (tingling, tightness, redness), likely to divert the consumer from using this composition. By "keratin materials" is meant the skin (body, face, eye contour), hair, eyelashes, eyebrows, hair, nails, lips, mucous membranes.

BACTERIOCINS Bacteriocins are peptide compounds naturally synthesized by certain bacteria. They play an important role in the competition between bacterial strains.

The bacteriocins may be bactericidal, i.e., remove certain microorganisms and / or they may be bacteriostatic, i.e., inhibit the growth of certain microorganisms. The bactericidal or bacteriostatic activity is directed against certain species close to the producing strain.

The bacteriocins are generally cationic and amphiphilic peptides responsible for the permeabilization of the membrane of the target cells. Indeed, they bind to certain membrane receptors and cause the formation of pores. The membrane is thus made permeable to certain compounds such as ions or molecules. This is usually lethal to the target bacteria. 20 Classification of bacteriocins

The bacteriocins are classified according to structural data in four classes, as proposed by Klaenhammer (1993). These four classes are: Class I. Lantibiotics: heat-stable peptides less than 5 kDa in size which contain unusual sulfur-containing amino acids formed post-translationally, i.e. lanthionine, R- methyl lanthionine, dehydrobutyrine and dehydroalanine. They can be divided into two types: class la which comprises elongated hydrophobic cationic peptides containing up to 34 amino acids and class Ib which comprises negatively charged or no net charge globular peptides and containing up to 19 amino acids ( McAuliffe et al., 2001, Twomey et al., 2002). There are also two-component class I bacteriocins such as cytolysin, lacticin 3147 and plantaricin W (see Table 3).

By way of illustration, mention may be made, as class I bacteriocins, which may be used according to the invention, of nisin, epidermin, subtilin, lactocin S, salivaricin A and plantaricin C.

In particular, the class I bacteriocins described in Tables 1, 2 and 3 below can be used.

Table 1: Examples of Class Bacteriocin Bacteriocins Producer References * Nisin A Lactococcus lactis NIZO5 Buchman et al., 1988 Nisin Z Lactococcus lactis NIZO22186 Mulders et al., 1991 Subtilin Bacillus subtilis ATCC6633 Banerjee and Hansen, 1988 Pep5 Staphylococcus epidermidis 5 Kaletta and al., 1989b Epidermin Staphylococcus epidermidis Tu3298 Schnell et al., 1989 Gallidermine Staphylococcus epidermidis Tu3298 Schnell et al., 1989 Mutacin III Streptococcus mutans JH1000 Hillman et al., 1998; (Mutacin 1140) Qi et al., 1999b Lactocin S Lactobacillus sakei L45 Skaugen et al., 1994; Skaugen et al., 1997 Lacticine 481 Lactococcus lactis ADRIA851030 Piard et al., 1993; Rince et al., 1994 Bacteriocin J46 Lactococcus lactis ssp. Cremoris J46 Huot et al., 1996 Streptococcin A Streptococcus pyogenes FF22 Hynes et al., 1993 FF22 Salivaricin A Streptococcus salivarius 20P3 Ross et al., 1993 Streptin Streptococcus pyogenes BL Karaya et al., 2001 Plantaricin C Lactobacillus plantarum C Turner et al. ., 1999 * as they appear in the chapter "Bacteriocins of lactic acid bacteria" (Morisset et al.) Of the book Lactic and Probiotic Bacteria, LUQUET François-Marie, CORRIEU Georges; ed. Lavoisier

Table 2: Examples of class Ib bacteriocins Lantibiotics Producer References * Mersacidin Bacillus subtilis HIL Y85 Kogler et al., 1991 Actagardine Actinoplanes Kettenring et al., 1990 Ancovenin Streptomyces ssp. Shiba et al., 1991 Duramycin C Streptomyces griseoluteus Fredenhagen et al., 1990 Mutacin II Streptococcus mutans Wooddruff et al., 1998 * as contained in the chapter "Bacteriocins of lactic acid bacteria" (Morisset et al.) Of the book Bacteria Lactics and probiotics, LUQUET François-Marie, CORRIEU Georges; ed. Table 3: Examples of Two-Component Class I Bacteriocins Lantibiotics Producer References * Lacticine 347 (Al and A2) Lactococcus lactis DPC3147 Dougherty et al., 1998 Cytolysin cyll (1 and 2) Enterococcus faecalis DS16 Gilmore et al., 1994 Plantaricin w (a and j3) Lactobacillus plantarum W Halo et al., 2001 * as they appear in the chapter "Bacteriocins of lactic acid bacteria" (Morisset et al.) Of the book Lactic and Probiotic Bacteria, LUQUET François-Marie, CORRIEU Georges; ed. Lavoisier Class II. Peptides less than 10 kDa, heat stable, not containing modified amino acids. The sequences of some bacteriocins belonging to this class are shown in Table 4.

10 Table 4: sequences of certain class of bacteriocins It Class Ila "Pediocin-like bacteriocin" mesentericin MTNMKSVEAYQQLDNQNLKKVVGGKYYGNGVHCTKSGCSVNWGEAASAGIH Y105 RLANGGNGFW (SEQ ID NO: 1) sakacin P MEKFIELSLKEVTAITGGKYYGNGVHCGKHSCTVDWGTAIGNIGNNAAANWAT GWNAGG (SEQ ID NO: 2) Curvacine A MNNVKELSMTELQTITGGARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGW ASGLAGM (SEQ ID NO : 3) Piscicoline 126 MKTVKELSVKEMQLTTGGKYYGNGVSCNKNGCTVDWSKAIGIIGNNAAANLTT GGAAGWNKG (SEQ ID NO: 4) Carnobactériocine MKSVKELNKKEMWWINGGAISYGNGVYCNKEKCWVNKAENKQAITGIVIGGW Bml ASSLAGMGH (SEQ ID NO: 5) pediocin PA-1 MKKIEKLTEKEMANIIGGKYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWAT GGHQGNHKC (SEQ ID NO: 6) enterocin A MKHLKILSIKETWLIYGGTTHSGKYYGNGVYCTKNKCTVDWAKATTCIAGMSIG GFLGGAIPGKC (SEQ ID NO: 7) sakacin G MKNTRSLTIQEIKSITGGKYYGNGVSCNSHGCSVNWGQAWTCGVNHLANGGH GGVC (SEQ ID NO: 8) Class Ilb: "Two peptides bacteriocin" ABP-118 a KRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTCL (SEQ ID NO: 9) I3 KNGYGGSGNRWVHCGAGIVGGALIGAIGGPWSAVAGG ISGGFTSCR (SEQ ID NO: 10) Lactocine 705 has MDNLNKFKKLSDNKLQATIGG (SEQ ID NO: 11) I3 MESNKLEKFANISNKDLNKITGG (SEQ ID NO: 12) lactococcin MN M IRGTGKGLAAAMVSGAAMGGAIGAFGGPVGAIMGAWGGAVGGAMKYSI (SEQ ID NO: 13) N GSIWGAIAGGAVKGAIAASWTGNPVGIGMSALGGAVLGGVTYARPVH (SEQ ID NO: 14) plantaricin EF E FNRGGYNFGKSVRHVVDAIGSVAGIRGILKSIR (SEQ ID NO: 15) F VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG (SEQ ID NO: 16) Class Ilc plantaricin A MKIQIKGMKQLSNKEMQKIVGGKSSAYSLQMGATAIKQVKKLFKKWGW (SEQ ID NO: 17) lactococcin A MKNQLNFNIVSDEELSEANGGKLTFIQSTAAGDLYYNTNTHKYVYQQTQNAFG AAANTIVNGWMGGAAGGFGLHH (SEQ ID NO: 18) lactococcin 972 MKTKSLVLALSAVTLFSAGGIVAQAEGTWQHGYGVSSAYSNYHHGSKTHSATV VNNNTGRQGKDTQRAGVWAKATVGRNLTEKASFYYNFW (SEQ ID NO: 19) 5 Class II is divided into three subclasses. The bacteriocins of subclass IIa are peptides having a structure similar to that of pediocin, which was the first bacteriocin of this described group. The bacteriocins of subclass IIa contain between 27 and 48 amino acids and all have a hydrophobic N-terminal portion containing the YGNGV consensus sequence as well as a disulfide bridge and a less conserved, hydrophobic or amphiphilic C-terminal portion which determines the specificity of action (Fimland et al., 2000, Richard et al., 2006). This class may also be more particularly defined as possessing in particular a conserved N-terminal sequence YGNGVxCxxxxCxV (Klaenhammer, 1993, Ennahar et al., 2000, Nes and Holo, 2000). They all have anti-Listeria activity. Some bacteriocins of this subclass also contain a second disulfide bridge in their C-terminal domain which appears to be important in the stabilization of the tertiary structure. It also appears to provide better antimicrobial activity, better resistance to high temperature exposure, and a broader spectrum of action (Eijsink et al., 1998, Fimland et al., 2000; al., 2006, Richard et al., 2006). Subclass Ilb includes bacteriocins in need of two peptides for activity. Two types of class IIb bacteriocins can be distinguished: the E type (Enhancing) where the function of one of the two peptides is to increase the activity of the other and the type S (Synergy) where the two peptides are complementary . Subclass Ilc contains bacteriocins that can not be classified in other subclasses.

By way of example of class IIa bacteriocins which can be used according to the invention, mention may be made of the bacteriocins of Table 5. It is also possible to mention coagulin. Table 5: Examples of class IIa bacteriocins Bacteriocins Producer References Mesentericin Y105 Leuconostoc mesenteroides ssp. Hechard et al., 1992a Mesenteroides Y105 Leucocin A Leuconostoc gelidum UAL 187 Hasting et al., 1991 Leucocin C Leuconostoc mesenteroides Fimland et al., 2002c Mundticin Enterococcus mundtii AT06 Bennik et al., 1998 Mundticin KS Enterococcus mundtii NFRI 7393 Kawamoto et al. , 2002 Sakacin P Lactobacillus sakei LTH674 Tichaczek et al., 1994 Curvacin A Lactobacillus curvatus LTH1174 Tichaczek et al., 1993 Piscicoline 126 Carnobacterium piscicola JG126 Jack et al., 1996 Carnobacteriocin BM1 Carnobacterium piscicola LV17B Quadri et al., 1994 Carnobacteriocin B2 Carnobacterium piscicola LV17B Quadri et al., 199425 Bavaricin MN Lactobacillus sakei MN Kaiser and Montville, 1996 Bacteriocin 31 Enterococcus faecalis Y1717 Tomita et al., 1996 Enterococcus P Enterococcus faecium P13 Cintas et al., 1997 Bifidocin B Bifidobacterium bifidum NCFB 1454 Yildirim et al. 1999 Sakacin G Lactobacillus sakei 2512 Simon et al., 2002 Pediocin PA-1 Pediococcus acidilactici PAC 1.0 Chikindas and et al., 1993 Enterococcus faecium Enterococcus faecium DPC1146 Aymerich et al., 1996 Divercine V41 Carnobacterium divergens V41 Metivier et al., 1998 Plantaricin 423 Lactobacillus plantarum 423 Van Reenen et al., 2003 Plantaricin C19 Lactobacillus plantarum C19 Atrich et al., 2001 Sakacin 5X Lactobacillus sakei Vaughan et al., 2001 Lactococcin MMFII Lactococcus lactis MMFII Ferchichi et al., 2001 * as they appear in the chapter "Bacteriocins of lactic acid bacteria" (Morisset et al.) Of the book Lactic and Probiotic Bacteria, LUQUET François-Marie, CORRIEU Georges; ed. Lavoisier As an example of class IIb bacteriocins that can be used according to the invention, mention may be made of lactococcin G, lactacin, lactoccin 705, thermophilin, plantaricin EF, leucocin, carnocine, and acidocine. In particular, mention may be made of the bacteriocins listed in Table 6 below.

Table 6: Examples of class IIb bacteriocins Bacteriocins (peptides) Producers References Lactococcin G (LcnG a and j3) Lactococcus lactis LMG2081 Nissen-Meyer et al., 1992 Lactococcin MN (Lcn M and N) Lactococcus lactis 9B4 Van Belkum et al. , 1991a Lactacin F (Laf A and X) Lactococcus johnsonii Allison et al., 1994 VP111088 Thermophilin 13 (Thm A and B) Streptococcus thermophilus Marciset et al., 1997 Sfi 13 Plantaricin S (Pls A and B) Lactobacillus plantarum Jimenez-Diaz et al., 1995; LCP010 Stephens et al., 1998 Plantaricin EF (Pln E and F) Lactobacillus plantarum C1 Diep et al., 1996; Anderssen et al., 1998 Plantaricin JK (Pln J and K) Lactobacillus plantarum C1 Diep et al., 1996; Anderssen et al., 1998 Leucocin H (a and j3) Leuconostoc ssp. MF215B Blom et al., 1999 Carnocine H Carnobacterium ssp. Blom et al., 2001 Lactocin 705 (a and 3) Lactobacillus casei CRL 705 Palacios et al., 1999; Cuozzo et al., 2000 Acidocin J1132 Lactobacillus Acidophilus Tahara et al., 1996; JCM 1132 Tahara et al., 1997 ABP-118 (a and R) Lactobacillus salivarius ssp. Flynn et al., 2002 salivarius UCC118 Enterococci 1071 Enterococcus faecalis BFE Balla et al., 2000 1071 Mutacin IV Streptococcus mutans UA 140 Qi et al., 2001 Enterococcus L50 (A and B) Enterococcus faecium L50 Floriano et al., 1998 * Such that they appear in the chapter "Bacteriocins of lactic acid bacteria" (Morisset et al.) of the book Lactic and Probiotic Bacteria, LUQUET François-Marie, CORRIEU Georges; ed. Examples of class IIc bacteriocins that can be used according to the invention include the bacteriocins listed in Table 7 below.

Table 7: Examples of class IIc bacteriocins Bacteriocins (peptides) Producers References Acidocin B Lactobacillus acidophilus M46 Leer et al., 1995 Divergicin A Carnobacterium divergens Worobo et al., 1995 LV13 Enterococcus P Enterococcus faecium P13 Cintas et al., 1997 Bacteriocin 31 Enterococcus faecalis 31 Tomita et al., 1996 Lactococcin 972 Lactococcus lactis IPLA 972 Martinez et al., 1999 Enterococcus faecium Enterococcus faecium 6Tla Quadri et al., 1994 Enterococcus faecium L50 Cintas et al., 2000 Acidocin 8912 Lactobacillus acidophilus Kanatani et al ., 1995b TK8912 Bacteriocin AS-48 Enterococcus faecalis Mendoza et al., 1999 Gassericin A Lactobacillus gasseri LA39 Kawai et al., 1998 Lactococcin A Lactococcus lactis Van Belkum et al., 1991c; Morgan et al., 1995 Lactococcin B Lactococcus lactis Van Belkum et al., 1992 Diacetin B Lactococcus lactis spp. Ali et al., 1995 diacetylactis UL720 Carnobacteriocin A Carnobacterium piscicola Holck et al., 1994; LV17A Worobo et al., 1994 Lactobin A Lactobacillus amylovorus LMG Contreras et al., 1997 P-13139 Divergicin 750 Carnobacterium divergens 750 Holck et al., 1996 Enterococcus B Enterococcus faecium Bogovic-Matijasic et al., 1998; T136 / C492 and BFE900 Franz et al., 1999 Peptide A Lactobacillus acidophilus LF221 Tahara et al., 1997 Peptide B Lactobacillus acidophilus LF221 Tahara et al., 1997 Leucocin B-TA33a Leuconostoc mesenteroides Papathanasopoulos et al., 1998 TA33a Gassericin B3 Lactobacillus gasseri JCM 2124 Tahara et al., 1997 Brévicine Lactobacillus brevis Benoit et al., 1997 Plantaricin 1.25 [3 Lactobacillus plantarum Ehrmann et al., 2000 TMW1.25 Mesentericin B105 Leuconostoc mesenteroides Revol-Junelles et al., 1996; spp. mesenteroides Y105 Hechard et al., 1999 * as they appear in the chapter "Bacteriocins of lactic acid bacteria" (Morisset et al.) of the book Lactic and Probiotic Bacteria, LUQUET François-Marie, CORRIEU Georges; ed. Lavoisier Class III. Proteins larger than 30 kDa and sensitive to heat. The

The structure and mode of action of these bacteriocins differs completely from other bacteriocins produced by lactic acid bacteria. To date, four bacteriocins of this class have been identified: helveticin J produced by Lactobacillus helveticus A, enterolysin A produced by Enterococcus faecium, zoocin A produced by Spreptococcus zooepidemicus and millericin B produced by Streptococcus milleri.

(Nilsen et al., 2003, Papagianni, 2003, Nigutova et al., 2007) .5 By way of example of class III bacteriocins that can be used according to the invention, mention may be made of the bacteriocins listed in Table 8 below. below.

Table 8: Examples of class III bacteriocins Bacteriocins (peptides) Producers References Helvecitin J Lactobacillus helveticus 481 Joerger and Klaenhammer 1990 Millericin B 061 Streptococcus milleri NMSCC Beukes et al., 2000 Zoocin A Streptococcus zooepidermicus Simmonds et al., 1996 4881 * as they appear in the chapter "Bacteriocins of Lactic Bacteria" (Morisset et al.) of the book Lactic and Probiotic Bacteria, LUQUET François-Marie, CORRIEU Georges; ed. Lavoisier Class IV. Peptides requiring a carbohydrate or lipid portion to have activity. No bacteriocin of this class has been described. The bacteriocins used in the present invention can be produced by any suitable method known to those skilled in the art. They can be synthesized without difficulty by those skilled in the art using conventional techniques for peptide synthesis in solid phase or in solution (M. Bodanszky, Principles of Peptides Synthesis, 2nd ed., 1993, Springer-Verlag Edition). The bacteriocins used according to the invention can also be produced by microorganisms, using bioengineering methods. In this case, it may be necessary to extract and purify the peptide producing microorganisms, before formulation. In a preferred embodiment, the bacteriocins used according to the invention are synthetic peptides. The present invention relates to the use as a deodorant agent of a class II bacteriocin as defined above. According to a particular embodiment, the bacteriocin used is a class IIb bacteriocin. In particular, the subject of the invention is the use of at least one of the class IIb bacteriocins mentioned above, more particularly of a

Class Ilb bacteriocin selected from the group consisting of the bacteriocins listed in Table 4 or 6.

According to another particular embodiment, the bacteriocin used is a class IIc bacteriocin. In particular, the subject of the invention is the use of at least one of the class IIc bacteriocins mentioned above, more particularly a class IIc bacteriocin chosen from the group consisting of the bacteriocins listed in Table 4. or 7.

According to a preferred embodiment, the bacteriocin used is a class IIa bacteriocin. In particular, the subject of the invention is the use of at least one of the class IIa bacteriocins mentioned above, more particularly a Class Ila bacteriocin chosen from the group consisting of the bacteriocins listed in Table 4. or 5. In a particularly preferred embodiment, class IIa bacteriocin is selected from the group consisting of pediocin PA-1, sakacin A and sakacin P.

According to one particular embodiment, class IIa bacteriocin is used in combination with another class II bacteriocin, for example with another class IIa bacteriocin, or with class IIb and / or IIc bacteriocin.

According to a particular embodiment, class II bacteriocin, for example class IIa, IIb or IIc, preferably class IIa, is used in combination with a bacteriocin of another class, for example a class I bacteriocin and or a class III bacteriocin.

Thus, according to a first variant, the invention relates to the use of a class II bacteriocin, preferably of class IIa, in combination with a class I bacteriocin. The class I bacteriocin may in particular be chosen from those mentioned above. -above. In particular, class I bacteriocin may be selected from the group consisting of the bacteriocins listed in Tables 1, 2 and 3. According to a particular embodiment of this variant, the invention relates to the use of a class bacteriocin. It is selected from the group consisting of the bacteriocins listed in Table 4 or 5, in combination with a class I bacteriocin selected from the group consisting of the bacteriocins listed in Tables 1, 2 and 3.

According to another particular embodiment of this variant, the class IIa bacteriocin is selected from the group consisting of pediocin PA-1, sakacin A and sakacin P and class I bacteriocin is selected from the group consisting of nisin A, epidermin, salivaricin, plantaricin C and gallidermin.

According to a second variant, the invention relates to the use of a class II bacteriocin, preferably of class IIa, in association with a class III bacteriocin. According to a particular embodiment of this variant, the class IIa bacteriocin is selected from the group consisting of the bacteriocins listed in Table 4 or 5. According to another particular embodiment of this variant, class IIa bacteriocin is chosen from the group consisting of pediocin PA-1, sakacin A and sakacin P.

Another subject of the invention relates to the use as a deodorant agent of a class III bacteriocin as defined above. More specifically, the invention therefore relates to the use of a class III bacteriocin selected from the group consisting of helveticin J, enterolysin A, zoocin A and millericin B. The class III bacteriocin may also be used in combination with a class I or class II bacteriocin, preferably class IIa, as defined above.

The invention also relates to a cosmetic composition for the treatment of human body odors, in particular axillary bad odors, comprising, in a cosmetically acceptable medium, a class II bacteriocin, for example a class Ila, Ilb or Ilc bacteriocin, preferably a class IIa bacteriocin.

According to a particular embodiment, the composition according to the invention comprises a class IIa bacteriocin as defined above. In particular, the invention relates to a composition comprising, in a cosmetically acceptable medium, a class IIa bacteriocin selected from the group consisting of the bacteriocins listed in Table 4 or 5. According to a particular embodiment of this composition, the bacteriocin of class IIa is selected from the group consisting of pediocin PA-1, sakacin A and sakacin P.

In a particular embodiment, the composition according to the invention further comprises at least one class I or III bacteriocin. According to one variant, the composition according to the invention comprises the combination of a Class II bacteriocin, preferably a class IIa bacteriocin, in particular chosen from the group consisting of the bacteriocins listed in Table 4 or 5, with a bacteriocin. class I selected from the group consisting of the bacteriocins listed in Tables 1, 2 and 3. According to a particular embodiment of this variant, the class I bacteriocin is selected from the group consisting of nisin A, epidermin, salivaricin, plantaricin C and gallidermine. According to another embodiment, the composition according to the invention comprises: a class Ila bacteriocin selected from the group consisting of pediocin PA-1, sakacin A and sakacin P, and a class I bacteriocin selected from the group consisting of nisin A, epidermin, salivaricin, plantaricin C and gallidermine.

According to another embodiment, the composition according to the invention comprises a class IIa bacteriocin, in particular one of those described in Tables 4 and 5, in association with a class III bacteriocin.

The invention also relates to a cosmetic composition for the treatment of human body odor, especially axillary bad odors, comprising a class III bacteriocin in a cosmetically acceptable medium.

The class III bacteriocin may be combined in the composition with a class I or class II, preferably class IIa, bacteriocin as defined above. The class IIa bacteriocin is more particularly chosen from those described in Tables 4 and 5. According to one particular embodiment, the composition comprises a class III bacteriocin, in particular one of the four mentioned above, in association with a class IIa bacteriocin selected from the group consisting of pediocin PA-1, sakacin A and sakacin P. The class I bacteriocin may more particularly be selected from the group of bacteriocins described in Tables 1, 2 and 3. According to one particular embodiment, the composition comprises a class III bacteriocin, in particular one of the four mentioned above, in association with a class bacteriocin (selected from the group consisting of nisin A, epidermin, salivaricin, plantaricin C and gallidermine.

According to a particular embodiment, each bacteriocin present in the compositions according to the invention may be present at a concentration of between 0.0001% and 1% of active material relative to the composition.

The invention also relates to a cosmetic process for treating body odor, especially axillary odors, which consists in applying to the keratin materials a composition as described above. Preferably, the process according to the invention comprises the application of a composition comprising a class II, preferably class IIa, bacteriocin according to each of the embodiments and variants of this composition described above.

The use of bacteriocins in products intended in particular to combat C.xerosis, which is a Gram + bacterium, is a particular embodiment of the invention. Destroying or inhibiting odor-causing bacteria, particularly axillary odors, reduces and / or removes or prevents the development of body odor without destroying the ecosystem of the area treated. Those skilled in the art can adapt the intensity of the deodorant effect by selecting the most active bacteriocins against one or more germs responsible for bad body odor. GALENIC FORMS The compositions according to the invention may be independently in the form of suspension, dispersion, solution, gel or emulsions (in particular of liquid or semi-liquid, soft, semi-solid or solid consistency). ), especially oil-in-water (O / W), wax-in-water or water-in-oil (W / O), or multiple (W / O / E or polyol / H / E or O / W) emulsions. / H), in the form of cream, paste, foam, microemulsion, dispersion of vesicles, in particular of ionic or non-ionic lipids, wax / aqueous phase dispersions, biphase or multiphase lotion, paste, in particular soft paste. They may in particular be in the form of aqueous gels or aqueous or hydroalcoholic solutions.

The compositions according to the invention or used for the process according to the invention may be in the form of a protection, treatment or care composition for the face, for the hands or for the body (for example, day creams). , night cream, make-up remover, sunscreen composition, body protection or care milk, after-sun milks, lotion, gel or mousse for skin care); an aftershave composition.

They can also be used for makeup.

According to one embodiment, the compositions are compositions for coating the skin of the body or of the face, more particularly compositions for makeup or care of the skin of the body or of the face, such as, for example, foundations or hair compositions. body makeup.

Those skilled in the art may choose the appropriate dosage form, as well as its method of preparation, on the basis of its general knowledge, taking into account, on the one hand, the nature of the constituents used, in particular their solubility in the support, and on the other hand, the intended application for each composition.

The compositions may in particular be packaged in pressurized form in an aerosol device or in a pump bottle; packaged in a device provided with a perforated wall including a grid; packaged in a device provided with a ball-on applicator; packaged in the form of sticks (sticks), in the form of loose or compacted powder; or else applied on wipes. The compositions may also be in the form of soaps or gels (rinsed or not rinsed). They contain in this respect the ingredients generally used in this type of products and well known to those skilled in the art.

According to another particular form of the invention, the compositions according to the invention can be anhydrous. An anhydrous composition according to the invention may especially be in the form of a stick, a cream, a soft-solid or an aerosol.

By anhydrous composition is meant a composition containing less than 2% by weight of water, or even less than 0.5% of water, and especially free of water, the water not being added during the preparation of the composition but corresponding to the residual water provided by the mixed ingredients.

According to another particular form of the invention, in the context of the deodorant application, the compositions according to the invention may be in the form of solid compositions, in particular in the form of a stick or a stick.

By "solid composition" it is meant that the measurement of the maximum force measured in texturometry during the insertion of a probe into the sample of formula must be at least 0.25 Newton, in particular at least equal to 0.30 Newton, especially at least 0.35 Newton, appreciated under precise measurement conditions as follows.

The formulas are poured hot in pots 4 cm in diameter and 3 cm deep. Cooling is done at room temperature. The hardness of the formulas is measured after 24 hours of waiting. The pots containing the samples are characterized in texturometry using a texturometer such as that marketed by Rhéo TA-XT2, according to the following protocol: a ball-type stainless steel probe of diameter 5 mm is brought into contact with the sample at a speed of 1 mm / s. The measurement system detects the interface with the sample with a detection threshold equal to 0.005 newtons. The probe sinks 0.3 mm into the sample at a rate of 0.1 mm / s. The meter records the evolution of the force measured in compression over time, during the penetration phase. The hardness of the sample corresponds to the average of the maximum values of the force detected during the penetration, on at least 3 measurements.

AQUEOUS PHASE The composition according to the invention may be aqueous. In this context, the composition preferably has a pH of between 3 and 9, depending on the support chosen.

The compositions according to the invention intended for cosmetic use may comprise at least one aqueous phase. They are in particular formulated in aqueous lotions or in water-in-oil, oil-in-water or multiple emulsion emulsions (triple oil-in-water-in-oil or water-in-oil-in-water emulsion). such emulsions are known and described for example by C. FOX in "Cosmetics and Toiletries" - november 1986 - Vol 101 - pages 101-112) The aqueous phase of said compositions contains water and in general other solvents The solvents which are soluble or miscible with water include short-chain monohydric alcohols, for example C 1 -C 4 alcohols, such as ethanol, isopropanol, diols or polyols, for instance ethylene glycol, 1,2-propylene glycol, 1,3-butylene glycol, hexylene glycol, diethylene glycol, dipropylene glycol, 2-ethoxyethanol, diethylene glycol monomethyl ether, triethylene glycol monomethyl ether and sorbitol, more particularly propylene glycol will be used. and glycerine, propane 1.3 diol.

25 EMULSIFIERS

a) Oil-in-water emulsifiers

Examples of emulsifiers that can be used in oil-in-water emulsions or oil-in-water-in-oil triple emulsions include nonionic emulsifiers such as oxyalkylenated fatty acid and glycerol esters (more particularly polyoxyethylenated); oxyalkylenated fatty acid and sorbitan esters; oxyalkylenated fatty acid esters (oxyethylenated and / or oxypropylenated); oxyalkylenated fatty alcohol ethers (oxyethylenated and / or oxypropylenated); sugar esters such as sucrose stearate; and mixtures thereof such as the mixture of glyceryl stearate and PEG-40 stearate.

Mention may also be made of the fatty alcohol / alkylpolyglycoside emulsifying mixtures as described in applications WO92 / 06778, WO95 / 13863 and WO98 / 47610, such as the commercial products sold by the company SEPPIC under the name MONTANOV®. (b) Water-in-oil emulsifiers

Among the emulsifiers that can be used in water-in-oil emulsions or triple water-in-oil-in-water-in-oil emulsions or triple emulsions, mention may be made by way of example of alkyl dimethicone copolyols corresponding to the formula (I) below CH 3 CH 3 CH 3 CH 3 Si-O-Si -CH 3 (1) Si CH 3 - Li CH 3 R 1 R CH 3 - a 2 b in which: R 1 denotes a linear or branched C 12 -C 20 alkyl group and preferably C12-C18; R2 denotes the group: - CnH2n - (- OC2H4-) x - (- OC3H6-) y - O-R3, R3 denotes a hydrogen atom or a linear or branched alkyl radical containing from 1 to 12 atoms of carbon; a is an integer from 1 to about 500; b is an integer from 1 to about 500; n is an integer from 2 to 12 and preferably 2 to 5; x denotes an integer ranging from 1 to about 50 and preferably from 1 to 30; y denotes an integer ranging from 0 to about 49 and preferably 0 to 29 provided that when y is different from zero the ratio x / y is greater than 1 and preferably varies from 2 to 11.

Among the preferred alkyldimethicone copolyol emulsifiers of formula (I), there will be mentioned more particularly CETYL PEG / PPG-10/1 DIMETHICONE and more particularly the mixture CETYL PEG / PPG-10/1 DIMETICONE AND DIMETHICONE (INCI name) as the product sold under the trade name ABIL EM90 by GOLDSCHMIDT or the mixture (POLYGLYCERYL-4- STEARATE and CETYL PEG / PPG-10 (AND) DIMETHICONE (AND) HEXYL LAURATE) as the product sold under the trade name ABIL WE09 by the same society.

Among the water-in-oil emulsifiers, mention may also be made of dimethicone copolyols corresponding to the following formula (II) CH 3 CH 3 CH 3 Si-O R 4 CH 3

## STR5 ## where R 4 denotes the group: ## STR2 ## wherein R 5 denotes a hydrogen atom or an alkyl radical; linear or branched having from 1 to 12 carbon atoms; c is an integer ranging from 1 to about 500 d denotes an integer ranging from 1 to about 500, m is an integer ranging from 2 to 12 and preferably 2 to 5, s denotes an integer ranging from 1 to about 50, and preferably from 1 to 30; t denotes an integer ranging from 0 to about 50 and preferably from 0 to 30; provided that the sum s + t is greater than or equal to 1.

Among these emulsifiers dimethicone copolyols of formula (II) preferential use is particularly PEG-18IPPG-18 DIMETHICONE and more particularly the mixture CYCLOPENTASILOXANE (and) PEG-18IPPG-18 DIMETHICONE (INCI name) such as the product sold by Dow Corning under the trade name Silicone DC 5225 C or KF-6040 from Shin Etsu.

According to a particularly preferred form, use will be made of a mixture of at least one emulsifier of formula (I) and at least one emulsifier of formula (II).

More particularly, a mixture of PEG-18IPPG-18 Dimethicone and Cetyl PEG / PPG-10/1 DIMETHICONE and even more particularly a mixture of (CYCLOPENTASILOXANE (and) PEG-18IPPG-18 Dimethicone) and Cetyl PEG / PPG-10 will be used more particularly. DIMETICONE and Dimethicone or (Polyglyceryl-4-stearate and Cetyl PEGIPPG-10 (and) Dimethicone (and) Hexyl Laurate).

Among the water-in-oil emulsifiers, mention may also be made of nonionic emulsifiers derived from fatty acid and polyol, alkylpolyglycosides (APG), sugar esters and mixtures thereof.

As nonionic emulsifiers derived from fatty acid and polyol, it is possible in particular to use the fatty acid and polyol esters, the fatty acid having in particular a C 8 -C 24 alkyl chain, and the polyols being, for example, glycerol and sorbitan.

Examples of fatty acid and polyol esters that may be mentioned include esters of isostearic acid and of polyols, esters of stearic acid and of polyols, and mixtures thereof, in particular esters of isostearic acid and of glycerol, and / or sorbitan.

As esters of stearic acid and of polyols, mention may in particular be made of polyethylene glycol esters such as PEG-30 dipolyhydroxystearate, such as the product sold under the name Arlacel P135 by the company ICI.

Examples of glycerol and / or sorbitan esters that may be mentioned are polyglycerol isostearate, such as the product sold under the name Isolan GI 34 by the company Goldschmidt; sorbitan isostearate, such as the product sold under the name Arlacel 987 by the company ICI; sorbitan isostearate and glycerol, such as the product sold under the name Arlacel 986 by the company ICI, the mixture of sorbitan isostearate and polyglycerol isostearate (3 moles) sold under the name Arlacel 1690 by the Unigema company. and their mixtures.

The emulsifier may also be chosen from alkylpolyglycosides having an HLB of less than 7, for example those represented by the following general formula (1):

RO - (G) x (1) wherein R represents a branched and / or unsaturated alkyl radical having from 14 to 24 carbon atoms, G represents a reduced sugar containing from 5 to 6 carbon atoms, and x denotes a value ranging from 1 to 10 and preferably from 1 to 4, and G particularly denotes glucose, fructose or galactose.

The unsaturated alkyl radical may comprise one or more ethylenic unsaturations, and in particular one or two ethylenic unsaturations.

As alkylpolyglycosides of this type, mention may be made of alkylpolyglucosides (G = glucose in formula (I)), and in particular the compounds of formula (I) in which R represents more particularly an oleyl radical (unsaturated C18 radical) or isostearyl radical ( saturated C18 radical), G denotes glucose, x is a value ranging from 1 to 2, especially isostearyl glucoside, oleyl glucoside and mixtures thereof. This alkylpolyglucoside may be used in admixture with a co-emulsifier, more particularly with a fatty alcohol and in particular a fatty alcohol having the same fatty chain as that of the alkylpolyglucoside, that is to say comprising from 14 to 24 carbon atoms. carbon and having a branched and / or unsaturated chain, and for example isostearyl alcohol when the alkylpolyglucoside is isostearylglucoside, and oleyl alcohol when the alkylpolyglucoside is oleylglucoside, optionally in the form of a self-emulsifying composition, as described for example in WO-A-92/06778. For example, the mixture of isostearyl glucoside and isostearyl alcohol sold under the name Montanov WO 18 by the company SEPPIC and the mixture octyldodecanol and octyldodecylxyloside sold under the name FLUDANOV 20X by the company SEPPIC may be used.

Mention may also be made of succinic-terminated polyolefins, such as ester-terminated polyisobutylenes and their salts, in particular diethanolamine salts, such as the products sold under the names Lubrizol 2724, Lubrizol 2722 and Lubrizol 5603 by the company Lubrizol, or the product CHEMCINNATE 2000.

The total amount of emulsifiers in the composition will preferably be in the composition according to the invention at contents of active material ranging from 1 to 8% by weight and more particularly from 2 to 6% by weight relative to the total weight of the composition. .

FATTY PHASE The non-rinsed compositions according to the invention may contain at least one immiscible organic liquid phase in water called the fatty phase. This generally comprises one or more hydrophobic compounds which render said phase immiscible in water. Said phase is liquid (in the absence of structuring agent) at ambient temperature (20-25 ° C.). Preferably, the organic liquid immiscible organic phase in accordance with the invention is generally constituted generally comprises at least one volatile oil and / or a non-volatile oil and optionally at least one structuring agent.

The term "oil" means a fatty substance which is liquid at ambient temperature (25 ° C.) and at atmospheric pressure (760 mmHg, ie 105 Pa). The oil can be volatile or non-volatile.

For the purposes of the invention, the term "volatile oil" means an oil capable of evaporating on contact with the skin or keratin fiber in less than one hour at ambient temperature and atmospheric pressure. The volatile oils of the invention are volatile cosmetic oils which are liquid at ambient temperature and have a non-zero vapor pressure at ambient temperature and atmospheric pressure, in particular ranging from 0.13 Pa to 40,000 Pa (10-3 to 300 mmHg), in particular ranging from 1.3 Pa to 13 000 Pa (0.01 to 100 mmHg), and more particularly ranging from 1.3 Pa to 1300 Pa (0.01 to 10 mmHg). ).

By "non-volatile oil" is meant an oil remaining on the skin or the keratinous fiber at room temperature and atmospheric pressure for at least several hours and in particular having a vapor pressure of less than 10 -3 mmHg (0.13 Pa). .

The oil may be chosen from all physiologically acceptable and in particular cosmetically acceptable oils, in particular mineral, animal, vegetable, and synthetic oils; in particular volatile and / or nonvolatile hydrocarbon and / or silicone and / or fluorinated oils and mixtures thereof.

More precisely, the term "hydrocarbon-based oil" means an oil comprising mainly carbon and hydrogen atoms and optionally one or more functional groups chosen from hydroxyl, ester, ether and carboxylic functions. Generally, the oil has a viscosity of 0.5 to 100,000 mPa.s, preferably 50 to 50,000 mPa.s and more preferably 100 to 300,000 mPa.s.

By way of example of volatile oil that may be used in the invention, mention may be made of: volatile hydrocarbon oils chosen from hydrocarbon-based oils having 8 to 16 carbon atoms, and in particular C8-C16 isoalkanes of petroleum origin (Also called isoparaffins) such as isododecane (also called 2,2,4,4,6-pentamethylheptane), isodecane, isohexadecane, and for example the oils sold under the trade names of Isopars or permetyls, branched C8-C16 esters, isohexyl neopentanoate, and mixtures thereof. Other volatile hydrocarbon oils such as petroleum distillates, in particular those sold under the name Shell or by Shell, may also be used; volatile linear alkanes such as those described in the patent application of Cognis DE10 2008 012 457. volatile silicones, such as, for example, volatile linear or cyclic silicone oils, in particular those having a viscosity of 8 centistokes (8 10-6 m2 / s), and having in particular from 2 to 7 silicon atoms, these silicones optionally comprising alkyl or alkoxy groups having from 1 to 10 carbon atoms. As volatile silicone oil that can be used in the invention, there may be mentioned in particular octamethylcyclotetrasiloxane, decamethylcyclopentasiloxane, dodecamethylcyclohexasiloxane, heptamethylhexyltrisiloxane, heptamethyloctyltrisiloxane, hexamethylisiloxane, octamethyltrisiloxane and decamethyl tetrasiloxane, dodecamethylpentasiloxane and mixtures thereof.

It is also possible to mention volatile alkyltrisiloxane linear oils of general formula (I): ## STR1 ## where R represents an alkyl group comprising from 2 to 4 carbon atoms. carbon and one or more hydrogen atoms may be substituted by a fluorine or chlorine atom.

Among the oils of general formula (I), mention may be made of: 3-butyl 1,1,1,3,5,5,5-heptamethyltrisiloxane, 3-propyl 1,1,1,3,5,5 , 5-heptamethyltrisiloxane, and 3-ethyl-1,1,1,3,5,5,5-heptamethyltrisiloxane, corresponding to the oils of formula (I) for which R is respectively a butyl group, a propyl group or an ethyl group.

As an example of a non-volatile oil that may be used in the invention, mention may be made of: hydrocarbon-based oils of animal origin, such as perhydrosqualene; vegetable hydrocarbon-based oils such as liquid triglycerides of fatty acids with 4 to 24 carbon atoms, for instance triglycerides of heptanoic or octanoic acids or oils, wheat germ oils, olive oil and almond oil sweet, palm, colza, cotton, alfalfa, poppy, pumpkin, squash, black currant, evening primrose, millet, barley, quinoa, rye, safflower, bancoulier, passionflower, muscat rose, sunflower, maize, soya, squash, grape seed, sesame, hazelnut, apricot, macadamia, castor oil, avocado, caprylic / capric acid triglycerides as those sold by the company Stearineries Dubois or those sold under the names Miglyol 810, 812 and 818 by the company Dynamit Nobel, jojoba oil, shea butter; linear or branched hydrocarbons of mineral or synthetic origin, such as paraffin oils and their derivatives, petroleum jelly, polydecenes, polybutenes, hydrogenated polyisobutene such as Parleam or squalane; synthetic ethers having from 10 to 40 carbon atoms; synthetic esters, especially of fatty acids, such as the oils of formula R1000R2 in which R1 represents the residue of a linear or branched higher fatty acid containing from 1 to 40 carbon atoms, and R2 represents a hydrocarbon chain, in particular branched, containing 1 at 40 carbon atoms with RI + R2 such as for example purcellin oil (cetostearyl octanoate), isononyl isononanoate, isopropyl myristate, isopropyl palmitate, 012 alcohol benzoate C15, hexyl laurate, diisopropyl adipate, isononyl isononanoate, ethyl 2-hexyl palmitate, octyl 2-dodecyl stearate, octyl 2-dodecyl erucate, isostearyl isostearate, tridecyl trimellitate; octanoates, decanoates or ricinoleates of alcohols or polyalcohols such as propylene glycol dioctanoate; hydroxylated esters such as isostearyl lactate, octyl hydroxy stearate, octyl dodecyl hydroxystearate, diisostearyl malate, triisocetyl citrate, heptanoates, octanoates, decanoates of fatty alcohols; polyol esters such as propylene glycol dioctanoate, neopentyl glycol diheptanoate, diethylene glycol diisononanoate; and pentaerythritol esters such as pentaerythritol tetraisostearate; branched-chain and / or unsaturated carbon-chain liquid fatty alcohols having from 12 to 26 carbon atoms, such as octyl dodecanol, isostearyl alcohol, 2-butyloctanol, 2-hexyl decanol and 2-undecyl; pentadecanol, oleic alcohol; higher fatty acids such as oleic acid, linoleic acid, linolenic acid; - carbonates; - acetates; - citrates; fluorinated oils which may be partially hydrocarbon-based and / or silicone-based, such as fluorosilicone oils, fluorinated polyethers or fluorinated silicones, as described in document EP-A-847752; silicone oils, such as non-volatile, linear or cyclic polydimethylsiloxanes (PDMS); polydimethylsiloxanes comprising alkyl, alkoxy or phenyl groups, during or at the end of the silicone chain, groups having from 2 to 24 carbon atoms; phenyl silicones such as phenyl trimethicones, phenyl dimethicones, phenyl trimethylsiloxy diphenyl siloxanes, diphenyl dimethicones, diphenyl methyldiphenyl trisiloxanes, 2-phenylethyl trimethylsiloxysilicates, and mixtures thereof.

20 STRUCTURING AGENT

The non-rinsed compositions according to the invention comprising a fatty phase may additionally contain at least one structuring agent of said fatty phase, which may preferably be chosen from waxes, pasty compounds, mineral or organic lipophilic gelling agents and mixtures thereof.

It is understood that the amount of these compounds can be adjusted by those skilled in the art so as not to damage the desired effect in the context of the present invention. Wax (s) The wax is generally a lipophilic compound, solid at room temperature (25 ° C.), with reversible solid / liquid state change, having a melting point greater than or equal to 30 ° C. go up to 200 ° C and in particular up to 120 ° C. In particular, the waxes that are suitable for the invention may have a melting point greater than or equal to 45 ° C., and in particular greater than or equal to 55 ° C.

For the purposes of the invention, the melting temperature corresponds to the temperature of the most endothermic peak 10 observed in thermal analysis (DSC) as described in the ISO 11357-3 standard; 1999. The melting point of the wax can be measured using a differential scanning calorimeter (DSC), for example the calorimeter sold under the name "MDSC 2920" by the company TA Instruments.

The measurement protocol is as follows:

A sample of 5 mg of wax placed in a crucible is subjected to a first temperature rise from -20 ° C. to 100 ° C., at the heating rate of 10 ° C./min, and is then cooled from 100 ° C. to -20 ° C at a cooling rate of 10 ° C / minute and finally subjected to a second temperature rise from -20 ° C to 100 ° C at a heating rate of 5 ° C / minute. During the second temperature rise, the variation of the power difference absorbed by the empty crucible and the crucible containing the wax sample as a function of temperature is measured. The melting point of the compound is the value of the temperature corresponding to the peak apex of the curve representing the variation of the difference in power absorbed as a function of temperature.

The waxes that may be used in the compositions according to the invention are chosen from solid waxes at room temperature of animal, vegetable, mineral or synthetic origin and mixtures thereof.

Illustrative waxes suitable for the invention include hydrocarbon waxes such as beeswax, lanolin wax, and China's insect waxes, rice bran wax, Carnauba wax. Candellila wax, Ouricury wax, Alfa wax, berry wax, shellac wax, Japanese wax and sumac wax; montan wax, orange and lemon waxes, refined sunflower wax marketed under the name SUNFLOWER WAX by KOSTER KEUNEN, microcrystalline waxes, paraffins and ozokerite; polyethylene waxes, waxes obtained by Fisher-Tropsch synthesis and waxy copolymers and their esters.

There may also be mentioned waxes obtained by catalytic hydrogenation of animal or vegetable oils having linear or branched C8-C32 fatty chains. Among these, there may be mentioned isomerized jojoba oil such as trans isomerized partially hydrogenated jojoba oil manufactured or marketed by Desert Whale under the trade reference Iso-Jojoba-50®, sunflower oil hydrogenated castor oil, hydrogenated coconut oil, hydrogenated lanolin oil, and di- (1,1,1-trimethylolpropane) tetrastearate sold under the name Hest 2T-4S® by the company HETERENE.

Mention may also be made of silicone waxes (C30-45 ALKYL DIMETHICONE) and fluorinated waxes.

It is also possible to use the waxes obtained by hydrogenation of castor oil esterified with cetyl alcohol sold under the names Phytowax Ricin 16L64® and 22L73® by the company SOPHIM. Such waxes are described in application FR-A-2792190.

As the wax, a C20-C40 alkyl (hydroxystearyloxy) stearate (the alkyl group comprising from 20 to 40 carbon atoms), alone or in admixture, can be used.

Such a wax is especially sold under the names "Kester Wax K 82 P®", "Hydroxypolyester K 82 P®" and "Kester Wax K 80 P®" by the company Koster Keunen. As micro-waxes that can be used in the compositions according to the invention, mention may be made in particular of carnauba micro-waxes such as that marketed under the name MicroCare 350® by the company Micro Powders, synthetic wax wax micro-waxes such as that sold under the name MicroEase 114S® by MICRO POWDERS, micro waxes consisting of a mixture of carnauba wax and polyethylene wax such as those marketed under the names of Micro Care 300® and 310® by the company MICRO POWDERS, micro waxes consisting of a mixture of carnauba wax and synthetic wax such as that sold under the name Micro Care 325® by MICRO POWDERS, polyethylene micro-waxes such as those sold under the names Micropoly. 200®, 220®, 220L® and 250S® by MICRO POWDERS, commercial products PERFOMALEN 400 POLYETHYLENE and PERFORMALENE 500-L POLYETHYLENE from NEW PHASE TECHNOLOGIES, PERFORMALENE 655 POLYETHYLENE or paraffin waxes such as wax having the name INCI, MICROCRYSTALLINE WAX and SYNTHETIC WAX and sold under the trade name MICROLEASE by the company SOCHIBO .; polytetrafluoroethylene micro waxes such as those sold under the names Microslip 519® and 519 L® by the company Micro Powders.

The composition according to the invention will preferably comprise a wax content (s) ranging from 3% to 20% by weight relative to the total weight of the composition, in particular from 5% to 15%, more particularly from 6% to 15%.

According to one particular form of the invention, in the context of the anhydrous solid compositions in the form of a stick, use will be made of polyethylene micro-waxes in the form of shape-factor crystallites of at least 2 having a melting point of 70.degree. at 110 ° C and preferably 70 to 100 ° C, in order to reduce or eliminate the presence of layers in the solid composition, These needle crystallites and in particular their dimensions can be characterized visually according to the following method.

The wax is deposited on a microscope slide, which is placed on a hot plate. The blade and the wax are heated to a temperature generally at least 5 ° C higher than that of the melting point of the wax or wax mixture considered (e). At the end of the melting, the liquid thus obtained and the microscope slide are allowed to cool to solidify. The observation of the crystallites is carried out using a Leica DMLB100 type optical microscope, with a target selected according to the size of the objects to be viewed, and in polarized light. The dimensions of the crystallites are measured using an image analysis software such as those marketed by Microvision.

The crystallite polyethylene waxes according to the invention preferably have an average length ranging from 5 to 10 μm. By "average length" is meant the dimension given by the statistical size distribution at half of the population, called D50. A mixture of waxes PERFOMALEN 400 POLYETHYLENE and PERFORMALENE 500-L POLYETHYLENE from NEW PHASE TECHNOLOGIES will be used more particularly.

20 Paste compounds

For the purposes of the present invention, the term "pasty compound" is intended to mean a lipophilic fat compound with a reversible solid / liquid state change, having in the solid state an anisotropic crystalline organization, and comprising at a temperature of 23.degree. liquid fraction and a solid fraction.

The pasty compound is preferably chosen from synthetic compounds and compounds of plant origin. A pasty compound can be obtained synthetically from starting materials of plant origin. The pasty compound may advantageously be chosen from: lanolin and its derivatives, silicone compounds which may or may not be polymeric, fluorinated compounds which are polymeric or non-polymeric, vinyl polymers, in particular: homopolymers of olefins, copolymers of olefins, - homopolymers and copolymers of hydrogenated dienes, - linear or branched oligomers, homo or copolymers of alkyl (meth) acrylates preferably having a C8-C30 alkyl group, - homo and copolymer oligomers of esters vinyls having C8-C30 alkyl groups; and homo- and copolymer oligomers of vinyl ethers having C8-C30 alkyl groups; liposoluble polyethers resulting from polyetherification between one or more C2-C100 diols, preferably C2-C10 diols; -050, - the esters, - their mixtures.

Among the esters, the following are particularly preferred: esters of an oligomeric glycerol, in particular the esters of diglycerol, in particular the condensates of adipic acid and of glycerol, for which part of the hydroxyl groups of the glycerols have reacted with a mixture of fatty acids such as stearic acid, capric acid, stearic acid and isostearic acid and 12-hydroxystearic acid, such as those marketed under the trademark Softisan 649 by the company Sasol, arachidyl propionate sold under the name Waxenol 801 by Alzo; phytosterol esters; triglycerides of fatty acids and their derivatives; pentaerythritol esters; non-crosslinked polyesters resulting from the polycondensation between a dicarboxylic acid or a polycarboxylic acid linear or branched C4-O50 and a diol or a C2-050 polyol, - ester aliphatic esters resulting from the esterification of a hydroxy acid ester aliphatic carboxylic acid with an aliphatic carboxylic acid, - the polyesters resulting from the esterification, by a polycarboxylic acid, of an aliphatic hydroxy carboxylic acid ester, said ester comprising at least two hydroxyl groups such as Risocast DA-H ® products and Risocast DA-L ®, the esters of diol dimer and diacid dimer, if appropriate, esterified on their (their) function (s) alcohol (s) or acid (s) free (s) by acid radicals or alcohols such as Plandool-G, - their mixtures.

Among the pasty compounds of plant origin, a mixture of soy sterols and oxyethylenated (5OE) oxypropylene pentaerythritol (5 PO), marketed under the reference Lanolide by the company VEVY, will preferably be chosen.

Lipophilic gelling agents Mineral gelling agents

As inorganic lipophilic gelling agents, there may be mentioned optionally modified clays, such as hectorites modified with a C10 to C22 ammonium chloride, such as hectorite modified with di-stearyl-dimethyl ammonium chloride such as, for example, sold under the name Bentone 38V® by the company ELEMENTIS.

It is also possible to mention the optionally hydrophobic fumed silica surface with a particle size of less than 1 μm. It is indeed possible to chemically modify the surface of the silica, by chemical reaction generating a decrease in the number of silanol groups present on the surface of the silica. In particular, it is possible to substitute silanol groups with hydrophobic groups: a hydrophobic silica is then obtained. The hydrophobic groups may be trimethylsiloxyl groups, which are especially obtained by treatment of fumed silica in the presence of hexamethyldisilazane. Silicas thus treated are called "Silica silylate" according to the CTFA (8th edition, 2000). They are for example sold under the references Aerosil R812® by the company Degussa, Cab-O-Sil TS-530® by the company Cabot, dimethylsilyloxyl or polydimethylsiloxane groups, which are especially obtained by treatment of fumed silica in the presence of polydimethylsiloxane or dimethyldichlorosilane. Silicas thus treated are called "Silica dimethyl silylate" according to the CTFA (8th edition, 2000). They are for example marketed under the references Aerosil R972®, and Aerosil R974® by the company DEGUSSA, CAB-O-SIL TS-610® and CAB-O-SIL TS-720® by CABOT.

The hydrophobic fumed silica has in particular a particle size that can be nanometric to micrometric, for example ranging from about 5 to 200 nm.

Organic gelling agents

Polymeric organic lipophilic gelling agents are, for example, partially or fully crosslinked elastomeric organopolysiloxanes of three-dimensional structure, such as those marketed under the names KSG6®, KSG16® and KSG18® by the company SHIN-ETSU, by Trefil E-505C®. and Trefil E-506C® by DOW-CORNING, Gransil SR-CYC®, SR DMF10®, SR-DC556®, SR 5CYC gel®, SR DMF 10 gel® and SR DC 556 gel® by the company 20 GRANT INDUSTRIES, SF 1204® and JK 113® by the company GENERAL ELECTRIC; ethylcellulose such as that sold under the name Ethocel® by Dow Chemical; galactomannans having from one to six, and in particular from two to four, hydroxyl groups per sac, substituted with a saturated or unsaturated alkyl chain, such as guar gum alkylated with C1-C6 alkyl chains, and in particular with C1 to C3 and mixtures thereof. Block copolymers of the "diblock", "triblock" or "radial" type of the polystyrene / polyisoprene, polystyrene / polybutadiene type, such as those sold under the name Luvitol HSB® by the company BASF, of the polystyrene / copoly (ethylene-propylene) type such as those sold under the name Kraton® by Shell Chemical Co., or else the polystyrene / copoly (ethylene-butylene) type, mixtures of triblock and radial (star) copolymers in isododecane, such as those marketed by the company PENRECO under the name Versagel® such as, for example, the mixture of butylene / ethylene / styrene triblock copolymer and ethylene / propylene / styrene star copolymer in isododecane (Versagel M 5960).

Lipophilic gelling agents that may also be mentioned include polymers having a weight average molecular weight of less than 100,000, comprising a) a polymer backbone having hydrocarbon-based repeating units provided with at least one heteroatom, and optionally b) at least one fatty chain. pendant and / or at least one optionally functionalized terminal fatty chain having from 6 to 120 carbon atoms and being bonded to these hydrocarbon units, as described in applications WO-A-02/056847, WO-A-02/47619 whose content is incorporated by reference; in particular polyamide resins (especially comprising alkyl groups having from 12 to 22 carbon atoms) such as those described in US-A-5783657 whose contents are incorporated by reference.

Among the lipophilic gelling agents that can be used in the compositions according to the invention, mention may also be made of dextrin and fatty acid esters, such as dextrin palmitates, in particular such as those sold under the names Rheopearl TL® or Rheopearl KL. ® by the company CHIBA FLOUR. It is also possible to use silicone polyamides of the polyorganosiloxane type such as those described in US-A-5,874,069, US-A-5,919,441, US-A-6,051,216 and US-A-5,981,680.

These silicone polymers may belong to the following two families: polyorganosiloxanes comprising at least two groups capable of establishing hydrogen interactions, these two groups being located in the polymer chain, and / or polyorganosiloxanes comprising at least two groups capable of establish hydrogen interactions, these two groups being located on grafts or branches.

ANTI-TRANSPIRING SALTS OR COMPLEXES According to one particular form of the invention, the compositions of the invention may contain at least one salt or antiperspirant complex.

By "sweat-treating agent" is meant any substance which, by itself, has the effect of diminishing the sensation on the skin of moisture associated with human sweat, of masking human sweat.

The antiperspirant salts or complexes in accordance with the invention are generally chosen from aluminum or zirconium salts or complexes. They are preferably chosen from aluminum halohydrates; aluminum and zirconium halohydrates, complexes of zirconium hydroxychloride and of aluminum hydroxychloride with or without an amino acid such as those described in patent US-3792068.

Among the aluminum salts, mention may in particular be made of aluminum chlorohydrate in activated or non-activated form, aluminum chlorohydrex, chlorohydrex polyethylene glycol aluminum complex, aluminum chlorohydrexpropyleneglycol complex, aluminum dichlorohydrate, aluminum dichlorohydrex complex polyethylene glycol, aluminum complex dichlorohydrex propylene glycol, sesquichlorohydrate aluminum, sesquichlorohydrex aluminum polyethylene glycol complex, sesquichlorohydrex propylene glycol aluminum complex, aluminum sulphate buffered with sodium aluminum lactate.

Among the aluminum and zirconium salts, there may be mentioned in particular aluminum zirconium octachlorohydrate, aluminum zirconium pentachlorohydrate, aluminum zirconium tetrachlorohydrate, aluminum zirconium trichlorohydrate.

The complexes of zirconium hydroxychloride and aluminum hydroxychloride with an amino acid are generally known under the name ZAG (when the amino acid is glycine). Among these products, mention may be made of aluminum complexes of zirconium octachlorohydrex glycine, aluminum zirconium pentachlorohydrex glycine, aluminum zirconium tetrachlorohydrex glycine and aluminum zirconium trichlorohydrex glycine.

The antiperspirant salts or complexes may be present in the composition according to the invention in a proportion of approximately 0.5 to 25% by weight relative to the total weight of the composition.

DEODORANT ASSETS

The compositions according to the invention may also contain one or more additional deodorant active agents.

Deodorant active means any substance capable of masking, absorbing, improving and / or reducing the unpleasant odor resulting from the decomposition of human sweat by bacteria

The deodorant active agents may be bacteriostatic agents or bactericidal agents acting on the germs of axillary odors, such as 2,4,4'-trichloro-2'-hydroxydiphenyl ether (®Triclosan), 2,4-dichloro-2 ' 3-hydroxydiphenyl ether, 3 ', 4', 5'-trichlorosalicylanilide, 1- (3 ', 4'-dichlorophenyl) -3- (4'-chlorophenyl) urea (®Triclocarban) or 3,7,11-trimethyldodeca -2,5,10-trienol (®Farnesol); quaternary ammonium salts such as cetyltrimethylammonium salts, cetylpyridinium salts, DPTA (1,3-diaminopropanetraacetic acid), 1,2 decanediol (SYMCLARIOL from Symrise), glycerol derivatives, for example Caprylic / Capric Glycerides (CAPMUL MCM from Abitec), Caprylate or Glycerol caprate (DERMOSOFT GMCY and DERMOSOFT GMC respectively from 25 STRAETMANS), Polyglyceryl-2 Caprate (DERMOSOFT DG ™ from STRAETMANS) Biguanide derivatives such as polyhexamethylene biguanide salts chlorhexidine and its salts; 4-Phenyl-4,4-dimethyl-2-butanol (SYMDEO MPP from Symrise).

Among the deodorant active agents according to the invention, mention may also be made of zinc salts such as zinc salicylate, zinc gluconate and zinc pidolate; zinc sulphate, zinc chloride, zinc lactate, zinc phenolsulfonate; zinc ricinoleate 10 - sodium bicarbonate; salicylic acid and its derivatives such as n-octanoyl-5-salicylic acid - silver zeolites or without silver - alum. The deodorant active agents may preferably be present in the compositions according to the invention in weight concentrations ranging from 0.01 to 5% by weight relative to the total weight of the composition.

10 SUSPENSION AGENTS

In order to improve the homogeneity of the product, it is also possible to use one or more suspending agents which are preferably chosen from hydrophobic modified montmorillonite clays, such as hydrophobic modified bentonites or hectorites. Mention may be made, for example, of the product Stearalkonium Bentonite (CTFA name) (reaction product of bentonite and quaternary ammonium chloride stearalkonium chloride), such as the commercial product sold under the name Tixogel MP 250 by the company Sud Chemie Rheologicals, United Catalysts Inc. or the product Disteardimonium Hectorite (CTFA name) (reaction product of hectorite and distearyldimium chloride) sold under the name Bentone 38 or Bentone Gel by Elementis Specialties.

The suspending agents are preferably present in amounts ranging from 0.1 to 5% by weight and more preferably from 0.2 to 2% by weight relative to the total weight of the composition.

ORGANIC POWDER

According to one particular form of the invention, the compositions according to the invention will additionally contain an organic powder.

As used herein, the term "organic powder" means any solid that is insoluble in the medium at room temperature (25 ° C.). As organic powders that can be used in the composition of the invention, mention may be made, for example, of polyamide particles and in particular those sold under the names ORGASOL by the company Atochem; polyethylene powders; microspheres based on acrylic copolymers, such as those made of ethylene glycol dimethacrylate / lauryl methacrylate copolymer sold by Dow Corning under the name Polytrap; polymethyl methacrylate microspheres, sold under the name MICROSPHERE M-100 by the company Matsumoto or under the name COVABEAD LH85 by the company Wackherr; hollow polymethyl methacrylate microspheres (particle size: 6.5-10.5 μ) sold under the name Ganzpearl GMP 0800 by Ganz Chemical; Methyl methacrylate / ethylene glycol dimethacrylate copolymer microbeads (size: 6.5-10.5 μ) sold under the name Ganzpearl GMP 0820 by Ganz Chemical or Microsponge 5640 by the company Amcol Health & Beauty Solutions; ethylene-acrylate copolymer powders, such as those sold under the name FLOBEADS by Sumitomo Seika Chemicals; expanded powders such as hollow microspheres and in particular microspheres formed of a terpolymer of vinylidene chloride, acrylonitrile and methacrylate and sold under the name EXPANCEL by the company Kemanord Plast under the references 551 DE 12 (particle size distribution). about 12 μm and density 40 kg / m 3), 551 DE (particle size about 30 μm and density 65 kg / m 3), 551 DE 50 (particle size about 40 μm), or the microspheres marketed under the name MICROPEARL F 80 ED by the company Matsumoto; powders of natural organic materials such as starch powders, especially corn starch, wheat or rice, crosslinked or otherwise, such as starch powders crosslinked with octenylsuccinate anhydride, sold under the name DRY -FLO by the company National Starch; silicone resin microbeads such as those sold under the name Tospearl by the company Toshiba Silicone, in particular Tospearl 240; amino acid powders such as the Lauroyllysine powder marketed under the name Amihope LL-11 by the Ajinomoto Company; the wax microdispersion particles, which preferably have average dimensions of less than 1 μm and in particular from 0.02 μm to 1 μm, and which consist essentially of a wax or a mixture of waxes, such as products marketed under the name Aquacer by the company Byk Cera, and in particular: Aquacer 520 (mixture of synthetic and natural waxes), Aquacer 514 or 513 (polyethylene wax), Aquacer 511 (polymeric wax), or such as the products marketed under denomination Jonwax 120 by the company Johnson Polymer (mixture of waxes of polyethylene and paraffin) and under the name Ceraflour 961 by Byk Cera (micronized modified polyethylene wax); and their mixtures.

Additives

The cosmetic compositions according to the invention may furthermore comprise cosmetic adjuvants chosen from softeners, antioxidants, opacifiers, stabilizers, moisturizing agents, vitamins, bactericides, preservatives, polymers, perfumes and thickeners. , propellants or any other ingredient usually used in cosmetics for this type of application.

Of course, those skilled in the art will take care to choose this or these optional additional compounds in such a way that the advantageous properties intrinsically attached to the cosmetic composition in accordance with the invention are not, or not substantially, impaired by the addition or additions envisaged. .

The thickeners, preferably nonionic, may be selected from guar gums and modified or unmodified celluloses such as hydroxypropyl guar gum, cetylhydroxyethylcellulose, silicas such as Bentone Gel MIO sold by the company NL INDUSTRIES or the Veegum Ultra, sold by POLYPLASTIC.

The thickeners may also be cationic, for example POLYQUATERNIUM-37 sold under the name Salcare SC95 (Polyquaternium-37 (And) Mineral Oil (And) PPG-1 Trideceth-6) or Salcare SC96 (Polyquaternium-37 (And) Propylene Glycol Dicaprylate / Dicaprate (And) PPG-1-Trideceth-6) or other crosslinked cationic polymer such as for example those of CTFA name Ethylacrylate / Dimethylamino Ethyl Methacrylate Cationic Emulsion Copolymer. The amounts of these various constituents that may be present in the cosmetic composition according to the invention are those conventionally used in compositions for the treatment of perspiration.

10 AEROSOLS

The compositions according to the invention may be further pressurized and packaged in an aerosol device consisting of: (A) a container comprising an antiperspirant composition as defined above, (B) at least one propellant and a dispensing means of said aerosol composition.

Propellants generally used in this type of product and well known to those skilled in the art are, for example, dimethyl ether (DME); volatile hydrocarbons such as n-butane, propane, isobutane, and mixtures thereof, optionally with at least one chlorinated and / or fluorinated hydrocarbon; among these are the compounds sold by the company Dupont de Nemours under the names Freon® and Dymel®, and in particular monofluorotrichloromethane, difluorodichloromethane, tetrafluorodichloroethane and 1,1-difluoroethane sold in particular under the trade name DYMEL 152 A by the company DUPONT. It is also possible to use as propellant carbon dioxide, nitrous oxide, nitrogen or compressed air.

The compositions containing the perlite particles as defined above and the propellant (s) may be in the same compartment or in different compartments in the aerosol container. According to the invention, the concentration of propellant generally varies from 5 to 95% by weight of pressurized weight and more preferably from 50 to 85% by weight relative to the total weight of the pressurized composition.

The dispensing means, which forms a portion of the aerosol device, is generally constituted by a dispensing valve controlled by a dispensing head, itself comprising a nozzle through which the aerosol composition is vaporized. The container containing the pressurized composition may be opaque or transparent. It may be glass, polymeric material or metal, optionally covered with a layer of protective varnish.

The following examples serve to illustrate the present invention. The amounts are given as a percentage by weight relative to the total weight of the composition.

The compounds are, as the case may be, listed in chemical names or CTFA names (International Cosmetic Ingredient Dictionary and Handbook).

EXAMPLES The following examples serve to illustrate the present invention.

Example 1 Emulsions for Roll-on Ingredients INCI Name Roll-on Roll-on Emulsion Deodorant Emulsion / Antiperspirant Deodorant ALUMINUM CHLOROHYDRATE 0 30 CHLORHYDROL 50 (SUMIT REHEIS) EXPANSED MILLED PERLITE 6.5 1 (OPTIMAT 1430 OR û Word Ores) Pediocin PA-1 0.1 0.1 POLY DIMETHYLSILOXANE 0.5 0.5 (VISCOSITY: 350 CST) (Dow Corning 200 Fluid 350 CST - Dow Corning) CETEARYL ALCOHOL 2.5 2.5 CETEARETH-33 1, 1.25 PPG-15 STEARYL ETHER 3 3 (ARLAMOL E Croda) PERMUTED WATER qs 100 qs 100 Example 2: Deodorant anhydrous aerosol composition Ingredients (INCI name) Quantities in% by weight TRIETHYL CITRATE CITROFLEX 2 1.0 (REILLY CHEMICALS STEARALKONIUM BENTONITE TIXOGEL MP 250 0.2 (SOUTH CHEMIE RHEOLOG.) ISOPROPYL PALMITATE 0.9 Sakacin P 0.1 EXPANSED MILLED PERLITE 2.5 (OPTIMAT 1430 OR - WORD MINERALS) CYCLOPENTA DIMETHYLSILOXANE 9 (DOW CORNING 245 FLUID - Dow Corning) CYCLOPENTASILOXANE (and) DIMETHICONOL 1,3 (DOW CORNING 1501 FLUID ((DOW CORNING) ISOBUTANE (A-31 -AEROPRES) qsp 1 The formula is pressurized with isobutane. EXAMPLE 3 Deodorant / Antiperspirant Anhydrous Aerosol Composition INCI name Trade reference Quantities in% by weight ALUMINUM REACH 103 (SUMIT REHEIS) 5.25 CHLOROHYDRATE STEARALKONIUM TIXOGEL MP 250 (rockwood 0.39 BENTONITE additives) Plantaricin EF 0.1 ISOPROPYL PALMITATE ISOPROPYL PALMITATE (Cognis) 0.9 ISOBUTANE ISOBUTANO (Repsol) 85 CYCLOPENTASILOXANE DOW CORNING 245 FLUID (Dow QSP corning) CYCLOPENTASILOXANE DOW CORNING 1501 FLUID (dow 1,35 (and) DIMETHICONOL corning) TRIETHYL CITRATE CITROFLEX 2 1,05 (Vertellus) formula is pressurized with isobutane.

Example 4: Anhydrous deodorant stick Ingredients (INCI name) Quantities in% by weight CYCLOPENTA DIMETHYLSILOXANE Qs 100 (DOW CORNING 245 FLUID-DOW CORNING) PPG-14 BUTYL ETHER 10.0 (UCON FLUID AP - AMERCHOL) HYDROGENATED CASTOR OIL 4.0 (CUTI NA HR - COGNIS) STEARYL ALCOHOL (LOROL C18 -COGNIS) 14.0 PEG-8 DISTEARATE (STEARINERY DUBOIS) 2.0 EXPANSED MILLED PERLITE 17 (OPTIMAT 1430 OR - WORD MINERALS) C12-15 ALKYL BENZOATE FINSOLV TN (WITCO 15.0 PLANTARICIN 0.1 Procedure: The cyclopentasiloxane is heated to 65 ° C. The other ingredients (1 by 1) are added remaining at 65-70 ° C. The whole (transparent solution) is homogenized for 15 minutes. Perlite is added. Cooled to about 55 ° C (a few ° C above the thickening of the mixture) and poured into the sticks. The formula is placed at 4 ° C for 30 minutes. 42

Claims (5)

REVENDICATIONS1. Use of Class II bacteriocin as a deodorant agent. 2. Use according to claim 1, characterized in that the bacteriocin is a class IIa bacteriocin. 3. Use according to claim 2, characterized in that the class IIa bacteriocin is selected from the group consisting of mesentericin Y105, Sakacin P, Curvacin A, coagulin, Piscicoline 126, carnobacterocin Bml, Pediocin PA -1, enterocin A, Sakacin G, Leucocin A, Leucocin C, Mundticin, Mundticin KS, Carnobacterocin B2, Bavaricin MN, Bacteriocin 31, enterocin P, Bifidocin B, Divercin V41, Plantaricin 423, Plantaricin C19, Sakacin 5X and Lactococcin MMFII. 4. Use according to claim 3, characterized in that the class IIa bacteriocin is selected from the group consisting of pediocin PA-1, sakacin A and sakacin P. 5. Use according to any one of claims 1 to 4, characterized in that the class II bacteriocin is associated with another class II bacteriocin, and / or class I and / or III bacteriocin. 7. Use according to claim 5, characterized in that the class I bacteriocin is selected from the group consisting of nisin A, epidermin, salivaricin, plantaricin C and gallidermine. Use according to any one of claims 1 to 7, wherein the Class II bacteriocin alone or in combination is used as deodorant active for the underarms. Cosmetic process for treating body odor comprising the application to keratin materials of a composition comprising, in an acceptable medium, at least one class II bacteriocin. 10. The method of claim 9, characterized in that the bacteriocin is a class IIa bacteriocin. 11. The method of claim 10, characterized in that the class IIa bacteriocin is selected from the group consisting of Mesentericin Y105, Sakacin P, Curvacin A, coagulin, Piscicoline 126, Carnobacteriocin Bml, Pediocin PA -1, enterocin A, Sakacin G, Leucocin A, Leucocin C, Mundticin, Mundticin KS, Carnobacterocin B2, Bavaricin MN, Bacteriocin 31, enterocin P, Bifidocin B, Divercin V41, Plantaricin 423, Plantaricin C19, Sakacin 5X and Lactococcin MMFII. 12. Process according to claim 11, characterized in that the class IIa bacteriocin is selected from the group consisting of pediocin PA-1, sakacin A and sakacin P. 13. Process according to any one of claims 9 to 12, characterized in that the composition further comprises another class II bacteriocin, and / or class I and / or III bacteriocin. 14. The method of claim 13, characterized in that the class I bacteriocin is selected from the group consisting of nisin A, epidermin, salivaricin, plantaricin C and gallidermine. 15. A method according to any one of claims 1 to 14 for the treatment of axillary odors.