EP4452417A1 - Discernible cell surface protein variants of cd45 for use in cell therapy - Google Patents

Discernible cell surface protein variants of cd45 for use in cell therapy

Info

Publication number
EP4452417A1
EP4452417A1 EP22844175.4A EP22844175A EP4452417A1 EP 4452417 A1 EP4452417 A1 EP 4452417A1 EP 22844175 A EP22844175 A EP 22844175A EP 4452417 A1 EP4452417 A1 EP 4452417A1
Authority
EP
European Patent Office
Prior art keywords
seq
cells
isoform
cell
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP22844175.4A
Other languages
German (de)
English (en)
French (fr)
Inventor
Stefanie Urlinger
Lukas JEKER
Rosalba LEPORE
Romina MATTER MARONE
Anna CAMUS
Alessandro Sinopoli
Izabela DURZYNSKA
Anna HAYDN
Anna DEVAUX
Simon GARAUDE
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cimeio Therapeutics Ag
Universitaet Basel
Original Assignee
Cimeio Therapeutics Ag
Universitaet Basel
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Cimeio Therapeutics Ag, Universitaet Basel filed Critical Cimeio Therapeutics Ag
Publication of EP4452417A1 publication Critical patent/EP4452417A1/en
Pending legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0647Haematopoietic stem cells; Uncommitted or multipotent progenitors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70589CD45
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/289Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD45
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells

Definitions

  • the present disclosure relates to the use of cells having discernible surface protein with engineered or naturally occurring mutation(s) but functional surface protein for use in therapy.
  • the present invention also relates to the use of cells having discernible CD45 surface protein variants but functional surface protein for use in therapy, in particular adoptive cell therapy.
  • Cell based immunotherapy is emerging as the third pillar of medicine after small molecule therapy and treatments based on biologies such as recombinant proteins including antibodies.
  • Cellular therapy can be used in oncology for treating hematopoietic malignant diseases, but also other applications such as the treatment of genetic diseases, solid organ tumors and autoimmune diseases are under development.
  • cellular therapy can be associated with severe unwanted side effects.
  • cancer immunotherapy with chimeric antigen receptor (CAR) T cells has been successful in targeting and eradicating malignant cells expressing a specific antigen, it does often not discriminate between normal and malignant cells and thus induces destruction of the normal hematopoietic system.
  • CAR chimeric antigen receptor
  • Targeted therapies which include antibody-based therapies, such as conventional monoclonal antibodies, multispecific antibodies, such as T cell engagers (e.g. BiTE's) and cellular therapies, such as CAR cells (e.g. CAR T-cells, CAR NK cells or CAR macrophages), eliminate all cells expressing the target molecule.
  • CAR cells e.g. CAR T-cells, CAR NK cells or CAR macrophages
  • cancer cell surface antigens are shared with normal hematopoietic or other cells.
  • to identify targets to kill diseased cells including tumors while avoiding damage to healthy cells is a major challenge for targeted therapies (Perna et al., Cancer Cell (2017) 32:506-519).
  • myeloid diseases including myelodysplastic syndrome (MDS), acute myeloid leukemia (AML) or Blastic Plasmacytoid Dendritic Cell Neoplasm (BPDCN) cell surface antigens such as CD117, CD33, or CD123 are shared with normal myeloid progenitors. Therefore, immunotherapy targeting CD117, CD33 or CD123 antigen for MDS, AML or PBDCN can be associated with depletion of normal hematopoietic cells in addition to malignant cells in patients (Gill S. I. Best practice & Research Clinical Hematology, 2019). As a consequence, targeted immunotherapy including mAbs, T cell engagers or CAR T have mostly been elusive, in part owing to the absence of truly diseasespecific surface antigens (Gill S. I. Best practice & Research Clinical Hematology, 2019).
  • CD33 CAR T cell resistant hematopoietic cells are being engineered in such a way that the entire CD33 gene is knocked out (Kim et al. 2018. Cell. 173:1439-53).
  • CD33 has a constitutive inhibitory effect on myeloid cells through its immunoreceptor tyrosine-based inhibitory motif (ITIM) signaling domain.
  • ITIM immunoreceptor tyrosine-based inhibitory motif
  • CD33-knock-out (CD33 KO) engineered cells transplanted in patients could present long-term functional defects (WO2018/160768, Kim et al. 2018. Cell. 173:1439-53, Borot et al. 2019. PNAS. 116:11978- 87, Humbert et al. 2019. Leukemia. 33:762-808).
  • the frequency of CD33 KO cells decreased in the two monkeys for which a long-term observation was reported. This could indicate functional impairment of CD33 KO cells, for instance through reduced engraftment of CD33 KO long-term repopulating HSC (LT-HSC) or through a competitive disadvantage (Kim et al. 2018. Cell. 173:1439-53).
  • CD19-negative relapses are observed in approximately 30% of patients receiving CD19-targeted CAR T therapy (Orlando et al. 2018 Nat Med 24: 1504-6). Dual targeting of CD19 and CD123 can prevent antigen-loss relapses (Ruel la et al. 2016 J Clin Invest 126:3814-26).
  • a single amino acid difference in surface protein variants can be genetically engineered into hematopoietic cells to change the antigenicity and be discriminated by specific and selective antibodies (WO2017/186718, W02018/083071). Contrary to the approach where a surface protein is removed (KO cells), the surface protein variants in these cells retain their normal expression and function and enable to target surface proteins with important non-redundant functions.
  • CD45 also known as protein tyrosine phosphatase receptor type C (PTPRC)
  • PTPRC protein tyrosine phosphatase receptor type C
  • CD45 is an enzyme encoded by the PTPRC gene (Kaplan et al., PNAS 87:7000-7004 (1990)).
  • CD45 is a member of the protein tyrosine phosphatase (PTP) family, which includes signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation.
  • PTP protein tyrosine phosphatase
  • CD45 contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus belongs to the receptor type PTP family.
  • CD45 is a type I transmembrane protein that is present in various isoforms on differentiated hematopoietic cells (except e.g. erythrocytes) (Holmes, Immunology 7:145-55 (2006)). CD45 has been shown to be a regulator of T- and B-cell antigen receptor signaling. It functions through either direct interaction with components of the antigen receptor complexes via its extracellular domain, or by activating various Src family kinases (SFK), such as Lek, required for the antigen receptor signaling via its cytoplasmic domain. CD45 also suppresses JAK kinases, and thus functions as a negative regulator of cytokine receptor signaling.
  • Src family kinases Src family kinases
  • CD45 is present on the surface of hematopoietic cells, including HSCs (hematopoietic stem cells), leukocytes, and osteoclasts, which are of hematopoietic origin (Shivtiel et al., J Exp Med 205:2381 (2008)).
  • HSCs hematopoietic stem cells
  • leukocytes hematopoietic progens
  • osteoclasts which are of hematopoietic origin
  • CD45- deficient (CD45 _/ ) mouse bone marrow contains normal numbers of hematopoietic cells, but the most primitive HSCs are reduced in number, and their mobilization in response to G-CSF is impaired.
  • CD45 /_ HSCs are also deficient in G-CSF-stimulated mobilization and homing to the chemokine CXCL12/SDF-1, which negatively affects cell engraftment following transplantation. These deficiencies can be restored by supplementation with SFK inhibitors, indicating that this role is usually performed by CD45.
  • CD45 /_ recipients also show deficient engraftment and subsequent mobilization of normal HSCs, indicating a role for CD45 in the stem cell niche, as well as in the HSC (Shivtiel et al, J Exp Med 205:2381 (2008)).
  • CD45 is expressed, for example, on HSCs and leukocytes, it presents a target for therapies including conditioning therapies, immune reset, and treatment of diseases.
  • the present disclosure aimed to identify amino acid residues of CD45 that are exposed on the cell surface and that can be substituted in a manner such that a) the function of CD45 is not, or at least not substantially, altered, i.e. the variant of CD45 is functionally indistinguishable from the wild type version of CD45, and b) a moiety, such as an antibody or a CAR T cell, that binds to the wild-type version of CD45, but shows a substantially decreased or no binding to the altered version of CD45, i.e. the variant of CD45 is immunologically distinguishable from the wild type version of CD45.
  • a moiety such as an antibody or a CAR T cell
  • CD45 is expressed on all nucleated hematopoietic cells and is therefore a target that has a broad spectrum of therapeutic applications. This includes HSC depletion, as well as autoimmune diseases since autoreactive lymphocytes (B and T cells) are depleted actively. Anti-CD45 therapies are also useful to treat antigen-negative relapses of most targeted therapies.
  • BC8 is a mouse hybridoma antibody commercially available from IchorBio (#ICH 1155). The BC8 antibody is the basis for an anti-CD45 antibody-radioconjugate developed by Actinium Pharmaceuticals (WO2017155937, WO2019084258, WO2020159656).
  • anti-CD45 antibodies are disclosed in WO2016016442, WO2019115791 and W02020058495 (INSERM), W02017009473 (UCB), WO2019129178 (Shanghai Baize Medical Laboratory), W02020018580 (Fred Hutchinson) and W02020170254 (Ramot At Tel Aviv University).
  • One of the objectives of the present disclosure is to develop a safer method for the treatment of malignancies, in particular cancer, hematological malignancies, and myeloid diseases.
  • the inventors thus sought variations of the surface protein CD45, which are immunologically distinguishable while retaining or substantially retaining normal function, and where amino acid changes originate from a single or multiple amino acid or nucleotide variations.
  • the inventors identified rationally designed and naturally occurring variants of CD45 and showed that these mutations change the antigenicity of CD45 to a specific antibody while retaining its normal expression and function, with its intracellular domain mediating the dephosphorylation of target proteins, e.g.
  • CD45 is also involved in the in vivo development of hematopoietic cells, which can for example be tested in humanized mice. Likewise, the structure of CD45 is important, especially as an extracellular spacer.
  • the present disclosure relates to a mammalian cell or a population of cells expressing a first isoform of CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of CD45, wherein said cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of CD45 and preferably wherein said first and second isoforms are functional.
  • said first isoform is generated via RNA editing.
  • the present disclosure relates to the mammalian cell or population of cells, preferably hematopoietic stem cells for use in a medical treatment in a patient in need thereof wherein said medical treatment comprises: administering a therapeutically efficient amount of said cell or population of cells expressing said first isoform of CD45 to said patient in need thereof, in combination with a therapeutically efficient amount of a depleting agent comprising at least a first antigen-binding region that binds specifically to said second isoform of CD45 to specifically deplete patient cells expressing said second isoform of CD45, preferably to restore normal hematopoiesis after immunotherapy in the treatment of hematopoietic disease, preferably malignant hematopoietic disease such as acute myeloid leukemia (AML), myeloblastic syndrome (MDS), T-cell non-Hodgkin lymphomas (T-NHLs), chronic myeloid leukemia (CML), hairy cell leukemias (HCL), T-cell acute myeloid leuk
  • the medical treatment relates to the restoration of the hematopoietic or the immune function in genetic diseases of the hematopoietic or immune system, such as severe combined immunodeficiency syndrome (SCID), sickle cell disease (SCD), beta-thalassemia, Fanconi anemia or Diamond-Blackfan anemia.
  • SCID severe combined immunodeficiency syndrome
  • SCD sickle cell disease
  • beta-thalassemia beta-thalassemia
  • Fanconi anemia Fanconi anemia
  • Diamond-Blackfan anemia adenoietic or hematopoietic or immune system.
  • the medical treatment relates to the restoration of the normal immune function in autoimmune diseases, such as systemic lupus erythematosus (SLE), systemic sclerosis (SSc) or multiple sclerosis (MS).
  • SLE systemic lupus erythematosus
  • SSc systemic sclerosis
  • MS multiple sclerosis
  • the present disclosure relates to the mammalian cell or population of cells for use in a medical treatment in a patient in need thereof, wherein said medical treatment comprises: administering a therapeutically efficient amount of said cell or population of cells expressing said first isoform to said patient in need thereof in combination with a therapeutically efficient amount of a depleting agent comprising at least a second antigen-binding region that binds specifically to said first isoform to specifically deplete transferred cells expressing first isoform, preferably for use in adoptive cell transfer therapy, more preferably for the treatment of malignant hematopoietic disease such as acute myeloid leukemia (AML), myeloblastic syndrome (MDS), T-cell nonHodgkin lymphomas (T-NHLs), chronic myeloid leukemia (CML), hairy cell leukemias (HCL), T-cell acute lymphoblastic leukemia (T-ALL), non-Hodgkin's lymphoma (NHL) or follicular lymphomas
  • AML
  • the present disclosure relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a mammalian cell, preferably a hematopoietic stem cell or an immune cell such as a T-cell as described above and preferably a depleting agent and a pharmaceutically acceptable carrier.
  • the present disclosure also relates to a depleting agent for use in preventing or reducing the risk of severe side effects in a patient having received a cell expressing a first isoform of CD45, wherein said patient's native cells express a second isoform of CD45, and wherein said depleting agent comprises at least a second antigen-binding region which binds specifically to said first isoform of CD45 and does not bind to said second isoform of CD45.
  • said depleting agent binds substantially weaker to said second isoform of CD45.
  • the present disclosure also relates to a depleting agent for use in preventing or reducing the risk of severe side effects in a patient having received a cell expressing a first isoform of CD45, wherein said patient's native cells express a second isoform of CD45, and wherein said depleting agent comprises at least a second antigen-binding region which binds specifically to said first isoform of CD45 and does not bind to said second isoform of CD45, and wherein said first and second isoforms are substantially functionally identical.
  • said depleting agent binds substantially weaker to said second isoform of CD45.
  • the present disclosure also relates to a depleting agent for use in preventing or reducing the risk of severe side effects in a patient having received a cell expressing a first isoform of CD45, wherein said patient's native cells express a second isoform of CD45, and wherein said depleting agent comprises at least a second antigen-binding region which binds specifically to said first isoform of CD45 and does not bind to said second isoform of CD45, and wherein said first and second isoforms lead to the dephosphorylation of target proteins.
  • the present disclosure also relates to a depleting agent for use in preventing or reducing the risk of severe side effects in a patient having received a cell expressing a first isoform of CD45, wherein said patient's native cells express a second isoform of CD45, and wherein said depleting agent comprises at least a second antigen-binding region which binds specifically to said first isoform of CD45 and does not bind to said second isoform of CD45, and wherein said first and second isoforms lead to the dephosphorylation of tyrosine kinase Lek.
  • the present disclosure also relates to a depleting agent for use in preventing or reducing the risk of severe side effects in a patient having received a cell expressing a first isoform of CD45, wherein said patient's native cells express a second isoform of CD45, and wherein said depleting agent comprises at least a second antigen-binding region which binds specifically to said first isoform of CD45 and does not bind to said second isoform of CD45, and wherein said first and second isoforms lead to essentially the same modulation of T cell function and/or B cell function.
  • the present disclosure also relates to a depleting agent for use in preventing or reducing the risk of severe side effects in a patient having received a cell expressing a first isoform of CD45, wherein said patient's native cells express a second isoform of CD45, and wherein said depleting agent comprises at least a second antigen-binding region which binds specifically to said first isoform of CD45 and does not bind to said second isoform of CD45, and wherein said first and second isoforms lead to the normal differentiation of hematopoietic cells.
  • the present disclosure also relates to a depleting agent for use in preventing or reducing the risk of severe side effects in a patient having received a cell expressing a first isoform of CD45, wherein said patient's native cells express a second isoform of CD45, and wherein said depleting agent comprises at least a second antigen-binding region which binds specifically to said first isoform of CD45and does not bind to said second isoform of CD45, wherein said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid in position E230, Y232, N255, N257, E259, T264, N267, E269, N286, S287, D292, 1328, T330, F331, D334, Y340, K352, E353, E360, E364, Y372 or Y373 of SEQ ID NO: 1, preferably by at least one substitution of an amino acid in position E230, N257, E259, F331, K
  • the present disclosure also relates to a depleting agent for use in preventing or reducing the risk of severe side effects in a patient having received a cell expressing a first isoform of CD45, wherein said patient's native cells express a second isoform of CD45, and wherein said depleting agent comprises at least a second antigen-binding region which binds specifically to said first isoform of CD45 and does not bind to said second isoform of CD45, wherein said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid in position 1328, N255, E360, E259, E364 and E269. Among these substitutions, substitutions 1328V, N255G, E360G, E259G, E364K and E269G are particularly preferred. In certain embodiments said depleting agents binds substantially weaker to said second isoform of CD45.
  • the present disclosure also relates to a depleting agent for use in preventing or reducing the risk of severe side effects in a patient having received a cell expressing a first isoform of CD45, wherein said patient's native cells express a second isoform of CD45, and wherein said depleting agent comprises at least a second antigen-binding region which binds specifically to said first isoform of CD45 and does not bind to said second isoform of CD45, wherein residue E230 is substituted with K, and/or residue N257 is substituted with A, D, E, H, K, R, S, T or V, and/or residue E259 is substituted with G, N, T or Q, and/or T264 is substituted with D or E, preferably D, and/or N267 is substituted with A, H, L, S or V, and/or residue N286 is substituted with G, L or R, and/or E329 is substituted with A, and/or residue F331 is substituted with A or
  • the present disclosure also relates to a method for improving engraftment of hematopoietic stem cell transplants.
  • Conditioning depletion of HSCs
  • HSCT hematopoietic stem cell transplantation
  • AML acute myeloid leukemia
  • busulfan carries the risk of significant side effects, including sterility, primary or secondary malignancy, and additional acute and chronic toxicities.
  • the present disclosure also relates to human cell or a population of human cells expressing a first isoform of CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of CD45, wherein said human cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of CD45, and wherein said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid in position E230, Y232, N255, N257, E259, T264, N267, E269, N286, S287, D292, 1328, T330, F331, D334, Y340, K352, E353, E360, E364, Y372 or Y373 of SEQ ID NO: 1.
  • said first and said second isoform are substantially functionally identical.
  • said first and said second isoforms dephosphorylate target proteins of CD45, activate the TCR signaling cascade, lead to an increase of cytokine production and/or lead to an increase of proliferation of T cells.
  • said first and said second isoforms of CD45 dephosphorylate tyrosine kinase Lek.
  • said medical treatment comprises administering a therapeutically efficient amount of said cell or population of cells expressing said first isoform of CD45 to said patient in need thereof, in combination with a therapeutically efficient amount of a depleting agent comprising an antigen-binding region that binds specifically to said second isoform of CD45 to specifically deplete patient cells expressing said second isoform of CD45.
  • said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid is in position F331, K352 or E353 of SEQ ID NO: 1. In certain embodiments, said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position K352 of SEQ ID NO: 1. In certain embodiments, said substitution in position K352 is selected from K352E, K352H, K352I, K352L, K352M, K352N, K352Q, K352S and K352T, preferably K352D, K352E and K352H, and more preferably said substitution is K352E.
  • the depleting agent used in conjunction with a substitution of an amino acid is in position N286, F331, K352 or E353 of SEQ ID NO: 1 is selected from a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6; and an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 7, VLCDR2 is SEQ ID NO: 8, VLCDR3 is SEQ ID NO: 9, more preferably wherein said first antigen binding region comprises a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 2 and/or a light chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 3; and b) an antibody heavy chain variable domain
  • said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid is in position E230, Y232, N257 or E259 of SEQ ID NO: 1.
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position N257 of SEQ ID NO: 1.
  • said substitution in position N257 is selected from N257E, N257K, N257R and N257T, preferably N257R.
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position E259 of SEQ ID NO: 1.
  • said substitution in position E259 is selected from E259N, E259Q, E259V and E259G, preferably E259V.
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position Y232 of SEQ ID NO: 1, preferably Y232C.
  • the depleting agent used in conjunction with a substitution of an amino acid is in position E230, Y232, N257 or E259 of SEQ ID NO: 1 is an antigen-binding region comprising an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 20, VHCDR2 is SEQ ID NO: 21 and VHCDR3 is SEQ ID NO: 22; and an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 23, VLCDR2 is SEQ ID NO: 24, VLCDR3 is SEQ ID NO: 25, more preferably wherein said first antigen binding region comprises a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 18 and/or a light chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 19.
  • VH antibody heavy chain variable domain
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position N257 of SEQ ID NO: 1. In certain embodiments, said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position N257 of SEQ ID NO: 1. In certain embodiments, said substitution in position N257 is selected from N257E, N257K, N257R and N257T, preferably N257R.
  • the depleting agent used in conjunction with the substitution of the amino acid in position N257 of SEQ ID NO: 1 is an antigen-binding region comprising a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 12, VHCDR2 is SEQ ID NO: 13 and VHCDR3 is SEQ ID NO: 14; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 15, VLCDR2 is SEQ ID NO: 16, VLCDR3 is SEQ ID NO: 17, preferably wherein said first antigen binding region comprises a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 10 and/or a light chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 11.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ
  • said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid in position E230, N257, E259, F331, K352 or E353 of SEQ ID NO: 1.
  • Said substitutions may be selected from CD45 variants, wherein said residue E230 is substituted with K, and/or residue N257 is substituted with A, D, E, H, K, R, S, T or V, and/or residue E259 is substituted with G, H, K, N, R, T or Q, and/or T264 is substituted with D or E, preferably with D, and/or N267 is substituted with A, H, L, S or V, and/or residue N286 is substituted with G, L or R, and/or E329 is substituted with A, and/or residue F331 is substituted with A or G, and or Y340 is substituted with A, G, N, Q or S and/or residue K352 is substituted with A, D, E, G
  • the present disclosure also relates to a human cell or population of human cells for use as disclosed herein, wherein said cell expressing said first isoform of CD45 has been selected from a subject comprising native genomic DNA with at least one natural polymorphism allele in nucleic acid encoding said first isoform.
  • the present disclosure also relates to a human cell or population of human cells for use as disclosed herein, wherein said first isoform of CD45 is obtained by ex vivo modifying the nucleic acid sequence encoding said first isoform of CD45 by gene editing, preferably by introducing into a human cell a gene editing enzyme capable of inducing site-specific mutations(s) within a target sequence encoding a surface protein region involved in the binding of agent comprising at least a first antigen-binding region.
  • the present disclosure also relates to a human cell or population of human cells for use as disclosed herein, wherein said medical treatment comprises administering a therapeutically efficient amount of said human cell or population of human cells expressing said first isoform of CD45 to said patient in need thereof, in combination with a therapeutically efficient amount of a depleting agent comprising at least a first antigenbinding region that binds specifically to said second isoform of CD45 to specifically deplete patient cells expressing said second isoform of CD45, preferably to restore normal haematopoiesis after immunotherapy in the treatment of hematopoietic disease, and preferably in the treatment of malignant hematopoietic disease such as acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), T-cell non-Hodgkin lymphomas (T- NHLs), chronic myeloid leukemia (CML), hairy cell leukemias (HCL), T-cell acute lymphoblastic leukemia (T-ALL), non-Hodgkin
  • the present disclosure also relates to a human cell or population of human cells for use as disclosed herein, wherein said depleting agent is an antibody, antibody-drug conjugate or an immune cell, preferably a T-cell bearing a chimeric antigen receptor (CAR) comprising a first antigen-binding region which binds specifically to said second isoform and does not bind or binds substantially weaker to said first isoform.
  • said depleting agent is an antibody, antibody-drug conjugate or an immune cell, preferably a T-cell bearing a chimeric antigen receptor (CAR) comprising a first antigen-binding region which binds specifically to said second isoform and does not bind or binds substantially weaker to said first isoform.
  • CAR chimeric antigen receptor
  • the present disclosure also relates to pharmaceutical composition
  • a human cell preferably a hematopoietic stem cell or an immune cell such as T-cell as disclosed herein, and preferably a depleting agent as disclosed herein, and a pharmaceutically acceptable carrier.
  • Fab fragments bind to human CD45 in a concentration dependent manner. Cells transfected with the empty vector did not show any binding of the anti-CD45 antibodies.
  • Figure 3 shows the result of an alanine scan on human CD45 for four antibodies tested. For each mutant clone, the mean binding value determined by flow cytometry was plotted as a function of expression. Clones harboring CD45 Ala variants that were identified as critical are circled. Secondary clones, i.e., clones that did not meet the initially set thresholds but whose decreased binding activity and proximity to critical residues suggested that the mutated residue may be part of the antibody epitope, are squared.
  • FIG. 4 schematically depicts the location of the identified critical positions on the 3D structure of human CD45. binding of the tested antibodies to the variants identified for Refmab #1, i.e., the variants to which Refmab #1 shows binding of less than 20% compared to wild type
  • bars indicate the predicted Provean score (y-axis) for each variant (x-axis), predicting whether a protein sequence variation might affect protein function.
  • the dashed horizontal line indicates the predefined threshold (-2.5). All variants are predicted as neutral, with the exception of E259G whose predicted score is slightly below the threshold (-2.570).
  • CD45 knock-out cells as well as cells expressing the CD45
  • E259G variant are protected from killing by a Refmab #1 - Antibody Drug Conjugate.
  • CD45 knock-out is shown on the top left. Wild type CD45 is shown in the top middle. Top right: Mut8 (22 aa deletion). Bottom (from left to right): Mut9 (F331 deletion), Mutl2 (F331S) and Mut 13 (F331I).
  • FIG. 16 shows phosphorylation of Lek at position Tyr505 detected using an AlphaLISA assay.
  • 10.000-50.000 Jurkat wildtype or Jurkat CD45 knock-out cells were incubated for 20 minutes in plates coated with anti-CD3 Antibody before cell lysis and detection of phosphorylated Lek.
  • Activation of Jurkat cells using the anti-CD3 antibody leads to CD45 activation which in turn dephosphorylates Lek.
  • Jurkat CD45 knock-out cells are not able to dephosphorylate Lek upon activation.
  • the figure shows the acceptor signal (counts) and represents one biological experiment containing two technical replicates.
  • FIG. 17 shows thermal unfolding curves of recombinant purified wildtype and variant human CD45 D1-D2 proteins, using DSF and Sypro Orange. Data are represented in relative fluorescence units (RFU, top) and as a first derivative of RFU with respect to temperature (d(RFU)/dT, bottom).
  • FIG. 18 shows conformational/thermal stability data of recombinant purified wildtype and variant human CD45 D1-D2 proteins measured by DSF.
  • %binding to Refmab #2 is illustrated.
  • C) %binding to RefmAb #4 is illustrated. %binding was calculated by dividing the nm shift of hCD45 Dl-2 variant by the nm shift of hCD45 Dl-
  • 21 and 22 shows binding of Refmab #1 and Refmab #4 to DF-1 cells expressing wt or variant CD45 as measured by flow cytometry.
  • the data show that mutations of residues
  • K352 and E353 lead to a loss of binding of Refmab #1. Mutations of residue N257 lead to a loss of binding of Refmab #4, and mutations of residue E259 lead to a strong reduction of binding of Refmab #4.
  • K352E shows base editing using ABE8e-NG and B) shows base editing using ABE8e-SpRY and various gRNAs. Repositioning the ABE8e base editor in a more favorable editing window increased the editing efficiencies to >30% shielded HSPCs as measured by flow cytometry.
  • Immunotherapy is a promising therapy to treat cancer, genetic and autoimmune diseases.
  • Immunodepleting agent such as antibodies or engineered immune cells directed to tumor antigen are administered into a patient to target and kill tumor cells.
  • tumor surface proteins are also expressed at the surface of normal cells including hematopoietic cells, this strategy can induce severe side effects to the patients, e.g., by altering hematopoiesis.
  • hematopoietic cells can be subsequently transplanted into the patient.
  • the binding of the depleting agent not only to the diseased cells but also to the newly transplanted healthy cells can limit the maximal tolerated dose or limit the use to treatment before transplantation of healthy cells.
  • transplanted cells need to be resistant to said immunodepleting agent in order not to be targeted and eliminated by it.
  • One approach is therefore to select cells resistant to said immunodepleting agent used in immunotherapy while retaining their function to restore normal hematopoiesis in the patient.
  • the inventors develop a method to identify functional allelic variants in the genetic sequence encoding the surface protein region responsible for the binding of a specific depleting agent.
  • Such variants can be naturally occurring polymorphisms and/or designed and engineered variants.
  • Different isoforms of surface proteins can be selected or generated.
  • Said first isoform of a surface protein encoded by a nucleic acid with said polymorphism is not recognized by a specific depleting agent.
  • This variant allele particularly does not alter or does not substantially alter the function of the surface protein.
  • said depleting agent can be used to bind specifically to the one isoform and not, or not substantially, the other isoform thereby depleting specifically cells expressing one isoform.
  • the depleting agent binds specifically to the second isoform, but not the first isoform, said depleting agent will specifically deplete cells expressing said second isoform.
  • said first isoform can be recognized by a second agent and thus this second agent can be used to deplete specifically cells expressing the first isoform, but not second isoform.
  • the cells expressing the first isoform of the surface protein encoded by at least one variant allele is advantageously used in medical treatment in a patient having cells expressing a second isoform, in particular for depleting specifically transplanted or patient cells by using a second or first agent respectively.
  • the mutations need to lie on a surface exposed stretch of the surface antigen that is accessible for the depleting agent.
  • the depleting agent needs to bind to this stretch on the exposed area of the surface antigen.
  • binding needs to be affected sufficiently enough so that the depleting agent can discriminate the first isoform from the second isoform. Residual binding to the other isoform should be minimal or, better, be completely absent.
  • the mutation should not affect, or only marginally affect, the function of the surface antigen.
  • the mutated isoform should fulfill its biological function at least to an extent that is tolerable in a given therapeutic setting.
  • the present disclosure relates to an agent comprising an antigen binding region which binds specifically to one isoform of CD45 on a cell and does not bind or binds substantially weaker to another isoform of CD45.
  • agent is referred to herein as "depleting agent”.
  • Both isoforms of CD45 are functional, i.e. CD45 is functional with respect to at least one relevant property.
  • Preferably both isoforms of CD45 have that same function, i.e., they are functionally indistinguishable.
  • the two isoforms of CD45 differ however with respect to binding to the depleting agent.
  • the depleting agent only binds specifically to one of the isoforms of CD45.
  • the isoforms can therefore be described as functional identical (or functionally substantially identical), but immunologically distinguishable.
  • the first and the second isoform of CD45 have substantially identical biophysical properties. In certain embodiments, the first and the second isoform of CD45 have identical biophysical properties. In certain embodiments, the first and the second isoform of CD45 have substantially the same stability. In certain embodiments, the first and the second isoform of CD45 have the same stability. In certain embodiments, the first and the second isoform of CD45 have substantially the same melting temperature. In certain embodiments, the first and the second isoform of CD45 have the same melting temperature. In certain embodiments, the first and the second isoform of CD45 have substantially the same aggregation propensity. In certain embodiments, the first and the second isoform of CD45 have the same aggregation propensity.
  • the first and the second isoform of CD45 have substantially the same tendency to form dimers. In certain embodiments, the first and the second isoform of CD45 have the same tendency to form dimers.
  • the first isoform and the second isoform of CD45 may be polymorphic alleles. Preferably, the first isoform and the second isoform of CD45 are naturally occurring polymorphic alleles. Also preferably, the first isoform and the second isoform of CD45 are single nucleotide polymorphism (SNP) alleles.
  • SNP single nucleotide polymorphism
  • the first isoform and the second isoform of CD45 may also be genetically engineered alleles.
  • the first isoform and the second isoform of CD45 differ by one, two, three, four or five amino acids.
  • mutations can be randomly inserted, followed by the functional and immunological screening of the variants generated.
  • mutations can be rationally designed, for example by analysis of the secondary or tertiary protein structure of CD45.
  • the depleting agent comprises an antigen binding region which binds specifically to one isoform of CD45 on a cell and does not bind or binds substantially weaker to another isoform.
  • the depleting agent of the present disclosure can be divided into two main categories.
  • the depleting agent can be a polypeptide comprising an antigen binding region.
  • Said polypeptide may consist of one or more polypeptide chains.
  • Preferably said polypeptide comprising an antigen binding region is an antibody.
  • Said polypeptide comprising an antigen binding region may also be an antibody fragment, an antibody drug conjugate, or another variant of an antibody or scaffold.
  • Exemplary antibody fragments and scaffolds include single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR, igNAR, bis-scFv, camelid antibodies, ankyrins, centyrins, domain antibodies, lipocalins, small modular immuno- pharmaceuticals, maxybodies, Protein A and affilins.
  • Said polypeptide comprising an antigen binding region may also be a bispecific, biparatopic or multispecific antibody. Such molecules may also contain additional functional domains.
  • said polypeptide comprising an antigen binding region may be a T cell engager, for example a BiTE.
  • Said polypeptide comprising an antigen binding region may also be fused to a cytokine or a chemokine, a toxin or to the extracellular domain of a cell surface receptor.
  • the depleting agent can be a cell comprising an antigen binding region.
  • the depleting agent can be a chimeric antigen receptor (CAR).
  • said cell comprising an antigen binding region is a CAR T-cell, CAR NK cells or CAR macrophages.
  • said cell comprising an antigen binding region is a CAR T-cell.
  • said cell comprising an antigen binding region is a primary T cell comprising a CAR.
  • the depleting agent binds specifically to one isoform of CD45, but not the second isoform and thus specifically depletes cells expressing one isoform.
  • the present disclosure relates to an agent comprising a first antigen binding region which binds specifically to a second isoform of CD45 and does not bind a first isoform. In other embodiments, the present disclosure also relates to an agent comprising a second antigen binding region which binds specifically to the first isoform of CD45 and does not bind a second isoform. In certain embodiments said agents binds substantially weaker to said second isoform of CD45.
  • the first and the second isoform of CD45 may differ from each other by only one amino acid substitution. Said one amino acid difference between the first and the second isoform may also be the result of the presence of a single nucleotide polymorphism, such as a naturally occurring single nucleotide polymorphism.
  • the first and the second isoform of CD45 may also differ from each other by more than one amino acid, such as by two, by three or by more than three amino acids.
  • the first and the second isoform of CD45 may also differ from each other in that one of the isoforms has an insertion of one, of two, of three or of more than three amino acids compared to the other isoform.
  • the first and the second isoform of CD45 may also differ from each other in that one of the isoforms has a deletion of one, of two, of three or of more than three amino acids compared to the other isoform.
  • the two isoforms may also differ from each other by combinations of amino acid substitutions, insertions and/or deletions.
  • said depleting agent is an antibody or an antigen-binding fragment. If the two isoforms of CD45 differ by more than one amino acid, then the amino acids changed may be adjacent to each other, i.e., direct neighboring amino acids, or they may be separated.
  • antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that immunospecifically binds an antigen. As such, the term antibody encompasses not only whole antibody molecules, but also antibody fragments as well as variants (including derivatives) of antibodies.
  • each heavy chain is linked to a light chain by a disulfide bond.
  • light chains There are two types of light chains, lambda (A.) and kappa (K).
  • A. lambda
  • K kappa
  • Each chain contains distinct sequence domains.
  • the light chain includes two domains, a variable domain (VL) and a constant domain (CL).
  • the heavy chain includes four domains, a variable domain (VH) and three constant domains (CHI, CH2 and CH3, collectively referred to as CH).
  • variable regions of both light (VL) and heavy (VH) chains determine binding recognition and specificity to the antigen.
  • the constant region domains of the light (CL) and heavy (CH) chains confer important biological properties such as antibody chain association, secretion, transplacental mobility, complement binding, and binding to Fc receptors (FcR).
  • the Fv fragment is the N-terminal part of the Fab fragment of an immunoglobulin and consists of the variable portions of one light chain and one heavy chain variable region.
  • the specificity of the antibody resides in the structural complementarity between the antibody combining site and the antigenic determinant.
  • Antibody combining sites are made up of residues that are primarily from the hypervariable or complementarity determining regions (CDRs). Occasionally, residues from non-hypervariable or framework regions (FR) can participate in the antibody binding site or influence the overall domain structure and hence the combining site.
  • Complementarity Determining Regions or CDRs refer to amino acid sequences which together define the binding affinity and specificity of the natural Fv region of a native immunoglobulin binding site.
  • the light and heavy chains of an immunoglobulin each have three CDRs, designated L-CDR1, L-CDR2, L- CDR3 and H-CDR1, H-CDR2, H-CDR3, respectively.
  • An antigen-binding site therefore, typically includes six CDRs, comprising the CDRs set from each of a heavy and a light chain V region.
  • Framework Regions refer to amino acid sequences interposed between CDRs. Accordingly, the variable regions of the light and heavy chains typically comprise 4 framework regions and 3 CDRs of the following sequence: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4.
  • the residues in antibody variable domains are conventionally numbered according to a system devised by Kabat et al. This system is set forth in Kabat et al., 1987, in Sequences of Proteins of Immunological Interest, US Department of Health and Human Services, NIH, USA (Kabat et al., 1992, hereafter "Kabat et al.”). This numbering system is used in the present specification. The Kabat residue designations do not always correspond directly with the linear numbering of the amino acid residues in SEQ ID sequences.
  • the actual linear amino acid sequence may contain fewer or additional amino acids than in the strict Kabat numbering corresponding to a shortening of, or insertion into, a structural component, whether framework or complementarity determining region (CDR), of the basic variable domain structure.
  • CDR complementarity determining region
  • the correct Kabat numbering of residues may be determined for a given antibody by alignment of residues of homology in the sequence of the antibody with a "standard" Kabat numbered sequence.
  • the CDRs of the heavy chain variable domain are located at residues 31-35 (H-CDR1), residues 50-65 (H-CDR2) and residues 95-102 (H-CDR3) according to the Kabat numbering system.
  • the CDRs of the light chain variable domain are located at residues 24-34 (L-CDR1), residues 50-56 (L-CDR2) and residues 89-97 (L-CDR3) according to the Kabat numbering system.
  • an antibody provided herein is an antibody fragment, and more particularly any protein including an antigen-binding domain of an antibody as disclosed herein.
  • the antigen-binding domain may also be integrated into another protein scaffold
  • Antibody fragments and scaffolds include, but are not limited to, Fv, Fab, F(ab')2, Fab', dsFv, scFv, sc(Fv)2, diabodies, single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR, IgNAR, bis-scFv, camelid antibodies, ankyrins, centyrins, domain antibodies, lipocalins, small modular immuno-pharmaceuticals, maxybodies, Protein A and affilins.
  • an "antigen binding region" or “antigen-binding fragment of an antibody” means a part of an antibody, i.e. a molecule corresponding to a portion of the structure of the antibody, that exhibits antigen-binding capacity for a specific antigen, possibly in its native form; such fragment especially exhibits the same or substantially the same antigen-binding specificity for said antigen compared to the antigen-binding specificity of the corresponding four-chain antibody.
  • the antigen-binding capacity can be determined by measuring the affinity between the antibody and the target fragment.
  • This antigen-binding region may also be designated as "functional fragments" of antibodies.
  • the agents of the disclosure comprise antibodies and fragments thereof but also comprise artificial proteins with the capacity to bind antigens mimicking that of antibodies, also termed herein antigen-binding antibody mimetic.
  • Antigen-binding antibody mimetics are organic compounds that specifically bind antigens, but that are not structurally related to antibodies. They are usually artificial peptides or small proteins with a molar mass of about 3 to 20 kDa.
  • an antigen binding region recognizing an antigen and “an antigen binding region having specificity for an antigen” are used interchangeably herein with the term “an antigen binding region which binds specifically to an antigen”.
  • specificity refers to the ability of an agent comprising an antigen binding region such as an antibody to detectably bind an epitope presented on an antigen.
  • Specific binding or “specifically bind to” includes binding with a monovalent affinity of about IO -8 M (KD) or stronger. Preferably, binding is considered specific when the binding affinity is between 10 s M (KD) and 10 12 M (KD), optionally between IO -8 M (KD) and 10 10 M (KD), in particular at least IO -8 M (KD).
  • the affinity can be determined by various methods well known from the one skilled in the art. These methods include, but are not limited to, surface plasmon resonance (SPR), biolayer interferometry (BLI), microscale thermophoresis (MST) and Scatchard plot. Whether a binding domain specifically reacts with or binds to a target can be tested readily by, inter alia, comparing the reaction of said binding domain with a target protein or antigen with the reaction of said binding domain with proteins or antigens other than the target protein.
  • epitope means the part of an antigen to which the antibody or antigen binding region thereof binds.
  • the epitopes of protein antigens can be divided into two categories, conformational epitope and linear epitope.
  • a conformational epitope corresponds to discontinuous sections of the antigen's amino acid sequence.
  • a linear epitope corresponds to a continuous sequence of amino acids from the antigen.
  • bispecific or multispecific molecules such as bispecific antibodies or multispecific antibodies.
  • an antibody can be derivatized or linked to another functional molecule, e.g., another peptide or protein (e.g., another antibody or ligand for a receptor) to generate a bispecific molecule that binds to at least two different binding sites or target molecules.
  • another functional molecule e.g., another peptide or protein (e.g., another antibody or ligand for a receptor) to generate a bispecific molecule that binds to at least two different binding sites or target molecules.
  • the antibody may in fact be derivatized or linked to more than one other functional molecule to generate multi-specific molecules that bind to more than two different binding sites and/or target molecules; such multi-specific molecules are also intended to be encompassed by the terms "bispecific molecule”, “bispecific antibody”, “biparatopic molecule”, “biparatopic antibody”, “multispecific molecule” and “multispecific antibody” as used herein.
  • an antibody of the disclosure can be functionally linked (e.g., by chemical coupling, genetic fusion, disulfide bonds, noncovalent association or otherwise) to one or more other binding molecules, such as another antibody, antibody fragment, peptide or binding mimetic, cytokine, chemokine, toxin or a receptor extracellular domain, such that a bispecific molecule results.
  • Specific bispecific and multispecific molecules contemplated by the present disclosure are T cell engagers, such as bispecific T cell engager, for example a BiTE.
  • an agent which does not bind or binds substantially weaker to a particular isoform of CD45 includes an agent which is not able to bind to cells expressing said particular isoform.
  • said agent may be labelled with a fluorescent marker or may be detected with a secondary antibody directed against said agent, and the percentage of cells presenting said fluorescent marker or said secondary antibody is determined by FACS analysis.
  • testing is done in cell lines expressing the recombinant target protein, i.e. CD45.
  • the target protein may be expressed in its entirety.
  • a truncated version may be used, wherein said truncated version at a minimum needs to include the extra cellular domain or the regions of the extracellular domain containing the respective antibody epitope.
  • cells may be stained with two agents simultaneously, one binding the epitope where variants were introduced and a second one that binds an epitope that is different from the one bound by the first agent.
  • the second epitope remains unaltered and thus this staining serves as an expression control.
  • a non-binding control cells are used that do not express the protein of interest.
  • a maximum binding control cells that normally do not express the protein of interest are transfected with the wildtype isoform. Different cell lines have different expression levels but the expression is controlled through endogenous control elements such as promoters.
  • Such cell lines can also be used to study the mode-of-action of a depleting agent, the effective shielding against a different mode- of-action, to test cytotoxicity and shielding/resistance from cytotoxicity or to test the function of the engineered receptors.
  • Western Blot, ELISA or FACS can be used to analyze phosphorylation of signaling molecules. Analysis of gene expression changes can serve to analyse gene expression compared to normal function.
  • Cells can also be used to demonstrate the feasibility of editing a specific variant via different approaches, e.g. homology directed repair (HDR), base editing or prime editing.
  • HDR homology directed repair
  • Binding of said agent can result in depletion of the cell expressing the first isoform of CD45.
  • Various mechanisms can lead to cell depletion.
  • Antibody dependent cellular cytotoxicity (ADCC) results from binding of the agent to a target protein and activation of NK cells through the Fc part on the agent bound by an FcR expressed by NK cells.
  • the Fc part of an immunoglobulin refers to the C-terminal region of an immunoglobulin heavy chain.
  • the Fc part can be wildtype or engineered. Mutations of enhanced, engineered Fc parts are known in the art.
  • FcyRI FcyRI
  • Fey Rl la FcyRl la
  • FcyRllb FcyRI Ila
  • Effector function can include, but is not limited to, one or more of the following: complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), cytokine secretion, immune complex-mediated antigen uptake by antigen-presenting cells, binding to NK cells, binding to macrophages, binding to monocytes, binding to polymorphonuclear cells, direct signaling inducing apoptosis, crosslinking of target-bound antibodies, dendritic cell maturation, or T cell priming. Binding of said agent may also lead to the blocking of binding of the natural receptor ligand and thereby result in cell death and apoptosis without cell- mediated depletion.
  • CDC complement dependent cytotoxicity
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • ADCP antibody-dependent cellular phagocytosis
  • cytokine secretion immune complex-mediated antigen uptake by antigen-presenting cells
  • binding to NK cells
  • a reduced or abolished binding of an Fc region to an Fc receptor and/or to Clq is typically achieved by mutating a wild-type Fc region, such as of an IgGl Fc region, more particular a human IgGl Fc region, resulting in a variant or engineered Fc region of said wild-type Fc region, e.g., a variant human IgGl Fc region.
  • a wild-type Fc region such as of an IgGl Fc region, more particular a human IgGl Fc region
  • substitutions that result in reduced binding can be useful.
  • non-conservative amino acid substitutions i.e. replacing one amino acid with another amino acid having different structural and/or chemical properties and/or charges, are preferred.
  • the Fc region of the antibody is of the IgGl isotype, carrying the LALA or PG-LALA mutations, i.e. the constant region carries a L234A, a L235A and a P329G mutation or PA-LALA mutations, i.e. the constant region carries a L234A, a L235A and a P329A mutation, or a AEASS , i.e. the constant region carries a L234A, a L235A and a P329A mutation or a L234A, a L235E, G237A, A330S and a P331S mutation.
  • the skilled person will be aware of possibilities to engineer the Fc region to obtain a desired effect.
  • Surrogate ADCC assays constitute an industry standard to quantitate an agent's potency to mediate ADCC as described in the experimental part.
  • Engineered Jurkat reporter cells carry an NFAT-responsive luciferase gene and an Fc receptor, such as human FcgRIIIa. Binding of the Fc receptor to bound antibody results in NFAT induction through receptor clustering and therefore a luciferase signal. Absence of binding and therefore clustering does not result in a luciferase signal.
  • Cells expressing either no target protein e.g.
  • HEK or DF-1 cells or human hematopoietic cancer cells such as TF-1, KG-1, KASUMI-l, K562 or Jurkat engineered to be CD45-deficient (e.g. a CD45 knock-out or human T-cell cancer cells such as Jurkat cells with a CD45 knock-out), the wildtype protein (e.g. HEK-CD45 or DF-1- CD45, orTF-1, KG-1, KASUMI-l or Jurkat cell lines) or individual variants (e.g. CD45 variants) were incubated with the test agent (e.g. antibody Refmab # 1) and mixed with the ADCC reporter cells. Then luciferase was measured to quantify the ADCC signal.
  • the test agent e.g. antibody Refmab # 1
  • the luciferase luminescence signals were normalized to the maximal signal observed in HEK-CD45, DF-1- CD45 or the corresponding myeloid or T cell cancer cell line. ADCC was measured with an ADCC Reporter Assay (Promega, Cat. No. G7015).
  • T cell engager molecules For example, a bispecific T cell engager using a CD45 binding site derived from antibody Refmab # 1 and a CD3 (OKT3) binding site may be used. The same target cells used for the ADCC assay are used. Primary human T cells and the bispecific T cell engager are added. Activation of human T cells was quantified by FACS by determining the frequency of CD69 upregulation and/or cytokine release.
  • the depleting agent according to the present disclosure binds specifically to one isoform of CD45 and allows the depletion of cells expressing said isoform. More preferably, in specific embodiments, said depleting agent according to the present disclosure does not bind or binds substantially weaker to a first isoform of CD45 but binds specifically to a second isoform of CD45 and allows the depletion of said cells expressing said second isoform of CD45, in particular in methods of use as disclosed herein.
  • said depleting agent which does not bind or binds substantially weaker to a first isoform of CD45 but binds specifically to a second isoform of CD45 expressed in patient's cell is used to deplete patient's cells but not hematopoietic stem cells or their progeny expressing said first isoform of CD45 transplanted to restore hematopoiesis in said patient.
  • said depleting agent according to the present disclosure does not bind or binds substantially weaker to a second isoform of CD45 but binds specifically to a first isoform of CD45 and allows the depletion of cells expressing said first isoform of CD45, in particular in methods of use as disclosed herein.
  • said depleting agent which does not bind or binds substantially weaker to a second isoform of CD45 but binds specifically to a first isoform of CD45 expressed in transplanted cells is used to deplete specifically transplanted cells to avoid eventual severe side effects such as graft- versus-host disease due to transplantation.
  • Selective depletion of cells expressing a specific isoform of CD45 can be achieved without limitation by complement-dependent cytotoxicity (CDC), antibody-dependent cellular cytotoxicity (ADCC) or antibody-dependent cellular phagocytosis (ADCP).
  • CDC complement-dependent cytotoxicity
  • ADCC antibody-dependent cellular cytotoxicity
  • ADCP antibody-dependent cellular phagocytosis
  • the antigen binding region is coupled to an effector compound such as a drug or a toxin.
  • an effector compound such as a drug or a toxin.
  • conjugates are referred to herein as “immunoconjugates", “antibody-drug conjugates” or “ADCs”.
  • a cytotoxin or cytotoxic agent includes any agent that is detrimental to (e.g., kills) cells.
  • Examples include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, maytansinoids, calicheamicins, indolinobenzodiazepines, pyrolobenzodiazepines, pyrridinobenzodiazepines, camptothecins, topotecan, irinotecan, belotecan, deruxtecan, alpha-amanitin, microcystins, auristatins and puromycin and analogs or homologs thereof.
  • said depleting agent is an immune cell harboring an antigen receptor such as a chimeric antigen receptor (CAR).
  • an antigen receptor such as a chimeric antigen receptor (CAR).
  • CAR chimeric antigen receptor
  • Said immune cell may express a recombinant antigen binding region, also named antigen receptor on its cell surface.
  • recombinant is meant an antigen binding region which is not encoded by the cell in its native state, i.e. it is heterologous, non-endogenous. Expression of the recombinant antigen binding region can thus be seen to introduce a new antigen specificity to the immune cell, causing the cell to recognise and bind a previously unrecognised antigen.
  • the antigen receptor may be isolated from any useful source.
  • said cell comprising an antigen binding region is a CAR T-cell, a CAR NK cell, CAR Treg or a CAR macrophage.
  • said cell comprising an antigen binding region is a CAR T-cell.
  • said cell comprising an antigen binding region is a primary T cell comprising a CAR.
  • said recombinant antigen receptor is a chimeric antigen receptor (CAR).
  • CARs are fusion proteins comprising an antigen-binding region, typically derived from an antibody, linked to the signaling domain of the TCR complex. CARs can be used to direct immune cells such T-cells or NK cells against a target antigen if a suitable antigen-binding region is selected.
  • the antigen-binding region of a CAR is typically based on a scFv (single chain variable fragment) derived from an antibody.
  • CARs typically may comprise a hinge domain, which functions as a spacer to extend the antigen-binding region away from the plasma membrane of the immune effector cell on which it is expressed, a transmembrane (TM) domain, an intracellular signaling domain (e.g. the signaling domain from the zeta chain of the CD3 molecule (CD3() of the TCR complex, or an equivalent) and optionally one or more co- stimulatory domains which may assist in signaling or functionality of the cell expressing the CAR.
  • TM transmembrane
  • Signaling domains from co-stimulatory molecules including CD28, OX-40 (CD134), CD27, ICOS and 4- 1BB (CD137) can be added alone (second generation) or in combination (third generation) to enhance survival and increase proliferation of CAR modified immune cells.
  • the immune cell for use in the method of the disclosure is a redirected T-cell, e.g. a redirected CD8+ T-cell or a redirected CD4+ T-cell, or a redirected NK cell.
  • a nucleic acid molecule encoding the antigen receptor may be introduced into the cell in the form of e.g. a vector, or any other suitable nucleic acid construct, or by inserting the nucleic acid molecule into the genome using genome editing technologies.
  • Vectors, and their required components are well known in the art.
  • Nucleic acid molecules encoding antigen binding region can be generated using any method known in the art, e.g. molecular cloning using PCR.
  • Antigen binding region sequences can be modified using commonly used methods, such as site-directed mutagenesis.
  • CD45 (UniProt: P08575; also known as protein tyrosine phosphatase receptor type C, PTPRC, LCA, B220 or LY5), is a member of protein tyrosine phosphatase (PTP) family, which includes signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation.
  • Human CD45 has the following amino acid sequence (SEQ ID No. 1):
  • said surface protein is CD45. In other embodiments said surface protein is CD45 comprising the amino acid sequence of SEQ ID No. 1. In other embodiments said surface protein is CD45 consisting of the amino acid sequence of SEQ ID No. 1.
  • the present disclosure relates to a mammalian cell or a population of cells expressing a first isoform of the surface protein CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of said surface protein, wherein said cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of said surface protein and preferably wherein said first and second isoforms are functional.
  • said mammalian cell is a human cell.
  • the present disclosure relates to a mammalian cell or a population of cells expressing a first isoform of the surface protein CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of said surface protein, wherein said cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of said surface protein, wherein said first and second isoforms are functional.
  • said mammalian cell is a human cell.
  • the present disclosure relates to a mammalian cell or a population of cells expressing a first isoform of the surface protein CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of said surface protein, wherein said cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of said surface protein, wherein said first and second isoforms are substantially functionally identical.
  • said mammalian cell is a human cell.
  • the present disclosure related to a first and a second isoform of CD45 wherein both isoforms are functional.
  • the present disclosure related to a first and a second isoform of CD45 wherein both isoforms are functional indistinguishable.
  • the present invention “functionally indistinguishable” refers to a first and a second isoform of CD45 that are equally capable of performing the same function within a cell without significant impairment. In other words, the first and the second isoform are functionally largely indistinguishable. A slight functional impairment may be acceptable.
  • said first isoform of CD45 remains functional and retain the capacity of performing the same function as the corresponding wild-type isoform within a cell without significant impairment.
  • the present disclosure relates to a mammalian cell or a population of cells expressing a first isoform of the surface protein CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of said surface protein, wherein said cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of said surface protein and wherein said first and said second isoform prevent T-cell receptor engagement upon inclusion into the immunological synapse.
  • said mammalian cell is a human cell.
  • the present disclosure relates to a mammalian cell or a population of cells expressing a first isoform of the surface protein CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of said surface protein, wherein said cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of said surface protein and wherein said first and said second isoform dephosphorylate target proteins of CD45.
  • said mammalian cell is a human cell.
  • CD45 One function of CD45 is the dephosphorylation of tyrosine kinase Lek. Therefore, in certain embodiments the present disclosure relates to a mammalian cell or a population of cells expressing a first isoform of the surface protein CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of said surface protein, wherein said cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of said surface protein and wherein said first and said second isoform dephosphorylate tyrosine kinase Lek.
  • Lek (UniProt: P06239) is a member of the Src family of protein tyrosine kinases (PTKs). Lek is a key signaling molecule in the selection and maturation of developing T-cells.
  • said mammalian cell is a human cell.
  • the present disclosure relates to a mammalian cell or a population of cells expressing a first isoform of the surface protein CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of said surface protein, wherein said cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of said surface protein and wherein said first and said second isoform dephosphorylate tyrosine kinase Lek at position Y505.
  • said mammalian cell is a human cell.
  • the present disclosure relates to a mammalian cell or a population of cells expressing a first isoform of the surface protein CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of said surface protein, wherein said cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of said surface protein and wherein said first and said second isoform activate the TCR signaling cascade.
  • said mammalian cell is a human cell.
  • the present disclosure relates to a mammalian cell or a population of cells expressing a first isoform of the surface protein CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of said surface protein, wherein said cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of said surface protein and wherein said first and said second isoform increase cytokine production.
  • said mammalian cell is a human cell.
  • the present disclosure relates to a mammalian cell or a population of cells expressing a first isoform of the surface protein CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of said surface protein, wherein said cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of said surface protein and wherein said first and said second isoform increase the proliferation of T cells.
  • said mammalian cell is a human cell.
  • CD45 is the normal differentiation of hematopoietic cells. This can for example be tested in humanized mice, for example by implanting engineered HSCs into humanized mice. Therefore, in certain embodiments the present disclosure relates to a mammalian cell or a population of cells expressing a first isoform of the surface protein CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of said surface protein, wherein said cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of said surface protein and wherein said first and said second isoform lead to a normal differentiation of hematopoietic cells.
  • said mammalian cell is a human cell.
  • additional variants or isoforms of CD45 within the methods and compositions of the present disclosure.
  • Such isoforms may for example include double mutants.
  • Such isoforms may for example also include single and double mutants.
  • the methods and compositions of the present disclosure may also be combined with cells carrying a CD45 knock out, e.g., a permanent knock out or a temporarily knock out (e.g. via CRISPRoff).
  • the methods and compositions of the present disclosure may also be used in the depletion of myeloid cells in solid tumors in order to enhance tumor responses.
  • compositions of the present disclosure may also be combined with cells combinations, in particular when said surface protein is CD45 with knock out of other targets, such as CD117, CD123, DLL-1, CD33, CD7, CLEC12A, CD44, Fit, CD300F, EVI2B, TPO and combinations thereof.
  • CD45 with knock out of other targets, such as CD117, CD123, DLL-1, CD33, CD7, CLEC12A, CD44, Fit, CD300F, EVI2B, TPO and combinations thereof.
  • the methods and compositions of the present disclosure may also comprise cells expressing first isoform of CD45 and other surface protein variants such as CD117 variants, CD123 variants, DLL-1 variants, CD33 variants, CD7 variants, CLEC12A (CD371) variants, CD44 variants Fit (CD135) variants, CD300F variants, EVI2B variants, TPO variants and any combination thereof.
  • CD45 and other surface protein variants such as CD117 variants, CD123 variants, DLL-1 variants, CD33 variants, CD7 variants, CLEC12A (CD371) variants, CD44 variants Fit (CD135) variants, CD300F variants, EVI2B variants, TPO variants and any combination thereof.
  • the cell expressing the first isoform of CD45 comprises genomic DNA with at least one polymorphic allele in the nucleic acid encoding said CD45 isoform.
  • said polymorphism induces at least one mutation involved in the binding of a specific agent in comparison to said second isoform.
  • Said polymorphism is preferably within a nucleic acid sequence encoding the surface protein region of CD45 involved in binding of the first agent, preferably located in the extracellular portion of CD45, in particular in a solvent-exposed secondary structure element. More particularly, said polymorphism is within a nucleic acid sequence encoding at least one specific amino acid residue involved in binding of the first agent. Said polymorphism can be a mutation such as a deletion, a substitution, an insertion, or a combination thereof of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15 or 20 nucleotides. In a particular embodiment, said polymorphism is a single nucleotide polymorphism.
  • isoform refers to a variant of a protein which differs from another variant of the same protein by at least one amino acid difference.
  • difference may be a substitution of a single amino acid, but such differences may also be double, triple or multiple amino acid substitutions, or insertions or deletions.
  • SNPs naturally occurring SNPs are isoforms.
  • sequence difference in the sequence of the two isoforms may also be genetically introduced.
  • sequence difference is preferably within a nucleic acid sequence encoding the CD45 region involved in binding of the first agent, preferably located in the extracellular portion of said surface protein, in particular in a solvent-exposed secondary structure element. More particularly, said sequence difference is within a nucleic acid sequence encoding at least one specific amino acid residue involved in binding of the first agent.
  • Said sequence difference can be a mutation such as a deletion, a substitution, an insertion or a combination thereof of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15 or 20 nucleotides. In a particular embodiment, said sequence difference is a single point mutation.
  • the present disclosure provides polymorphisms in CD45, including in particular polymorphisms including substitution of the residues E230, N255, N257, E259, T264, N267, E269, N286, S287, D292, 1328, E329, T330, F331, D334, Y340, K352, E353, E360, E364, Y372 or Y373.
  • the present disclosure provides polymorphisms in CD45, including in particular polymorphisms including substitution of the residues E230, N257, E259, F331, K352 or E353.
  • Particular preferred polymorphisms include substitutions of the residue E230, wherein E230 is substituted with K.
  • Other preferred polymorphisms include substitutions of the residue N257, wherein N257 is substituted with D, E, H, K, R, S, T or V.
  • Other preferred polymorphisms include substitutions of the residue F331, wherein F331 is substituted with G.
  • Other preferred polymorphisms include substitutions of the residue K352, wherein K352 is substituted with H, I, L, M, N, Q, S or T.
  • Yet other preferred polymorphisms include substitutions of the residue E353, wherein E353 is substituted with K or R.
  • the present disclosure relates to a variant CD45 polypeptide, wherein said variant CD45 polypeptide comprises at least one mutation in an amino selected from E230, N257, E259, T264, N267, N286, S287, D292, 1328, T330, F331, D334, Y340, K352, E353, Y372 and Y373 of wild type human CD45.ln preferred embodiments said mutation is selected from E230, N257, E259, T264, N267, N286, S287, D292, 1328, T330, F331, D334, Y340, K352, E353, Y372 and Y373. It will be appreciated that amino acid may be designated by the 3-letter code or the 1- letter code, which both are familiar to the skilled person.
  • Table 1 shows the 20 natural occurring amino acids: tryptophan Trp W tyrosine Tyr Y valine Vai V
  • an identified variant may be substituted with a similar amino acid residue.
  • an acidic amino acid can be replaced by another acidic amino acid, since it can be expected to have the same effect.
  • a charged amino acid can be replaced by another charged amino acid.
  • T264E is expected to be equivalent to T264D, since both, D and E are acidic amino acids.
  • said cell according to the present disclosure is selected from a subject comprising native genomic DNA with at least one natural polymorphism allele, preferably single nucleotide polymorphism (SNP) in the nucleic acid encoding said isoform.
  • SNP single nucleotide polymorphism
  • cells are selected from a subject that comprises native genomic DNA with at least one natural polymorphism allele, in particular SNP, in a nucleic acid sequence encoding CD45 region involved in anti- CD45 agent binding, preferably located in the extracellular portion of said surface protein, more preferably in a solvent- exposed secondary structure element.
  • SNPs are described in the literature. These naturally SNPs may be used within the spirit of the present disclosure with a respective binding agent which is able to discriminate such SNP from another isoform of CD45.
  • said cell expressing the first isoform of CD45 according to the present disclosure is obtained by gene editing, preferably by changing the sequence encoding said surface protein in the patient's native genomic DNA.
  • the cell can be genetically engineered by introducing into the cell a gene editing system to induce said polymorphism resulting in insertion, deletion and/or substitution of amino acids of the surface protein.
  • Said gene editing modality targets a nucleic acid sequence, named herein target sequence encoding surface protein region involved in first agent binding as described above.
  • said gene editing modality targets a nucleic acid encoding at least one amino acid residue in position E230, Y232, N255, N257, E259, T264, N267, E269, N286, S287, D292, 1328, T330, F331, D334, Y340, K352, E353, E360, E364, Y372 or Y373 of SEQ. ID NO: 1.
  • amino acid residue E230 is substituted with K, and/or residue Y232 is substituted with C, and/or residue N257 is substituted with A, D, E, H, K, R, S, T or V, and/or residue E259 is substituted with H, K, N, V, G, R, T or Q, and/or residue T264 is substituted with D or E, and/or residue N267 is substituted with A, H, L, S or V, and/or residue N286 is substituted with D, G, L or R, and/or residue E329 is substituted with A, and/or residue F331 is substituted with A or G, and/or residue Y340 is substituted with A, G, N, Qor S, and/or residue K352 is substituted with A, D, E, G, H, I, L, M, N, Q, S, T or Y, and/or residue E353 is substituted with A, H, I, K, L, S, T or R.
  • Gene editing enzymes
  • nuclease refers to a wild type or variant enzyme capable of catalyzing the hydrolysis (cleavage) of phosphodiester bonds between nucleotides of a nucleic acid (DNA or RNA) molecule, preferably a DNA molecule.
  • cleavage is intended a double-strand break or a single-strand break event.
  • sequence-specific nuclease refers to a nuclease which cleaves nucleic acid in a sequence-specific manner.
  • site-specific nucleases can be used, such as Meganucleases, TAL-nucleases (TALEN), Zing-finger nucleases (ZFN), or RNA/DNA guided endonucleases like Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)/Cas system and Argonaute (Review in Li et al., Nature Signal transduction and targeted Therapy, 5, 2020; Guha et al., Computational and Structural Biotechnology Journal, 2017, 15, 146-160).
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
  • the nuclease generates a DNA cleavage within a target sequence
  • said target sequence encodes a surface protein region involved in first agent binding as described above.
  • the inventors use CRISPR system to induce a cleavage within a target sequence encoding surface protein region recognized by first agent as described above.
  • target sequence it is intended targeting a part of the sequence encoding the region on CD45 involved in first agent binding as described as described above and/or sequences adjacent to said region on CD45 involved in first agent binding, in particular at least one (one or two) sequence of up to 50 nucleotides adjacent to said region on CD45 involved in first agent binding, preferably 20, 15, 10, 9, 8, 7, 6 or 5 nucleotides adjacent to said agent binding site.
  • CRISPR system involves two or more components, Cas protein (CRISPR-associated protein) and a guide RNA.
  • the guide RNA can be a single guide RNA or a dual guide RNA.
  • Cas protein is a DNA endonuclease that uses guide RNA sequence as a guide to recognize and generate double-strand cleavage in DNA that is complementary to the target sequence.
  • Cas systems that generate single strand breaks require only one nuclease domain.
  • Cas systems that generate double strand breaks require two nuclease domains.
  • Cas protein may comprise two active cutting sites, such as HNH nuclease domain and RuvC- like nuclease domain.
  • Cas protein is also meant an engineered endonuclease, homologue or orthologue of Cas 9 which is capable of cleaving target nucleic acid sequence.
  • Cas protein may induce a cleavage in the nucleic acid target sequence which can correspond to either a double-stranded break or a single- stranded break.
  • Cas protein variant may be a Cas endonuclease that does not naturally exist in nature and that is obtained by protein engineering or by random mutagenesis.
  • the Cas protein can be one type of the Cas proteins known in the art.
  • Cas proteins include Casl, CaslB, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csnl and Csxl2), SaCas9, Casl2, Casl2a (Cpfl), CaslO, Csyl, Csy2, Csy3, Csel, Cse2, Cscl , Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Cmrl , Cmr3, Cmr4, Cmr5, Cnrr6, Csbl , Csb2, Csb3, Csxl7, CsxM, Csx IO, Cs 16, CsaX, Csx3, Cs I, Csxl5, Csfl, Csf2, CsO, Csf4, homologs, orthologs thereof, or modified versions thereof.
  • Cas protein is Streptoc
  • a guide RNA designed to comprise a complementary sequence to the target sequence to specifically induce DNA cleavage within said target sequence, in particular according to the present disclosure a complementary sequence of a part of target sequence encoding surface protein region recognized by agent as described above.
  • a guide RNA refers to a nucleic acid that promotes the specific targeting or homing of a gRNA/Cas complex to a target nucleic acid.
  • gRNA refers to RNA that comprises a transactivating crRNA (tracrRNA) and a crRNA.
  • said guide RNA corresponds to a crRNA and tracrRNA which can be used separately or fused together to generate a single guide RNA.
  • the complementary sequence pairing with the target sequence recruits Cas to bind and cleave the DNA at the target sequence.
  • crRNA is engineered to comprise a complementary sequence to a part of a target sequence as described above encoding surface protein region recognized by agent, such that it is capable of targeting said region.
  • sgRNA is used to target the binding site of the said binding agent.
  • the guide RNA contains chemically modifications known to the person skilled in the art.
  • the crRNA comprises a sequence of 5 to 50 nucleotides, preferably 15 to 30 nucleotides, more preferably 20 nucleotides which is complementary to the target sequence.
  • complementary sequence refers to the sequence part of a polynucleotide (e.g., part of crRNA or tracRNA) that can hybridize to another part of polynucleotides under standard low stringent conditions.
  • the sequences are complementary to each other pursuant to the complementarity between two nucleic acid strands relying on Watson-Crick base pairing between the strands, i.e., the inherent base pairing between adenine and thymine (A-T) nucleotides and guanine and cytosine (G-C) nucleotides.
  • A-T adenine and thymine
  • G-C guanine and cytosine
  • Said gRNA can be designed by any methods known by one of skill in the art in view of the present disclosure.
  • said target sequence encodes surface protein region on CD45 involved in first agent binding, preferably located in the extracellular portion of CD45, more preferably in an extracellular loop in comparison to said second isoform, again more preferably comprising amino acid residues involved in agent binding.
  • said target sequence when surface protein is CD45, said target sequence encodes a CD45 region involved in binding of a first agent, such as anti- CD45 agent binding as disclosed above.
  • target sequence encodes at least one residue in position E230, Y232, N255, N257, E259, T264, N267, E269, N286, S287, D292, 1328, T330, F331, D334, Y340, K352, E353, E360, E364, Y372 or Y373 of SEQ ID NO: 1.
  • the DNA strand break that is introduced by the nuclease according to the disclosure can result in mutation of the DNA at the cleavage site via non-homologous end joining (NHEJ) which often results in small insertions and/or deletions or replacement of the DNA surrounding the cleavage site via homology-directed repair (HDR).
  • NHEJ non-homologous end joining
  • HDR homology-directed repair
  • said polymorphism within nucleic acid encoding the isoform of CD45 is induced via HDR repair following the DNA cleavage and the introduction of an exogeneous nucleotide sequence, named herein HDR template.
  • HDR template comprises a first and a second portion of sequence which are homologous to regions 5' and 3' of the target sequence, respectively and a middle sequence portion comprising polymorphism. Following cleavage of the target sequence, a homologous recombination event is achieved between the genome containing the target sequence and the HDR template and the genomic sequence containing the target sequence is replaced by the exogeneous sequence.
  • homologous sequences of at least 20 bp, preferably more than 30 bp, more preferably more than 50 bp and most preferably less than 200 bp are used.
  • Homologous sequences may be dsDNA or ssDNA.
  • the homologous sequences are ds DNA.
  • shared DNA homologies are located in regions flanking upstream and downstream the site of the break and the exogeneous sequence to be introduced should be located between the two arms.
  • the flanking sequences may be symmetrical or asymmetrical. Both strands of the target nucleic acid, i.e. the plus strand or the minus strand, may be targeted.
  • a PAM sequence may be used, which may be silenced to improve HDR.
  • the cell according to the present disclosure is genetically engineered by introducing into said cell said site-specific nuclease which targets the sequence encoding the region on CD45 recognized by said first agent as described above and a HDR template.
  • said gene editing enzyme is a DNA base editor as described in Komor et al., Nature 533, 420-424, and in Rees HA, Liu DR. Nat Rev Genet. 2018;19: 770-788, or a prime editor as described in Anzalone et al. Nature, 2019, 576: 149- 157, Matsoukas et al., Front Genet. (2020) 11: 528, Chen et al. Cell (2021) 184: 5635-52, Koblan et al, Nat Biotechnol (2021) 39: 1414-25 and Kantor A. et al. Int. J. Mol. Sci. 2020, 21(6240).
  • Base editor or prime editor can be used to introduce mutations at specific sites in the target sequence.
  • the base editor or prime editor generates a mutation within the target sequence by sequence-specific targeting of the sequence encoding the region on CD45 involved in first agent binding.
  • said base editor or prime editor are CRISPR base or prime editors.
  • Said CRISPR base or prime editor may comprise as catalytically inactive sequence specific nuclease a dead Cas protein (dCas). It may also comprise Cas9 with a mutated nuclease domain.
  • dCas refers to a modified Cas nuclease which lacks endonucleolytic activity. Nuclease activity can be inhibited or prevented in dCas proteins by one or more mutations and/or one or more deletions in the HNH and/or RuvC-like catalytic domains of the Cas protein.
  • the resulting dCas protein lacks nuclease activity but bind to a guide RNA (gRNA)- DNA complex with high specificity and efficiency to specific target sequence.
  • said dCas may be a Cas nickase wherein one catalytic domain of the Cas is inhibited or prevented.
  • Said base editor is complexed with a guide RNA (gRNA) designed to comprise a complementary sequence of the target nucleic acid sequence to specifically bind said target sequence as described above.
  • gRNA guide RNA
  • Said gRNA can be designed by any methods known by one of skill in the art in view of the present disclosure.
  • said gRNA may target the sequence encoding the region on CD45 recognized by said first agent as described above.
  • said base editor is a nucleotide deaminase domain fused to a dead Cas protein, in particular Cas nickase.
  • Said nucleotide deaminase may be an adenosine deaminase or cytidine deaminase.
  • Said nucleotide deaminase may be natural or engineered deaminase.
  • said base editor may be as non-limiting examples selected from the group consisting of: BE1, BE2, BE3, BE4, HF-BE3, Sa-BE3, Sa-BE4, BE4-Gam, saBE4- Gam, YE1-BE3, EE-BE3, YE2-BE3, YEE-BE3, VQR-BE3, VRER-BE3, SaKKH-BE3, casl2a-BE, Target-AID, Target-AID-NG, xBE3, eA3A-BE3, A3A-BE3, BE-PLUS, TAM, CRIPS-X, ABE7.9, ABE7.10, ABE7.10* xABE, ABESa, ABEmax, ABE8e, VQR-ABE, VRER-ABE and SaKKH-ABE.
  • Said prime editor consists of a fusion of a catalytically inactive sequence specific nuclease as described above, particularly a Cas nickase and a catalytically active engineered reverse transcriptase (RT) enzyme.
  • Said fusion protein is used in combination with a prime editing guide RNA (pegRNA) which contains the complementary sequence to the target sequence as described above, particularly when surface protein is CD45 comprises one of the sequences described in the Table 13 and also an additional sequence comprising a sequence that binds to the primer binding site region on the DNA.
  • said reverse transcriptase enzyme is a Maloney murine leukemia virus RT enzyme and variants thereof.
  • Said prime editor may be as non-limiting examples selected from the group consisting of: PEI, PE2, PE3 and PE3b, or any of the prime editors described in Chen et al. Cell (2021) 184: 5635-52 or Koblan et al, Nat Biotechnol (2021) 39: 1414-25.
  • anti-CD45 moieties are known in the art, some of which are currently in development.
  • QA17A19 Biolegend, #393411)
  • HI30 Biolegend, #304001
  • Various anti-CD45 from Magenta are in development, most as antibody drug conjugates (e.g. WO2017219025, W02020092654).
  • BC8 is a mouse hybridoma antibody commercially available from IchorBio (WICH1155). The BC8 antibody is the basis for an anti-CD45 antibodyradioconjugate developed by Actinium (WO2017155937, WO2019084258,
  • WO2020159656 Other anti-CD45 antibodies are disclosed in WO2016016442, WO2019115791 and W02020058495 (INSERM), W02017009473 (UCB), WO2019129178 (Shanghai Baize Medical Laboratory), W02020018580 (Fred Hutchinson) and W02020170254 (Ramot At Tel Aviv University). These and other anti-CD45 moieties may be used in the context of the present disclosure.
  • Several anti-CD45 antibodies were also generated in the present disclosure, in full length antibody format, as well as in Fab format. Details are provided in Example 1.
  • said depleting agent which binds to said second isoform of CD45 and does not bind or binds substantially weaker to said first isoform of CD45 as described above binds specifically to an epitope including the amino acids E230, Y232, N255, N257, E259, T264, N267, E269, N286, S287, D292, 1328, T330, F331, D334, Y340, K352, E353, E360, E364, Y372 and/or Y373 of SEQ ID NO: 1. More preferably, said depleting agents binds specifically to an epitope including the amino acids N286, F331, K352 and/or E353 of SEQ ID NO: 1. In other preferred embodiments said depleting agents binds specifically to an epitope including the amino acids E230, Y232, N257 and/or E259 of SEQ ID NO: 1.
  • said anti-CD45 agent comprises an antigen binding region comprising: a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 7, VLCDR2 is SEQ ID NO: 8 and VLCDR3 is SEQ ID NO: 9.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ ID NO: 4
  • VHCDR2 is SEQ ID NO: 5
  • VHCDR3 is SEQ ID NO: 6
  • VL antibody light chain variable domain
  • said anti-CD45 agent comprises an antigen binding region comprising: a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 60, VLCDR2 is SEQ ID NO: 61 and VLCDR3 is SEQ ID NO: 9.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ ID NO: 4
  • VHCDR2 is SEQ ID NO: 5
  • VHCDR3 is SEQ ID NO: 6
  • VL antibody light chain variable domain
  • said anti-CD45 agent comprises an antigen binding region derived from and retaining the binding specificity of an antibody comprising: a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 7, VLCDR2 is SEQ ID NO: 8 and VLCDR3 is SEQ ID NO: 9.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ ID NO: 4
  • VHCDR2 is SEQ ID NO: 5
  • VHCDR3 is SEQ ID NO: 6
  • VL antibody light chain variable domain
  • said anti-CD45 agent comprises an antigen binding region derived from and retaining the binding specificity of an antibody comprising: a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 60, VLCDR2 is SEQ ID NO: 61 and VLCDR3 is SEQ ID NO: 9.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ ID NO: 4
  • VHCDR2 is SEQ ID NO: 5
  • VHCDR3 is SEQ ID NO: 6
  • VL antibody light chain variable domain
  • said anti-CD45 agent comprises an antigen binding region derived competing with an antibody comprising: a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 7, VLCDR2 is SEQ ID NO: 8 and VLCDR3 is SEQ ID NO: 9.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ ID NO: 4
  • VHCDR2 is SEQ ID NO: 5
  • VHCDR3 is SEQ ID NO: 6
  • VL antibody light chain variable domain
  • said anti-CD45 agent comprises an antigen binding region derived competing with an antibody comprising: a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 60, VLCDR2 is SEQ ID NO: 61 and VLCDR3 is SEQ ID NO: 9.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ ID NO: 4
  • VHCDR2 is SEQ ID NO: 5
  • VHCDR3 is SEQ ID NO: 6
  • VL antibody light chain variable domain
  • said anti-CD45 agent comprises an antigen binding region comprising: a) an antibody heavy chain variable domain (VH) comprising the variable heavy chain of SEQ ID NO: 2; and b) an antibody light chain variable domain (VL) comprising variable light chain of SEQ ID NO: 3.
  • VH antibody heavy chain variable domain
  • VL antibody light chain variable domain
  • said anti-CD45 agent comprises an antigen binding region comprising: a) an antibody heavy chain variable domain (VH) comprising the variable heavy chain of SEQ ID NO: 58; and b) an antibody light chain variable domain (VL) comprising variable light chain of SEQ ID NO: 59.
  • VH antibody heavy chain variable domain
  • VL antibody light chain variable domain
  • said anti-CD45 agent comprises an antigen binding region comprising: a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 12, VHCDR2 is SEQ ID NO: 13 and VHCDR3 is SEQ ID NO: 14; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 15, VLCDR2 is SEQ ID NO: 16 and VLCDR3 is SEQ ID NO: 17.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ ID NO: 12
  • VHCDR2 is SEQ ID NO: 13
  • VHCDR3 is SEQ ID NO: 14
  • VL antibody light chain variable domain
  • said anti-CD45 agent comprises an antigen binding region comprising: a) an antibody heavy chain variable domain (VH) comprising the variable heavy chain of SEQ ID NO: 10; and b) an antibody light chain variable domain (VL) comprising variable light chain of SEQ ID NO: 11.
  • said anti-CD45 agent comprises an antigen binding region comprising: a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 20, VHCDR2 is SEQ ID NO: 21 and VHCDR3 is SEQ ID NO: 22; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 23, VLCDR2 is SEQ ID NO: 24 and VLCDR3 is SEQ ID NO: 25.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ ID NO: 20
  • VHCDR2 is SEQ ID NO: 21
  • VHCDR3 is SEQ ID NO: 22
  • VL antibody light chain variable domain
  • said anti-CD45 agent comprises an antigen binding region comprising: a) an antibody heavy chain variable domain (VH) comprising the variable heavy chain of SEQ ID NO: 18; and b) an antibody light chain variable domain (VL) comprising variable light chain of SEQ ID NO: 19.
  • VH antibody heavy chain variable domain
  • VL antibody light chain variable domain
  • said anti-CD45 agent is an antibody selected from Refmab #1, Refmab #2, Refmab #3, Refmab #4 and Refmab #5.
  • said anti-CD45 agent is an antibody selected from QA17A19 (Biolegend, #393411), BC8 (IchorBio; #ICH1155), AbA (WQ2020092654A1, SEQ ID NO 1 & 5), HI30 (Biolegend, #304001) and 2D1 (R&D Systems, #MAB1430).
  • said anti-CD45 agent is an antibody comprising the CDR of an antibody selected from QA17A19 (Biolegend, #393411), BC8 (IchorBio; #ICH1155), AbA (WQ2020092654A1, SEQ ID NO 1 & 5), HI30 (Biolegend, #304001) and 2D1 (R&D Systems, #MAB1430).
  • said anti-CD45 agent is an antibody competing for binding to CD45 with an antibody selected from QA17A19 (Biolegend, #393411), BC8 (IchorBio; #ICH1155), AbA (WQ2020092654A1, SEQ ID NO 1 & 5), HI30 (Biolegend, #304001) and 2D1 (R&D Systems, #MAB1430).
  • said depleting agent is or is derived from QA17A19 (Biolegend, #393411; Refmab #1), wherein said depleting agent binds to one isoform of CD45 but not, or substantially weaker, to a second isoform of CD45, wherein one of said isoform is wild type CD45 and the other isoform has a mutation in at least one of the following amino acid residues of CD45: F331, K352 and E353.
  • said mutation includes one or more of the following: F331G, K352H, K352E, K352D, K352I, K352L, K352M, K352N, K352Q, K352S, K352T, E353K or E353R.
  • said depleting agent is or is derived from AbA (WQ2020092654A1, SEQ ID NO 1 & 5; Refmab #2), wherein said depleting agent binds to one isoform of CD45 but not, or substantially weaker, to a second isoform of CD45, wherein one of said isoform is wild type CD45 and the other isoform has a mutation in amino acid residues N257 of CD45.
  • said mutation is N257D, N257E, N257K, N257R or N257T.
  • said depleting agent is or is derived from BC8 (IchorBio; WICH1155; Refmab #4), wherein said depleting agent binds to one isoform of CD45 but not, or substantially weaker, to a second isoform of CD45, wherein one of said isoform is wild type CD45 and the other isoform has a mutation in at least one of the following amino acid residues of CD 45: E230, N257, E259, T264, N267, N286, S287, D292, F331, D334, Y340, K352, E353 and Y373.
  • said mutation includes one or more of the following: E230K, N257T, N257H, N257R, N257S, N257V, E259G, E259N or E259Q.
  • the antigen-binding region of the anti-CD45 antibody may be further screened or optimized for their binding properties as above defined.
  • said antigen binding region thereof may have 1, 2, 3, 4,
  • CDR1, CDR2, CDR3, CDR4, CDR5, or CDR6 of the VJ or VDJ region of the light or heavy variable region of antigen binding region may have an insertion, deletion, or substitution with a conserved or non-conserved amino acid.
  • amino acids that can either be substituted or constitute the substitution are disclosed above.
  • the amino acid differences are conservative substitutions, i.e., substitutions of one amino acid with another having similar chemical or physical properties (size, charge or polarity), which substitution generally does not adversely affect the biochemical, biophysical and/or biological properties of the CD45 protein. In particular, the substitution does not disrupt the interaction of the antibody with the CD45 antigen.
  • Said conservative substitution(s) are advantageously chosen within one of the following five groups: Group 1-small aliphatic, non-polar or slightly polar residues (A, S, T, P, G); Group 2- polar, negatively charged residues and their amides (D, N, E, Q); Group 3-polar, positively charged residues (H, R, K); Group 4-large aliphatic, nonpolar residues (M, L, I, V, C); and Group 5-large, aromatic residues (F, Y, W).
  • said first antigen-binding region comprises a heavy chain variable domain comprising or consisting of any one of amino acid sequences selected from SEQ ID NO: 2, 10, 18 and 58, and/or a light chain variable domain comprising or consisting of any one of amino acid sequences selected from SEQ ID NO: 3, 11, 19 and 59.
  • first antigen binding region thereof with amino acid sequences having at least 90%, for example, at least 95%, 96%, 97%, 98%, or 99% identity to any one of the above defined amino acid sequences are also part of the present disclosure, typically first antigen binding region have at least equal or higher binding activities than said first antigen binding region consisting of heavy chain consisting of any one of amino acid sequences selected from SEQ ID NO: 2, 10, 18 and 58 and/or a light chain variable domain comprising or consisting of any one of amino acid sequences selected from SEQ ID NO: 3, 11, 19 and 59.
  • said anti-CD45 agent can be a bispecific CD45 antibody, comprising at least one first binding specificity for CD45, for example, one antigen-binding region of anti-CD45 as described herein and a second binding specificity for a second target epitope or target antigen.
  • said anti-CD45 agent can be an immune cell harboring an antigen receptor targeting CD45, such as a CAR targeting CD45, said antigen receptor comprising an antigen binding region as described above.
  • said immune cell (e.g., T cell) harboring a CAR targeting CD45 recognizes a second isoform of CD45 as expressed in a patient in need thereof, and does not recognize a first isoform of CD45.
  • said immune cell may bind specifically to an epitope including the amino acids E230, Y232, N255, N257, E259, T264, N267, E269, N286, S287, D292, 1328, T330, F331, D334, Y340, K352, E353, E360, E364, Y372 or Y373 of SEQ ID NO: 1. More preferably, said immune cell binds specifically to an epitope including the amino acids N286, F331, K352 or E353 of SEQ ID NO: 1.
  • said anti-CD45 agent can be an immune cell (e.g., T cell) harboring a CAR, said CAR comprising an antigen-binding region, e.g. scFv, comprising a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 8, VLCDR2 is SEQ ID NO: 9, VLCDR3 is SEQ ID NO: 10.
  • an immune cell e.g., T cell
  • said CAR comprising an antigen-binding region, e.g. scFv, comprising a) an antibody heavy chain variable domain (VH) comprising the three CDRs V
  • said anti-CD45 agent can be an immune cell (e.g., T cell) harboring a CAR, said CAR comprising an antigen-binding region, e.g. scFv, comprising a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 60, VLCDR2 is SEQ ID NO: 61 and VLCDR3 is SEQ ID NO: 9.
  • scFv comprising a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2
  • said anti-CD45 agent can be an immune cell (e.g., T cell) harboring a CAR comprising said first antigen-binding region e.g. scFv comprising a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 2 and/or a light chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 3.
  • a CAR comprising said first antigen-binding region e.g. scFv comprising a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 2 and/or a light chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 3.
  • said anti-CD45 agent can be an immune cell (e.g., T cell) harboring a CAR comprising said first antigen-binding region e.g. scFv comprising a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 58 and/or a light chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 59.
  • a CAR comprising said first antigen-binding region e.g. scFv comprising a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 58 and/or a light chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 59.
  • said anti-CD45 agent can be an immune cell harboring an antigen receptor targeting CD45, such as a CAR targeting a specific isoform of CD45, said antigen receptor comprising an antigen binding region as described above and said immune cell either not expresses CD45 or expresses an isoform of CD45 which is not recognized by said CAR.
  • an antigen receptor targeting CD45 such as a CAR targeting a specific isoform of CD45
  • said antigen receptor comprising an antigen binding region as described above and said immune cell either not expresses CD45 or expresses an isoform of CD45 which is not recognized by said CAR.
  • said anti-CD45 agent can be an immune cell (e.g. T cell) harboring a CAR, said CAR targeting a specific isoform of CD45 comprising an antigenbinding region, e.g. scFv, comprising: a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 12, VHCDR2 is SEQ ID NO: 13 and VHCDR3 is SEQ ID NO: 14; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 15, VLCDR2 is SEQ ID NO: 16 and VLCDR3 is SEQ ID NO: 17; and said immune cell either not expresses CD45 or expresses an isoform of CD45 which is not recognized by said CAR.
  • an immune cell e.g. T cell harboring a CAR, said
  • said anti-CD45 agent can be an immune cell (e.g. T cell) harboring a CAR comprising said first antigen-binding region e.g. scFv comprising a heavy chain variable domain comprising or consisting of an amino acid sequence of SEQ ID NO: 10 and a light chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 11, and said immune cell expresses an isoform of CD45 which is not recognized by said CAR.
  • a CAR comprising said first antigen-binding region e.g. scFv comprising a heavy chain variable domain comprising or consisting of an amino acid sequence of SEQ ID NO: 10 and a light chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 11, and said immune cell expresses an isoform of CD45 which is not recognized by said CAR.
  • said anti-CD45 agent is antibody Refmab #1 as described in the examples.
  • said anti- CD45 agent can be an immune cell harboring a CAR targeting a specific isoform of CD45 as described in the examples.
  • the disclosure also relates to depleting anti-CD45 agents as disclosed above (for example CAR cell composition or antibodies) comprising a first or a second antigen binding region for use in selectively depleting the host cells or transferred cells respectively, in a subject in need thereof.
  • depleting anti-CD45 agents as disclosed above (for example CAR cell composition or antibodies) comprising a first or a second antigen binding region for use in selectively depleting the host cells or transferred cells respectively, in a subject in need thereof.
  • the present disclosure relates to a mammalian cell, preferably a hematopoietic cell, or a population of cells expressing a first isoform of CD45 wherein said cell or population of cells express a first isoform of CD45 comprising at least one polymorphic allele in the nucleic acid encoding said first isoform, and wherein said first isoform is not recognized by the depleting agent comprising a first antigen binding region as described herein.
  • said mammalian cell is a human cell.
  • Said cell or population of cells are particularly useful in medical treatment in a patient expressing a second isoform of CD45.
  • said cells e.g. hematopoietic stem cell
  • said cells encoding or expressing said first isoform of CD45 not recognized by a depleting agent (e.g. hematopoietic cells) are particularly useful in medical treatment to restore normal hematopoiesis after immunotherapy, such as adoptive cell transfer in a patient expressing said second isoform, in particular wherein the treatment comprises administering a therapeutically efficient amount of said hematopoietic cells expressing said first isoform of CD45 in combination with a therapeutically efficient amount of a depleting agent targeting said second isoform of CD45.
  • a depleting agent e.g. hematopoietic cells
  • said hematopoietic cells preferably hematopoietic stem cells are administered subsequently to said depleting agent.
  • said hematopoietic cells, preferably hematopoietic stem cells can be administered before or concurrently to said depleting agent
  • said cells expressing said first isoform of CD45 specifically recognized by depleting agent which does not bind or binds substantially weaker second isoform of CD45 are particularly useful in medical treatment in a patient expressing said second isoform of CD45, in particular to avoid severe side-effect related to transplanted cells carrying the first isoform (safety switch), wherein the treatment comprises administering a therapeutically efficient amount of a depleting agent targeting said first isoform of CD45.
  • said hematopoietic cells, preferably immune cells harboring a CAR are administered prior to said depleting agent.
  • cell relates to mammalian cells, preferably human cells.
  • said cells are hematopoietic cells.
  • Hematopoietic cells comprise immune cells including lymphocytes, such as B cells and T cells, natural killer cells, myeloid cells, such as monocytes, macrophages, eosinophils, mast cells, basophils, granulocytes, dendritic cells (DC) and plasmacytoid dendritic cells (pDCs).
  • lymphocytes such as B cells and T cells
  • myeloid cells such as monocytes, macrophages, eosinophils, mast cells, basophils, granulocytes, dendritic cells (DC) and plasmacytoid dendritic cells (pDCs).
  • DC dendritic cells
  • pDCs plasmacytoid dendritic cells
  • said immune cells are T cells.
  • said immune cells are primary T cells.
  • T cell includes cells bearing a T cell receptor (TCR) or a cell derived from a T cell bearing a TCR.
  • T- ce Ils according to the disclosure can be selected from the group consisting of inflammatory T-lymphocytes, cytotoxic T-lymphocytes, regulatory T-lymphocytes, memory T- lymphocytes, tumor infiltrating lymphocytes and helperT- lymphocytes included both type 1 and 2 helperT cells and Thl7 helper cells.
  • said cell can be derived from the group consisting of CD4+ T- lymphocytes and CD8+ T-lymphocytes or non-classical T cells such as MR1 restricted T cells, MAIT cells, NKT cells, gamma delta T cells or innate- like T cells.
  • T-cells can be obtained from a number of non-limiting sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
  • T-cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled person.
  • T cells can be differentiated from iPS cells.
  • said hematopoietic cells are hematopoietic stem cells.
  • the stem cells can be adult stem cells, embryonic stem cells, more particularly non-human stem cells, cord blood stem cells, progenitor cells, bone marrow stem cells, induced pluripotent stem cells, totipotent stem cells or hematopoietic stem cells.
  • Representative human stem cells are CD34 + cells.
  • Hematopoietic stem cells can be differentiated from iPS cells or can be harvested from umbilical cord blood, from bone marrow or from mobilized or not mobilized peripheral blood.
  • the cell is an allogeneic cell which refers to a cell derived from a donor that presents with an HLA genotype that is identical, similar or different to the HLA genotype of the person receiving the cell.
  • the donor may be a related or unrelated person.
  • the cell is an autologous cell which refers to a cell derived from the same person that is receiving the cell.
  • Said cells may originate from a healthy donor or from a patient, in particular from a patient diagnosed with cancer, genetic disease or an auto-immune disease or from a patient diagnosed with an infection.
  • Hematopoietic cells can be extracted from blood, bone marrow or derived from stem cells.
  • HSC's can for example be derived from iPS (induced pluripotent stem cells.
  • the disclosure further relates to a composition of cells or a population of cells for use in the therapy as disclosed herein.
  • said cell expressing first isoform of CD45 may be modified to display desired specificities and enhanced functionalities.
  • said cell may express a recombinant antigen binding region, also named antigen receptor on its cell surface as described above.
  • said recombinant antigen receptor is a chimeric antigen receptor (CAR).
  • said immune cell expressing a first isoform of CD45 and a CAR can be specifically depleted by the administration of a therapeutically efficient amount of an agent which comprises a second antigen binding region which specifically binds to said first isoform of CD45 but not to the second isoform of CD45, thereby avoiding eventual severe side effects due to transplantation of said immune cells.
  • the immune cell is redirected against a cancer antigen.
  • cancer antigen is meant any antigen (i.e., a molecule capable of inducing an immune response) which is associated with cancer.
  • An antigen as defined herein may be any type of molecule which induces an immune response, e.g., it may be a polysaccharide or a lipid, but most preferably it is a peptide (or protein).
  • Human cancer antigens may be human or human derived.
  • a cancer antigen may be a tumor-specific antigen, by which is meant an antigen which is not found in healthy cells. Tumor-specific antigens generally result from mutations, in particular frame-shift mutations which generate a wholly new amino acid sequence not found in the healthy human proteome.
  • Cancer antigens also include tumor-associated antigens, which are antigens whose expression or production is associated with, but not limited to, tumor cells.
  • tumor-associated antigens include for instance Her2, prostate stem cell antigen (PSCA), alpha-fetoprotein (AFP), carcinoembryonic antigen (CEA), cancer antigen- 125 (CA-125), CA19-9, calretinin, MUC-1, epithelial membrane protein (EMA), epithelial tumor antigen (ETA), tyrosinase, melanoma-associated antigen (MAGE), CD34, CD45, CD99, CD117, CD123, chromogranin, cytokeratin, desmin, glial fibrillary acidic protein (GFAP), gross cystic disease fluid protein (GCDFP-15), HMB-45 antigen, protein melan-A (melanoma antigen recognized by T lymphocytes; MART-1), myo-DI, muscle-specific actin, neurofilament, neuron- specific eno
  • said tumor-associated antigen or tumor-specific antigen is integrin av
  • the immune cell for use in adoptive cell transfer therapy, preferably for the treatment of malignant hematopoietic disease such as acute myeloid leukemia (AML) or B- acute lymphoblastic leukemia (B-ALL), expresses a recombinant antigen binding region such as a CAR targeting CD45. Said cell expressing the first isoform and expressing the CAR (e.g.
  • CAR- CD45 can be further specifically depleted by administering a depleting agent comprising a second antigenbinding region which binds specifically to the first isoform of CD45, but does not bind or binds substantially weaker to the second isoform of CD45, thereby avoiding eventual severe side effects such as graft-versus-host disease due to the transplantation.
  • said immune cell e.g. T cell
  • said immune cell expressing the first isoform harbors a CAR targeting CD45, said CAR comprising an antigen-binding region, e.g. scFv, comprising an antigen-binding region which binds specifically to an epitope of CD45 located within the N-terminal domain, or within the polypeptide including the amino acids E230, Y232, N255, N257, E259, T264, N267, E269, N286, S287, D292, 1328, T330, F331, D334, Y340, K352, E353, E360, E364, Y372 and/or Y373 of SEQ ID NO: 1, more preferably amino acids E230, N257, E259, F331, K352 and/or E353 of SEQ ID NO: 1.
  • said immune cell e.g., T cell
  • said immune cell expressing first isoform harbors a CAR targeting CD45 comprising an antigen-binding region, e.g. scFv, comprising a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 20, VHCDR2 is SEQ ID NO: 21 and VHCDR3 is SEQ ID NO: 22; and b) an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 23, VLCDR2 is SEQ ID NO: 24 and VLCDR3 is SEQ ID NO: 25, more preferably comprising an antigen-binding region comprising a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 18 and/or a light chain variable domain comprising or consisting of the amino acid sequence of SEQ ID
  • the cell expressing the first isoform of CD45 can be genetically engineered by introducing into said cell a nucleic acid construct (e.g., mRNA) encoding at least one gene editing enzyme or ribonucleoprotein complex comprising gene editing enzyme and/or HDR template as described above.
  • a nucleic acid construct e.g., mRNA
  • the gene editing system is transduced into said cells via a viral system, such as an adenoviral system.
  • Said cell can also be genetically engineered by further introducing into said cell a nucleic acid construct encoding a CAR as described above.
  • said method is an ex vivo method performed on a culture of cells.
  • nucleic acid construct refers to a nucleic acid molecule resulting from the use of recombinant DNA technology.
  • a nucleic acid construct is a nucleic acid molecule, either single- or double-stranded, which has been modified to contain segments of nucleic acid sequences, which are combined and juxtaposed in a manner, which would not otherwise exist in nature.
  • a nucleic acid construct usually is a "vector", i.e., a nucleic acid molecule which is used to deliver exogenously created DNA into a host cell.
  • the nucleic acid construct comprises said gene editing enzyme, HDR template and/or CAR, operably linked to one or more control sequences.
  • Said control sequences may be a ubiquitous, tissue-specific or inducible promoter which is functional in cells of target organs (i.e., hematopoietic cell).
  • Such sequences which are well-known in the art include in particular a promoter, and further regulatory sequences capable of further controlling the expression of a transgene, such as without limitation, enhancer, terminator, intron, silencer.
  • the nucleic acid construct as described above may be contained in an expression vector.
  • the vector may be an autonomously replicating vector, i.e., a vector that exists as an extra- chromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid, an extra-chromosomal element, a mini-chromosome, or an artificial chromosome.
  • the vector may contain any means for assuring self-replication.
  • the vector may be one that, when introduced into the host cell, is integrated into the genome and replicated together with the chromosome(s) into which it has been integrated.
  • vectors examples include, but are not limited to, recombinant integrating or non-integrating viral vectors and vectors derived from recombinant bacteriophage DNA, plasmid DNA or cosmid DNA.
  • the vector is a recombinant integrating or nonintegrating viral vector.
  • recombinant viral vectors include, but not limited to, vectors derived from herpes virus, retroviruses, lentivirus, vaccinia viruses, adenoviruses, adeno-associated viruses or bovine papilloma virus.
  • the present disclosure relates to a method for expressing a first isoform of a cell surface protein in a cell by introducing into said cell a nucleic acid construct (e.g. mRNA) encoding the gene editing enzyme or ribonucleoprotein complex comprising gene editing enzyme and/or HDR template as described above.
  • Said method may further comprise a step of introducing into said cell a nucleic acid construct encoding a CAR.
  • Said method involves introducing gene editing enzyme such as Cas protein, base editor or prime editor and guide RNA (crRNA, tracrRNa, or fusion guide RNA or pegRNA) into a cell.
  • said gene editing enzyme is CRISPR/Cas gene editing enzyme as described above.
  • said gene editing enzyme is a site-specific nuclease, more preferably CRISPR/Cas nuclease comprising a guide RNA and Cas protein, wherein said guide RNA in combination with Cas protein cleaves and induces cleavage within said target sequence comprising a nucleic acid encoding surface protein region involved in agent binding as described above.
  • Said Cas nuclease may be a high fidelity Cas nuclease such as a high fidelity Cas9 nuclease.
  • Said gene editing enzyme, preferably guide RNA and/or Cas protein, base editor or prime editor as described above may be synthesized in situ in the cell as a result of the introduction of nucleic acid construct, preferably expression vector encoding said gene editing enzyme such as guide RNA and/or Cas protein, base editor or prime editor as described above into the cell.
  • said gene editing enzyme such as guide RNA and/or Cas protein, base editor or prime editor may be produced outside the cell and then introduced thereto.
  • Said nucleic acid construct or expression vector can be introduced into cell by any methods known in the art and include, as non-limiting examples, stable transduction methods in which the nucleic acid construct or expression vector is integrated into the cell genome, transient transfection methods in which the nucleic acid construct or expression vector is not integrated into the genome of the cell and virus-mediated methods.
  • transient transformation methods include for example microinjection, electroporation, cell squeezing, particle bombardment or in vivo targeting approaches.
  • the cell expressing the first isoform of CD45 may also be edited in vivo.
  • the molecular machinery to convert CD45 into a first isoform of CD45 which is not recognized by the depleting agent can be accomplished by any of these methods.
  • the present disclosure relates a pharmaceutical composition
  • a pharmaceutical composition comprising molecular machinery capable of in vivo editing a gene and a depleting agent, wherein said molecular machinery capable of in vivo editing a gene comprises all components required to introduce a point mutation of wild type CD45 in a target cell into an isoform of CD45, and wherein said depleting agent binds to wild type CD45, but not to said isoform of CD45 for use in a medical treatment in a patient in need thereof.
  • said isoform of CD45 is characterized by a substitution of the lysine at position 352 of wild type CD45 to a glutamic acid.
  • said isoform of CD45 is characterized by a substitution of the lysine at position 352 of wild type CD45 to an aspartic acid.
  • said isoform of CD45 is characterized by a substitution of the lysine at position 352 of wild type CD45 to a histidine.
  • said isoform of CD45 is characterized by a substitution of the lysine at position 353 of wild type CD45 to a lysine.
  • said isoform of CD45 is characterized by a substitution of the lysine at position 353 of wild type CD45 to a arginine.
  • said depleting agent comprises i. an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6, and ii. an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 7, VLCDR2 is SEQ ID NO: 8 and VLCDR3 is SEQ ID NO: 9.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ ID NO: 4
  • VHCDR2 is SEQ ID NO: 5
  • VHCDR3 is SEQ ID NO: 6
  • VL antibody light chain variable domain
  • said depleting agent comprises i. an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6, and ii. an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 60, VLCDR2 is SEQ ID NO: 61 and VLCDR3 is SEQ ID NO: 9.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ ID NO: 4
  • VHCDR2 is SEQ ID NO: 5
  • VHCDR3 is SEQ ID NO: 6
  • VL antibody light chain variable domain
  • said isoform of CD45 is characterized by a substitution of the asparagine at position 257 of wild type CD45 to a glutamic acid.
  • said isoform of CD45 is characterized by a substitution of the asparagine at position 257 of wild type CD45 to a lysine.
  • said isoform of CD45 is characterized by a substitution of the asparagine at position 257 of wild type CD45 to an arginine.
  • said isoform of CD45 is characterized by a substitution of the asparagine at position 257 of wild type CD45 to a threonine.
  • said isoform of CD45 is characterized by a substitution of the glutamic acid at position 259 of wild type CD45 to a valine.
  • said isoform of CD45 is characterized by a substitution of the glutamic acid at position 259 of wild type CD45 to a glycine.
  • said isoform of CD45 is characterized by a substitution of the tyrosine at position 232 of wild type CD45 to a cysteine.
  • said isoform of CD45 is characterized by a substitution of the asparagine at position 286 of wild type CD45 to an aspartic acid.
  • said depleting agent comprises i. an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 20, VHCDR2 is SEQ ID NO: 21 and VHCDR3 is SEQ ID NO: 22, and ii. an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 23, VLCDR2 is SEQ ID NO: 24 and VLCDR3 is SEQ ID NO: 25.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ ID NO: 20
  • VHCDR2 is SEQ ID NO: 21
  • VHCDR3 is SEQ ID NO: 22
  • VL antibody light chain variable domain
  • said depleting agent comprises i. an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 12, VHCDR2 is SEQ ID NO: 13 and VHCDR3 is SEQ ID NO: 14, and ii. an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 15, VLCDR2 is SEQ ID NO: 16 and VLCDR3 is SEQ ID NO: 17.
  • VH antibody heavy chain variable domain
  • VHCDR1 is SEQ ID NO: 12
  • VHCDR2 is SEQ ID NO: 13
  • VHCDR3 is SEQ ID NO: 14
  • VL antibody light chain variable domain
  • the present disclosure relates to a human cell or a population of human cells expressing a first isoform of CD45 for use in a medical treatment in a patient in need thereof, said patient having cells expressing a second isoform of CD45, wherein said human cell expressing said first isoform comprises genomic DNA with at least one polymorphism or genetically engineered allele, wherein said polymorphism or genetically engineered allele is not present in the genome of the patient having cells expressing said second isoform of CD45, and wherein said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid in position E230, Y232, N255, N257, E259, T264, N267, E269, N286, S287, D292, 1328, T330, F331, D334, Y340, K352, E353, E360, E364, Y372 or Y373 of SEQ ID NO: 1.
  • said medical treatment comprises administering a therapeutically efficient amount of said cell or population of cells expressing said first isoform of CD45 to said patient in need thereof, in combination with a therapeutically efficient amount of a depleting agent comprising an antigen-binding region that binds specifically to said second isoform of CD45 to specifically deplete patient cells expressing said second isoform of CD45.
  • said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid in position N286, F331, K352 or E353 of SEQ ID NO: 1.
  • said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid in position N286, F331, K352 or E353 of SEQ ID NO: 1, and said depleting agent comprises an antigen-binding region, selected from a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6; and an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 7, VLCDR2 is SEQ ID NO: 8, VLCDR3 is SEQ ID NO: 9, more preferably wherein said first antigen binding region comprises a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 2 and/or a light chain variable domain comprising or consisting of the amino acid
  • said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid in position F331, K352 or E353 of SEQ ID NO: 1, and said depleting agent binds to the same epitope as an antigen-binding region, selected from a) an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 4, VHCDR2 is SEQ ID NO: 5 and VHCDR3 is SEQ ID NO: 6; and an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 7, VLCDR2 is SEQ ID NO: 8, VLCDR3 is SEQ ID NO: 9, more preferably wherein said first antigen binding region comprises a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 2 and/or a light chain variable domain comprising or
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position K352 of SEQ ID NO: 1.
  • said substitution of the amino acid in position K352 of SEQ ID NO: 1 is selected from K352E, K352H, K352I, K352L, K352M, K352N, K352Q, K352S and K352T, preferably wherein said substitution is K352D, K352E and K352H, and more preferably wherein said substitution is K352E.
  • said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid in position E230, Y232, N257, E259 or N286 of SEQ ID NO: 1.
  • said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid in position E230, Y232, N257, E259 or N286 of SEQ ID NO: 1, and said depleting agent comprises an antigen-binding region comprising an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 20, VHCDR2 is SEQ ID NO: 21 and VHCDR3 is SEQ ID NO: 22; and an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 23, VLCDR2 is SEQ ID NO: 24, VLCDR3 is SEQ ID NO: 25, more preferably wherein said first antigen binding region comprises a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 18 and/or a light chain variable domain comprising or consisting of the amino
  • said polymorphic or genetically engineered allele is characterized by at least one substitution of an amino acid in position E230, Y232, N257, E259 or N286 of SEQ ID NO: 1, and said depleting agent binds to the same epitope as an antigen-binding region comprising an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 20, VHCDR2 is SEQ ID NO: 21 and VHCDR3 is SEQ ID NO: 22; and an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 23, VLCDR2 is SEQ ID NO: 24, VLCDR3 is SEQ ID NO: 25, more preferably wherein said first antigen binding region comprises a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 18 and/or a light chain variable
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position N257 of SEQ ID NO: 1.
  • said substitution of the amino acid in position in position N257 of SEQ ID NO: 1 is a N257E, N257K, N257R or N257T substitution, preferably wherein said substitution is a N257R substitution.
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position E259 of SEQ ID NO: 1.
  • said substitution of the amino acid in position in position E259 of SEQ ID NO: 1 is a E259N, a E259Q, a E259V or a E259G substitution, preferably wherein said substitution is a E259V substitution.
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position Y232 of SEQ ID NO: 1, preferably wherein said substitution is a Y232C substitution.
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position N286 of SEQ ID NO: 1, preferably wherein said substitution is N286D.
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position N257 of SEQ ID NO: 1.
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position N257 of SEQ ID NO: 1
  • said depleting agent comprises an antigen-binding region comprising an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 12, VHCDR2 is SEQ ID NO: 13 and VHCDR3 is SEQ ID NO: 14; and an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 15, VLCDR2 is SEQ ID NO: 16, VLCDR3 is SEQ ID NO: 17, preferably wherein said first antigen binding region comprises a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position N257 of SEQ ID NO: 1, and said depleting agent binds to the same epitope as an antigen-binding region comprising an antibody heavy chain variable domain (VH) comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3 wherein VHCDR1 is SEQ ID NO: 12, VHCDR2 is SEQ ID NO: 13 and VHCDR3 is SEQ ID NO: 14; and an antibody light chain variable domain (VL) comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3 wherein VLCDR1 is SEQ ID NO: 15, VLCDR2 is SEQ ID NO: 16, VLCDR3 is SEQ ID NO: 17, preferably wherein said first antigen binding region comprises a heavy chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO: 10 and/or a light chain variable domain comprising or consisting of the amino acid sequence of SEQ ID NO:
  • said polymorphic or genetically engineered allele is characterized by a substitution of the amino acid in position N257 of SEQ ID NO: 1.
  • said substitution of the amino acid in position in position N257 of SEQ ID NO: 1 is a N257E, N257K, N257R or N257T substitution, preferably wherein said substitution is a N257R substitution.
  • the present disclosure also provides a pharmaceutical composition
  • a pharmaceutical composition comprising cells or a population of cells expressing a first isoform of CD45 as described above with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
  • said cell expressing the first isoform of CD45 is a hematopoietic stem cell.
  • said cell expressing said first isoform of CD45 is an immune cell, preferably a T-cell, more preferably a primary T cell, bearing a chimeric antigen receptor (CAR), preferably a CAR which targets the second isoform of CD45 expressed by said patient's cells as described above.
  • an immune cell preferably a T-cell, more preferably a primary T cell, bearing a chimeric antigen receptor (CAR), preferably a CAR which targets the second isoform of CD45 expressed by said patient's cells as described above.
  • CAR chimeric antigen receptor
  • the pharmaceutical composition may further comprise a depleting agent comprising a first or second antigen binding region as described above.
  • the pharmaceutical composition is formulated in a pharmaceutically acceptable carrier according to the route of administration.
  • the composition is formulated to be administered by intravenous injection.
  • Pharmaceutical compositions suitable for such administration may comprise the cells expressing first isoform as described above, in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions (e.g., balanced salt solution (BSS)), dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes or suspending or thickening agents.
  • BSS balanced salt solution
  • the composition comprising cells expressing first isoform of CD45 may be frozen for storage at any temperature appropriate for storage of the cells.
  • the cells may be frozen at about -20° C, -80° C or any other appropriate temperature.
  • Cryogenically frozen cells may be stored in appropriate containers and prepared for storage to reduce risk of cell damage and maximize the likelihood that the cells will survive thawing.
  • the cells may also be maintained at room temperature of refrigerated, e.g., at about 4° C.
  • the present disclosure relates to the cell or population of cells expressing a first isoform od CD45 as described above for use as a medicament, in particular for use in immunotherapy such as adoptive cell transfer therapy in a patient.
  • said cell or population of cells e.g., hematopoietic cells
  • said medical treatment comprises administering a therapeutically efficient amount of cell or population of cells expressing said first isoform of CD45, in combination with a therapeutically efficient amount of a depleting agent (e.g. a CAR cell or antibody) that binds specifically to the second isoform or first isoform of CD45 to specifically depleting the patients or the transplanted cells, respectively.
  • a depleting agent e.g. a CAR cell or antibody
  • the term "in combination” or “in combination therapy” means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated or treatment has ceased for other reasons.
  • the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as “simultaneous" or “concurrent delivery”.
  • the delivery of one treatment ends before the delivery of the other treatment begins. The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
  • a depleting agent that binds to a second isoform or a first isoform of CD45 is administered at a dose and/or dosing schedule described herein, and the cells expressing the first isoform are administered at a dose and/or a dosing schedule described herein.
  • "in combination with,” is not intended to imply that the depleting agent targeting the second (e.g. CAR cells or antibody recognizing a second isoform of CD45) or the first isoform of CD45 and compositions of cells expressing said first isoform of CD45, must be administered at the same time and/or formulated for delivery together, although these methods of delivery are within the scope of this disclosure.
  • the depleting agent e.g.
  • CAR cells or antibody targeting a second isoform of CD45 can be administered concurrently with, prior to or subsequent to a dose of the hematopoietic stem cells expressing the first isoform of CD45.
  • each agent will be administered at a dose and/or on a time schedule determined for that particular agent.
  • Adoptive cell transfer therapy can be used to treat patients diagnosed with cancer, genetic disease, autoimmune disease, infectious disease, a disease requiring a hematopoietic stem cell transplantation (HSCT), the prevention of organ rejection, the tumor conditioning regimen, tumor maintenance treatment, minimal residual disease, the prevention of relapse.
  • HSCT hematopoietic stem cell transplantation
  • the present disclosure also relates to the use of cells expressing a first isoform of CD45 as described above in the manufacture of a medicament for adoptive transfer cell therapy in a patient.
  • the term "subject”, or “patient” refers to an animal, preferably to a mammal in which an immune response can be elicited including human, pig, chimpanzee, dog, cat, cow, mouse, rabbit or rat. More preferably, the patient is a human, including adult, child and human at the prenatal stage.
  • treatment refers to any act intended to ameliorate the health status of patients such as therapy, prevention, prophylaxis and retardation of the disease.
  • such term refers to the amelioration or eradication of a disease or symptoms associated with a disease.
  • this term refers to minimizing the spread or worsening of the disease resulting from the administration of one or more therapeutic agents to a subject with such a disease.
  • Cancers that may be treated include tumors that are not vascularized, or not yet substantially vascularized, as well as vascularized tumors.
  • the cancers may comprise nonsolid tumors (such as hematological tumors, for example, leukemias and lymphomas including relapses and treatment-related tumors e.g. secondary malignancies after use of cytotoxic therapy and hematopoietic stem cell transplantation (HSCT)) or may comprise solid tumors.
  • nonsolid tumors such as hematological tumors, for example, leukemias and lymphomas including relapses and treatment-related tumors e.g. secondary malignancies after use of cytotoxic therapy and hematopoietic stem cell transplantation (HSCT)
  • HSCT hematopoietic stem cell transplantation
  • autoimmune disease as used herein is defined as a disorder that results from an autoimmune response. An autoimmune disease is the result of an inappropriate and excessive response to a self-antigen.
  • Infectious disease is a disease caused by pathogenic microorganism such as bacteria, viruses, parasites or fungi.
  • infections according to the disclosure occur in immunosuppressed patients, such as patients after HSCT or patients who received a solid organ transplantation.
  • the present disclosure relates to a cell expressing first isoform of CD45 as described above for use in hematological cancer, preferably leukemia or lymphoproliferative disorders.
  • Said leukemia can be selected from the group consisting of: acute myelogenous leukemia (AML), myelodysplastic syndrome (MDS), blastic plasmacytoid dendritic cell neoplasm (BPDCN), myeloproliferative neoplasms (MPN) including chronic myelogenous leukemia (CML), myelodysplastic syndrome/myeloproliferative neoplasm (MDS/MPN) overlap syndromes including chronic myelomonocytic leukemia (CMML), chronic lymphoid leukemia (CLL), B- and T-cell non- hodgking lymphomas, acute biphenotypic leukemia, hairy cell leukemia, interleukin-3 receptor subunit alpha positive leukemia, B-cell acute lympho
  • said cell or population of cells e.g., hematopoietic cells
  • said cell or population of cells can be used for the treatment of solid tumor, in particular for selective depletion of myeloid cells in solid tumors in a patient, to enable immunotherapy agent such as immune checkpoint inhibitors, CAR T-cells or tumor infiltrating lymphocytes to access to tumors since myeloid cells in tumors can be immunosuppressive.
  • said cell or population of cells (e.g., hematopoietic cells) expressing a first isoform CD45 as described above can serve to replenish the hematopoietic system that might be affected by the treatment intended to deplete the myeloid cells in solid tumors.
  • said cell or population of cells e.g., hematopoietic cells
  • said cell or population of cells e.g., hematopoietic cells
  • a first isoform of CD45 as described above can be used for the treatment of autoimmune disease such as lupus, multiple sclerosis, scleroderma or systemic sclerosis.
  • the disclosure also relates to depleting agents (for example CAR cell composition or antibodies) comprising a first or a second antigen binding region for use in selectively depleting the host cells or transferred cells respectively, in a subject in need thereof.
  • depleting agents for example CAR cell composition or antibodies
  • said cell or population of cells e.g. hematopoietic cells
  • said medical treatment comprises administering a therapeutically efficient amount of said cells or population of cells expressing said first isoform of CD45, in combination with a therapeutically efficient amount of a depleting agent (e.g. a CAR cell or antibody) that binds specifically to a second isoform of CD45.
  • a depleting agent e.g. a CAR cell or antibody
  • immunodepleting agent such as a CAR expressing immune cells directed to CD45
  • a CAR expressing immune cells directed to CD45 can be administered to a patient to target and kill tumoral cells.
  • tumoral surface proteins are also expressed at the surface of normal hematopoietic cells
  • this strategy can induce severe side effects to the patients by altering hematopoiesis.
  • hematopoietic cells can be subsequently transplanted into the patient.
  • these cells need to be resistant to said agent, i.e., the depleting agent for CD45 expressing cells, in order not to be targeted by it.
  • the depleting agent comprising a first antigen binding region which binds specifically to a second isoform of CD45 can be administered to ablate specifically patient cells expressing said second isoform of CD45 and not transplanted cells expressing said first isoform of CD45.
  • the selective depletion of patient cells, but not transplanted cells allows to reconstitute the patient with a healthy hematopoietic system which will no longer be depleted by immunodepleting agent.
  • the patients have a functional immune system rather than go through a prolonged phase of immunodepression.
  • the use of cells according to the present disclosure eliminates infections as a major complication of current HSC transplantation.
  • the present disclosure relates to a method for adoptive cell transfer therapy, preferably for hematopoietic stem cell transplantation to restore normal hematopoiesis in a patient having cells expressing a second isoform of CD45 comprising:
  • a cell e.g. hematopoietic stem cells
  • said cell expressing said first isoform of CD45 comprises genomic DNA with at least one polymorphic allele, preferably single nucleotide polymorphism (SNP) allele, or a genetically engineered allele in the nucleic acid encoding said first isoform and wherein said polymorphism is not present in the genome of the patient having cells expressing said second isoform of CD45 or a pharmaceutical composition thereof;
  • the depleting agent e.g., CAR cells or antibody targeting a second isoform of CD45 is administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, 12 weeks, or 16 weeks before), or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, 12 weeks, or 16 weeks after) a dose of the hematopoietic stem cells expressing a first isoform of said surface protein (e.g., a first isoform of CD45).
  • a dose of the hematopoietic stem cells expressing a first isoform of said surface protein
  • a “therapeutically efficient amount” or “effective amount” is intended a number of cells, in particular hematopoietic stem cells expressing the first isoform of CD45 as described above administered to a subject that is sufficient to constitute a treatment as defined above, in particular restoration of normal hematopoiesis in a patient.
  • the administration of the cell or pharmaceutical composition according to the present disclosure may be carried out in any convenient manner, including injection, transfusion, implantation or transplantation.
  • the compositions described herein may be administered to a patient subcutaneously, intradermal, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous or intra lymphatic injection, or intraperitoneally.
  • the cells or pharmaceutical compositions of the present disclosure are preferably administered by intravenous injection.
  • the cells or pharmaceutical compositions of the present disclosure may be injected directly into a tumor, lymph node, or site of infection.
  • the administration of the cells or population of cells can consist of the administration of 10 4 -10 9 cells per kg body weight, preferably 10 5 to 10 7 cells/kg body weight, more preferably 2xl0 6 -5xl0 6 cells per kg body weight including all integer values of cell numbers within those ranges.
  • the dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.
  • the cells or population of cells can be administrated in one or more doses. Timing of administration is within the judgment of managing physician and depends on the clinical condition of the subject.
  • the cells or population of cells may be obtained from any source, such as a blood bank or a donor. While individual needs vary, determination of optimal ranges of effective amounts of a given cell type for a particular disease or conditions within the skill of the art.
  • the disclosure also relates to depleting anti- CD45 agents as disclosed above (for example CAR cell composition or antibodies) comprising a first antigen binding region for use in selectively depleting the host cells in a subject in need thereof.
  • depleting anti- CD45 agents as disclosed above (for example CAR cell composition or antibodies) comprising a first antigen binding region for use in selectively depleting the host cells in a subject in need thereof.
  • said cell or population of cells e.g. hematopoietic cells
  • said medical treatment comprises administering a therapeutically efficient amount of a cell or a population of cells expressing said first isoform of CD45, in combination with a therapeutically efficient amount of a depleting agent (e.g. a CAR cell or antibody) that binds specifically to said first isoform CD45.
  • a depleting agent e.g. a CAR cell or antibody
  • the cell or population of cells, preferably immune cells expressing the first isoform of CD45 of the present disclosure is particularly used in adoptive transfer cell transfer therapy into a patient.
  • Said transplanted cell expressing said first isoform of CD45 can be further depleted in patients by administering a therapeutically efficient amount of a depleting agent comprising a second antigen binding region which specifically binds to the first isoform of CD45 particularly and does not bind or binds substantially weaker to the second isoform of CD45 expressed by patient's cells to avoid eventual severe side effects such as graft-versus-host disease due to the transplantation.
  • said agent comprising a second antigen-binding region which binds specifically to said first isoform of CD45 (expressed by transplanted cell) is administered to deplete specifically transplanted cells and not patient cells. Selective depletion of the transplanted cells constitutes an important safety feature by providing a "safety switch".
  • Graft-versus-host disease relates to a medical complication following the receipt of transplanted tissue from a genetically different person. Immune cells in the donated tissue (the graft) recognize the recipient (the host) as foreign.
  • the medical condition is graft-versus-host disease caused by hematopoietic stem cell transplantation or adoptive cell transfer therapy wherein immune cells are transferred into patient.
  • Said side effects can also occur when transplanted cells, particularly immune cells harboring a CAR have severe side effects such as cytokine release syndrome and/or neurotoxicity.
  • the transplanted cells expressing the first isoform of CD45 can be eliminated when said cells become malignant or cause any type of unwanted on-target or off -target damage as a safety switch.
  • the present disclosure relates to a method for adoptive cell transfer therapy in a patient having cells expressing a second isoform of CD45 comprising:
  • the depleting agent e.g. CAR cells or antibody targeting a second isoform of CD45
  • the depleting agent is administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, 12 weeks, or 16 weeks before), or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, 12 weeks, or 16 weeks after) a dose of the hematopoietic stem cells expressing a first isoform of CD45.
  • the administration of the cells or pharmaceutical composition according to the present disclosure may be carried out in any convenient manner, including injection, transfusion, implantation or transplantation.
  • the compositions described herein may be administered to a patient subcutaneously, intradermal, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous or intra lymphatic injection, or intraperitoneally.
  • the cells or pharmaceutical compositions of the present disclosure are preferably administered by intravenous injection.
  • the cells or pharmaceutical compositions of the present disclosure may be injected directly into a tumor, lymph node, or site of infection.
  • the administration of the cells or population of cells can consist of the administration of 10 4 -10 9 cells per kg body weight, preferably 10 5 to 10 7 cells/kg body weight including all integer values of cell numbers within those ranges.
  • the dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.
  • the cells or population of cells can be administrated in one or more doses. Timing of administration is within the judgment of managing physician and depends on the clinical condition of the subject.
  • the cells or population of cells may be obtained from any source, such as a blood bank or a donor. While individual needs vary, determination of optimal ranges of effective amounts of a given cell type for a particular disease or conditions within the skill of the art.
  • the disclosure relates to a depleting agent (e.g. a CAR cell or an antibody) for use in preventing or reducing the risk of severe side effects in a patient having received a cell expressing a first isoform of CD45 as described above, wherein said patient have native cells expressing a second isoform of CD45, and wherein said depleting agent comprising at least a second antigen-binding region which binds specifically to said first isoform of CD45 and does not bind or binds substantially weaker to said second isoform of CD45.
  • a depleting agent e.g. a CAR cell or an antibody
  • the present disclosure relates to a kit for expressing a first isoform CD45 as describe above into a cell, said kit comprising a gene editing enzyme, such as guide RNA in combination with a Cas protein, base editor or prime editor, nucleic acid construct, expression vector as described above or isolated cell according to the present disclosure.
  • a gene editing enzyme such as guide RNA in combination with a Cas protein, base editor or prime editor, nucleic acid construct, expression vector as described above or isolated cell according to the present disclosure.
  • the present disclosure relates to a human cell or population of human cells according to the present disclosure for a medical use, wherein said medical use comprises administering a therapeutically efficient amount of said human cell or population of human cells expressing said first isoform of CD45 to said patient in need thereof in combination with a therapeutically efficient amount of a depleting agent comprising at least a second antigen-binding region that binds specifically to said first isoform of CD45 to specifically deplete transferred cells expressing first isoform of CD45, preferably for use in adoptive cell transfer therapy, more preferably for the treatment of malignant hematopoietic disease such as acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), T-cell non-Hodgkin lymphomas (T-NHLs), chronic myeloid leukemia (CML), hairy cell leukemias (HCL), T-cell acute lymphoblastic leukemia (T-ALL), non- Hodgkin's lymphoma (NHL) or
  • AML
  • Refmab's #1, #2 and #5 Five different anti- CD45 antibodies were generated in Fab and MAb format based on publicly available sequence information or sources. Variable chains and CDRs (Kabat) of the antibodies (Refmab's #1, #2 and #5) are shown in Table 5.
  • Refmab #3 (HI30) is a mouse hybridoma antibody available from Biolegend (#304001).
  • Refmab #5 (2D1) is a mouse hybridoma antibody available from R&D Systems (#MAB1430).
  • DF-1 cells (ATCC number CRL-12203) were transfected with a construct containing wild- type CD45 (SEQ ID No. 1) or with an empty vector. Binding of the antibodies to the transfected cells and the optimal assay conditions were evaluated in 384-well format. Detection of cellular expression was measured via high-throughput flow cytometry. Serial dilutions of each antibody were tested for immunoreactivity against cells expressing CD45 or vector alone. The optimal screening concentration for each antibody was determined based on the raw signal values and signal-to-background calculations. Results are shown in Figure 1. Each point represents the mean of four replicates. All five antibodies in Mab format bind to human CD45 in a concentration dependent manner. Cell transfected with the empty vector did not show any binding to anti-human CD45 antibodies.
  • alanine scan on human CD45 was performed to the determine the residues on CD45 that are involved in binding to the antibodies investigated.
  • the alanine scan was performed via shotgun mutagenesis epitope mapping (Integral Molecular, Philadelphia/PA, USA) as described in Immunology (2014) 143, 13-20. Briefly, a mutation library of CD45 was created by high-throughput, site-directed mutagenesis. Each residue was individually mutated to alanine, with alanine codons mutated to serine. The mutant library was arrayed in 384-well microplates and transiently transfected into DF-1 cells.
  • Mutated residues were identified as being critical to the antibody epitope if they did not support the reactivity of the test antibody but did support the reactivity of the control antibody, which was in each case another anti-CD45 RefMab, e.g., for RefMab #1 RefMab #2 was used as control antibody, and for RefMab #3 RefMab #4 was used as control antibody.
  • This counter-screen strategy facilitates the exclusion of mutants that are locally misfolded or that have an expression defect. Binding of each antibody to each mutant clone was determined in duplicates. For each point, background fluorescence was subtracted from the raw data, which were then normalized to antibody reactivity with wild type CD45.
  • Table 10 summarizes the critical residues for each of the antibodies tested. Residues whose mutations gave the lowest reactivities with specific antibodies are highlighted in bold and are underlined. Validated critical residues represent amino acids whose side chains make the highest energetic contributions to the antibody-epitope interaction (J.
  • Example 4 The critical residues identified in Example 4 were investigated in more detail. First, a validation step of identified critical residues was performed considering reproducibility of binding activity, surface accessibility, structural localization and distance to other critical sites, as well as the nature and biochemical properties of the substituted amino acid (e.g. cysteine forming disulfide bridges or post -translational modification sites). After validation, each critical residue was subject to comprehensive mutagenesis to selected biophysically appropriate non-alanine amino acids, based on sequence and structure-related properties of the substituted amino acid as well as the newly introduced ones.
  • a validation step of identified critical residues was performed considering reproducibility of binding activity, surface accessibility, structural localization and distance to other critical sites, as well as the nature and biochemical properties of the substituted amino acid (e.g. cysteine forming disulfide bridges or post -translational modification sites). After validation, each critical residue was subject to comprehensive mutagenesis to selected biophysically appropriate non-alanine amino acids, based on sequence and structure-related properties of the
  • Antibodies were screened for binding to the human CD45 variants in IgG format. As in Example 4, binding of each test antibody to each mutant clone in the comprehensive library was determined in duplicate by high-throughput flow cytometry. For each mutation, background fluorescence was subtracted from the raw data, which were then normalized to antibody reactivity with wild-type CD45. Mean binding reactivities and ranges are listed in Table 11 for all mutant clones. Mutations that caused binding below 20% are highlighted in grey.
  • Table 12 summarizes the variants that reduce binding of the tested antibodies to below
  • Figure 4 schematically depicts the location of the identified variants on the 3D structure of human CD45.
  • Refmab #1 binds to a region different to that of the other tested antibodies, with the key variants identified being located between positions 328 and 373. Specifically, variants at the following position were identified for which Refmab #1 showed binding of less than 20% as compared to wild type CD45: residues E259, N286, 1328, T330, F331, D334, Y340, K352, E353, Y372 and Y373. A comparison of binding of the antibodies tested to some of these variants is shown in Figure 5. Of the variants identified some seem to be less preferred, e.g. F331G which is part of a non-conserved loop in a low accessible side chain.
  • Variants F331, in particular F331G, variant K352, in particular variants K352E, K352H, K352I, K352L, K352M, K352N, K352Q, K352S and K352T, and variant K353, in particular variants E353H, E353K and E353R are particularly preferred variants.
  • variants were identified that inhibited binding of Refmab #2 to less than 20% as compared to CD45 wildtype: N257, E259, Y340 and Y372.
  • a comparison of binding of the antibodies tested to some of these variants is shown in Figure 6.
  • Variant N257 in particular variants N257D, N257E, N257R and N257T are particularly preferred variants.
  • variant N257K which was not tested, by analogy is a preferred variant.
  • variants were identified that inhibited binding of Refmab #4 to less than 20% as compared to CD45 wildtype: E230, N257, E259, T264, N267, N286, S287, D292, F331, D334, Y340, K352, E353 and Y373.
  • a comparison of binding of the antibodies tested to some of these variants is shown in Figure 7.
  • Variant E230, in particular variants E230K and E230R, variant E259, in particular variants E259N and E259Q, and variant N257, in particular variants N257M, N257P, N257T, N257H, N257R, N257S and N257V are particularly preferred variants.
  • PROVEAN scores (PLoS ONE (2012); 7(10): e46688; Choy (2012), In Proceedings of the ACM Conference on Bioinformatics, Computational Biology and Biomedicine (BCB '12). ACM, New York, NY, USA, 414-417) were generated for candidate single amino acid substitutions at selected position of CD45.
  • a delta alignment score is computed for each sequence belonging to the top clusters of closely related sequences, i.e., supporting sequence set. Delta scores are then averaged within and across clusters to generate the final PROVEAN score. If the predicted PROVEAN score is equal to or below(above) a given threshold (-2.5), the protein variant is predicted to have a deleterious(neutral) impact on protein function.
  • Base editing was used to test and verify that human CD45 is amenable to mutation via base editing.
  • GFP positive cells were then expanded for 2 more days in ImL of RPMI-1640 (Sigma-Aldrich Ref:R8758-500ML) supplemented with 10% FCS and 100X GlutaMAX (ThermoFisher Scientific Ref:35050061) and Penicillin-Streptomycin (1/1000). 72h after the initial coelectroporation, we extracted the gDNA for each condition performed PCR of the corresponding screened exons (9, 10 and 11). PCR products were then sent for sanger sequencing with the correct forward primer.
  • hCD45_Exon9_For ACAAGCTGAGGTCCTTGTTAG (SEQ ID No. 26)
  • hCD45_Exon9_Rev AGCAGAAAGTTCACCCACTTG (SEQ ID No. 27)
  • hCD45_ExonlO_For CCATAGCAATCTCAATCCTTGCC (SEQ ID No. 28)
  • hCD45_ExonlO_Rev TGCCTGTGTATAACAATTGCCAAG (SEQ ID No. 29)
  • hCD45_Exonll_For TGACCTCAAGCTATGTATATGAGG (SEQ ID No. 30)
  • hCD45_Exonll_Rev GAGACTGTTACCTCACACCATATAC (SEQ ID No. 31)
  • Table 13 and Figure 9 display the most interesting hits from the screen (single amino-acid changes and some other relevant variant candidates).
  • Variants to be generated were selected by computer aided rational design. The following variants were generated with the respective base editors and sg RNA mentioned: Table 13:
  • results are shown in Figure 9.
  • human CD45 is amenable to base editing.
  • variants 1328V, N255G, E360G, E259G, E364K, E269G can be successfully edited via base editing.
  • residues can be efficiently edited in K562 cells and human T cells while preserving the function of CD45.
  • This gene editing technology is therefore compatible with the variants identified in the present disclosure and can be used in a respective clinical setting, for example for a safety switch or shielding.
  • Example 8 Base editing can shield human T cells from antibody-drug conjugate mediated killing in vitro
  • Human primary T cells were isolated from donor PBMC using an EasySep Human T Cell Isolation Kit (Stemcell Technologies Ref:17951) following the manufacturer's recommendations. Isolated human T cells were then incubated in 200 pL of human medium in a 96 well plate (1.5e6 cells/mL) for 24 hours. On the next day, cells were activated at a concentration of 1.5e6 cells/mL by addition of IL-2 (150U/mL), 11-7 (5ng/mL), IL-15 (5ng/mL) and Dynabead Human T-Activator CD3/CD28 for T Cell Expansion and Activation (Gibco Ref:11132D) following the manufacturer's recommendation (1:1 ratio beads:cells). After 48h of incubation, cells were debeaded and were ready for electroporation.
  • IL-2 150U/mL
  • 11-7 5ng/mL
  • IL-15 5ng/mL
  • Dynabead Human T-Activator CD3/CD28 for T Cell Expan
  • Electroporated human T cells were electroporated with 7.5pg of ABE8e-NG mRNA (TriLink) and 7.5pg of sg7-E259G (SEQ ID NO. 33) or Sg44-I283M+H285R+N286D (ATATCTCATAATTCATGTAC; SEQ ID No. 64; Synthego) using a P3 Primary Cell 4D- NucleofectorX Kit L (Lonza) following the manufacturer's recommendation. Electroporated cells were expanded for 5 days in 48 well-plates in 1 mL of human medium with supplementation of 500U/mL of IL-2 and media renewal every 48 hours.
  • 5,000 bulk base edited T cells were incubated for 3 days in 100 pL of human medium with addition of different concentrations of Refmab#4-biotin-streptavidin-saporin (1:1 Refmab#4-biotin:saporin-streptavidin; pre-incubated 30min at room temperature before addition to the wells). After 3 days of incubation, all cells from each condition were collected, stained with Refmab#4-Ax647, Refmab#l-Ax488 and for viability and were resuspended in 200uL of FACS buffer for flow cytometry analysis.
  • the whole resuspension volume for each condition was then analyzed using a BD FACSAria III Cell Sorter (BD Biosciences). Live cells were sorted and sent for Sanger sequencing to assess the enrichment of base edits correlating with increasing concentrations of Refmab#4-biotin- streptavidin-saporin.
  • Results are shown in Figure 10.
  • PBS alone and unconjugated saporin (SAP) were used as negative control groups.
  • About a third of base edited cells lost binding to Refmab#4 (edited cells).
  • Increasing concentrations of Refmab#4-biotin:saporin-streptavidin resulted in an increasing depletion of unedited cells.
  • At the highest concentration (lnM) a complete depletion of unedited cells (Refmab #4+ cells) was observed when the antibody-toxin was added while edited cells persisted (Fig. 10A, Refmab #4 low cells).
  • Example 9 HDR-based gene editing renders human T cells resistant to killing by Refmab #1 conjugated to a toxin
  • Human T cells were isolated from PBMCs (peripheral blood mononuclear cells) by negative selection using the EasySepTM Human T Cell Isolation Kit (Stemcell Technologies ; Cat# 17951). Cells were rested 12h at 37C before they were activated for 2 days with Dynabeads Human-T cells Activator CD23/CD28 (Thermo Fischer; Cat. No. 111.31D) in 1:1 ratio supplemented with IL2, IL7 and IL15. Activated T cells were then electroporated with 60pmols of Cas9 conjugated to 120pmol of sgRNA using a Nucleofector 4D unit (Lonza) in P3 buffer and pulse EH115.
  • PBMCs peripheral blood mononuclear cells
  • Activator CD23/CD28 Thermo Fischer; Cat. No. 111.31D
  • Activated T cells were then electroporated with 60pmols of Cas9 conjugated to 120pmol of sgRNA using
  • HDR Homology Directed Repair
  • the variant used in this experiment is F331del, i.e. a CD45 variant lacking the phenylalanine residue at position 331. Electroporation of the cells with the RNP only, led to a knock-out of CD45, indicated by a loss-of-binding of Refmab's #1 and #3 ( Figure 11). Cells transfected with the HDR template encoding the point mutation lost binding to Refmab #1, but were still reactive to Refmab #3.
  • HDRT used for human T cells engineering are shown in Table 14:
  • CD34+ HSPCs were engineered to express F331del.
  • the cells were then incubated with antibody Optimus Pr/me-tesirine (see Example 18). Non-edited cells were depleted while CD45 KO and CD45 F331del cells were protected.
  • Example 10 Knock out of CD45 in cells and re-expression of CD45 variants in cell lines
  • K562 cells (ATCC CCL-243) were electroporated with RNP targeting CD45 utilizing a Nucleofector4D unit (Lonza).
  • the gRNA was the same as used in Example 9 (SEQ ID No. 51). 4 days after electroporation, cells were sorted for CD45KO and separated via limiting dilution to receive single clones. Clones were grown and sequenced. A clone with all alleles showing indels in the CD45 gene was selected.
  • Example 11 Engineering of shielding CD45 variants into human CD34+ HSPCs using HDR
  • the HDR template was the following sequence:
  • Electroporated cells were expanded for seven days and analyzed by FACS. Cells were stained with two different CD45 antibodies, one binding to the region of the mutation (Refmab #1) and the second antibody binding a different region (Refmab #3). Results shows the presence of 50% knock-out and 5-6% HDR-mediated knock-in cells (identified by the loss of binding of the antibody targeting the mutated epitope but the retention of the binding of the second antibody). See Figure 14.
  • Example 12 Expression of variants in DF-1 cells
  • DF-1 cells (ATCC number CRL-12203) show no staining upon incubation with antibodies against human CD45. Therefore, they are suitable cell lines to express human wild-type or mutant CD45 variants. DF-1 cells were transfected with a construct containing wild-type CD45 (SEQ ID No. 1) or with constructs containing mutant CD45 variants.
  • DF-1 cells were transfected with selected CD45 variants (K352E, K352H, N257R or N257T) or wild-type CD45 using Lipofectamine LipofectamineTM 3000 Transfection Reagent (Thermo Fischer Scientific, cat. L3000008). After 72 hours, the transfection efficiency, and the expression of CD45 were analyzed by FACS using the antibody Refmab #4 directly labeled to AlexaFluor 647 (APC) and the antibody Refmab #1 directly labeled with AlexaFluor 488 (FITC). Refmab #1 and Refmab #4 binds to different regions of CD45. Using this antibody combination, it is possible to evaluate the loss of binding of the antibody of interest to a specific mutation of CD45, while measuring the retention of the binding of the second antibody shows that the variant CD45 is still expressed by the cells, and structurally folded.
  • APC AlexaFluor 647
  • FITC AlexaFluor 488
  • Results are shown in Figure 19 (panel A: wild-type, panel B: K352E, panel C: K352H, panel D: N257R, panel E: N257T).
  • the wild-type protein binds to both antibodies, Refmab #1 and Refmab #4, whereas the K352E, K352H variants were detected with Refmab #4 only, and the N257R and N257T variants with the Refmab #1 only.
  • the protein sequence (residues 225-394) is histidine tagged at the C-terminus and contains few N- and C-terminal added amino acids important for crystal packing (full wt sequence ETGIEGRKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHN SCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKL ENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEGTKHHHHHHHH SEQ ID No.
  • Peak monomer (c7-cl0) and dimer fractions (where needed) were concentrated using lOkDa cut off Amicon centrifugal filter and protein aliquots were flash frozen in liquid nitrogen before storage at -150°C.
  • a monomeric, CD45 D1-D2 wild type protein was produced.
  • Variant CD45 proteins are produced using the same experimental procedure. The monomer content % for each protein was taken from the size exclusion chromatogram (fractions c5- cll).
  • Figure 15 shows a representative chromatogram of size exclusion chromatography (panel A) and a SDS-PAGE of the purified non-glycosylated wt protein (panel B).
  • Binding of the antibodies to CD45 wildtype and variants was measured in an Octet system RED96e (Sartorius) or R8 at 25 °C with shaking at 1,000 rpm using lx kinetic buffer (Sartorius, PN : 18-1105).
  • the elected variants were screened for their ability to bind Refmab #1 and Refmab #2 using different concentrations of CD45 (wild type or variant).
  • Antibodies were captured by Anti-Human Fc capture biosensor (AHC) (Sartorius, PN: 18-5060) for 300 s at 0.5 to 1 ug/mL.
  • AHC Anti-Human Fc capture biosensor
  • human CD45 wt and variants, containing only domains 1, 2 were titrated at 3-7 different concentrations (from 2000 nM to 1 nM). Association of the analyte to the antibodies was monitored for 300 or 600 s and dissociation of the analyte from the antibodies was monitored for 900 or 1800 s. Reference subtraction was performed against buffer only wells. AHC tips were regenerated using 10 mM Gly-HCI pH 1.7. Data were analyzed using the Octet Data Analysis software HT 12.0. Data were fitted to a 1:1 binding model. Kinetic rates k a and kd were globally fitted or steady state analysis was performed.
  • Refmab #4 streptavidin (SA) biosensor (Sartorius, PN: 18-5020) were first coated with CaptureSelectTM biotin anti-LC-kappa (murine) conjugate (Thermo Scientific, PN: 7103152100) for 600 s at 1 ug/mL. Refmab #4 was then captured by the coated SA biosensors for 300 s at 0.5-1.0 ug/mL. Analyte titration, association and dissociation were performed as for Refmab's #1 and #2.
  • SA streptavidin
  • Results are shown in Table 16 and Figure 20.
  • the %binding for the Refmab's was calculated by dividing the nm shift of the hCD45 variant by the hCD45 wt.
  • the nm shift used for this calculation was for the top hCD45 concentration (500 nM) at the end of the association (300 s).
  • Marked with an asterik are %binding results which were calculated by dividing the nm shift of 50 nM (instead of 500 nM) hCD45 variant by the nm shift of 50 nM (instead of 500 nM) hCD45 wt.
  • ND stands for not determined.
  • NA stands for not analysed.
  • the single point mutations E230K, E259N, H285R, N286D as well as the triple mutation I283M H285R N286D decreased binding to Refmab #4, while no binding to Refmab #4 was observed for hCD45 Dl-2 variants (N257D, N257E, N257K, N257R, N257G, N257T, E259G, E259Q, E259V, N267S and the double mutant H285R N286D) up until 500 nM analyte concentration.
  • CD45 D1-D2 variants were analyzed by differential scanning fluorimetry and monitoring tryptophane fluorescence using Nanotemper Prometheus NT.48 NanoDSF (NanoTemper Technologies). Tryptophane fluorescence was measured using CD45 D1-D2 wild-type and variants at 0.25-1.0 mg/mL in 150mM NaCI, 20mM Hepes pH7.4 and the temperature was increased from 20 °C to 95 °C. The melting temperature was determined as the inflexion point of the sigmoidal curve and compared to CD45 Dl-2 wt. Results are shown in Figure 17 and Figure 18.
  • Target protein dephosphorylation by CD45 can be tested by the skilled person by any commonly used assay, such as an AlphaLISA immunoassay (Perkin Elmer). Cells expressing CD45 wild type or isoform are activated with anti-CD3 antibodies for different time points (5-20min), before cell lysis. Phosphorylation of Lek at position Tyr505 or total Lek is detected and read out by a plate reader.
  • AlphaLISA immunoassay Perkin Elmer
  • Dephosphorylation of Lek at position Tyr505 by CD45 or total Lek was measured using an AlphaLISA assay.
  • Cells e.g. Jurkat cells (wild type or variants thereof) are collected and preincubated with HBSS medium for 2h at 37°C.
  • Assay plates (96-well plates) are coated for 2h at 37°C or overnight at 4°C with lOug/mL anti-CD3 antibody in lOOuL medium per well. Assay plates are washed twice with sterile PBS and cells are seeded at a concentration of 10.000-50.000 cells per well in 80uL of HBSS medium.
  • the rest of the assay was performed according to the Assay Kit Protocol according to the manufacturer (Perkin Elmer) containing all the necessary reagents (PerkinElmer AlphaLISA WALSU-PLCK-A-HV and WALSU-TLCK-A- HC). After 5-30minutes 20uL of 5x Lysis buffer is added to the wells and incubated for lOmin at 350rpm on a plate shaker. 5uL of lysate are transferred to a 384-white well plate and 5uL of Acceptor Mix (according to manufacturer's protocol) added to the wells, sealed with a foil, incubated for 2min on a plate shaker and incubated at room temperature for at least 1 hour.
  • 5uLof Donor Mix (according to the manufacturer's protocol) are added to the wells, plate sealed with a foil, mixed on a plate shaker for 2min and incubated at room temperature for at least 1 hour. Plates are then read on the Envision plate reader (Perkin Elmer) to detect total Lek and phosphorylated Lek.
  • FIG. 16 A results of an assay measuring phosphorylation of Lek at position Tyr505 via an AlphaLISA assay is shown in Figure 16.
  • 10.000-50.000 Jurkat wildtype or Jurkat CD45 knock-out cells were incubated for 20 minutes in plates coated with anti-CD3 Antibody before cell lysis and detection of phosphorylated Lek.
  • Activation of Jurkat cells using the anti-CD3 antibody leads to CD45 activation which in turn dephosphorylates Lek.
  • Jurkat CD45 knock-out cells are not able to dephosphorylate Lek upon activation.
  • the figure shows the acceptor signal (counts) and represents one biological experiment containing two technical replicates.
  • Antibody internalization can be tested by the skilled person by any commonly used assay, such as FACS.
  • Cells expressing CD45 are incubated with antibodies labelled with a fluorophore e.g. Alexa Fluor 488 (AF488) for different time points (l-24h), before washing and quenching with an anti-AF488 antibody for one hour.
  • AF488 Alexa Fluor 488
  • Internalized antibody is able to give a signal in the FACS readout, while the signal of Antibody bound to the cell surface is quenched and not detectable.
  • TF-1 cells are seeded at a concentration of 1 million cells/mL in O.lmL of medium (for TFl cells: RPMI1640 supplemented with GlutaMAX + 10% heat inactivated FBS + 2ng/mL GM-CSF; for Jurkat cells: RPMI ATCC modification + 10% heat inactivated FBS) in a 96-well plate.
  • Antibody Optimus Prime demonstrated to have a binding specificity that is identical to that of Refmab #1. 19: HSCs bv base
  • Electroporated CD34+ HSPCs were kept in culture at 0.5e6 cells per mL in 6-well flat-bottom plate (Corning #3516) in stem cell medium renewed every 5 days (StemSpan SFEM II (StemCell #09655) + luL/mL hSCF (Miltenyi #130-096-695) + ImL/mL hFlt3-Ligand (Miltenyi #130-096-479) + luL/mL hTPO (Miltenyi #130-095-752). Editing was analyzed 5 days post electroporation using flow cytometry.
  • K352E can be engineered into CD34+ HSPCs by base editing using ABE8e-NG mRNA (Trilink) and sgRNA-49 (SEQ ID No. 33; Synthego). This resulted in ⁇ 1% Refmab#l nonstaining CD34+ HSPCs (Fig. 23A).
  • ABE8e-NG mRNA Trilink
  • sgRNA-49 SEQ ID No. 33; Synthego
  • ABE8e-NG and ABE8e-SpRY sgRNA-49.3 sequence: GGAATGTGGAAACAATACTA (SEQ ID No. 62; only targetable by ABE8e-SpRY) sgRNA-49.4 sequence: GAATGTGGAAACAATACTAG (SEQ ID No. 63; only targetable by ABE8e-SpRY)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Cell Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • Oncology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
EP22844175.4A 2021-12-23 2022-12-23 Discernible cell surface protein variants of cd45 for use in cell therapy Pending EP4452417A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP21217465 2021-12-23
PCT/EP2022/087829 WO2023118608A1 (en) 2021-12-23 2022-12-23 Discernible cell surface protein variants of cd45 for use in cell therapy

Publications (1)

Publication Number Publication Date
EP4452417A1 true EP4452417A1 (en) 2024-10-30

Family

ID=79171049

Family Applications (1)

Application Number Title Priority Date Filing Date
EP22844175.4A Pending EP4452417A1 (en) 2021-12-23 2022-12-23 Discernible cell surface protein variants of cd45 for use in cell therapy

Country Status (10)

Country Link
EP (1) EP4452417A1 (enExample)
JP (1) JP2025500288A (enExample)
KR (1) KR20240119146A (enExample)
CN (1) CN118541158A (enExample)
AU (1) AU2022422572A1 (enExample)
CA (1) CA3240875A1 (enExample)
IL (1) IL313785A (enExample)
MX (1) MX2024007316A (enExample)
WO (1) WO2023118608A1 (enExample)
ZA (1) ZA202405124B (enExample)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3110837A1 (en) 2018-08-28 2020-03-05 Vor Biopharma Inc. Genetically engineered hematopoietic stem cells and uses thereof
WO2026082736A1 (en) * 2024-10-14 2026-04-23 Cimeio Therapeutics Ag Chimeric antigen receptor (car) that targets receptor-type tyrosine phosphatase c (cd45) and its use to related applications

Family Cites Families (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170226209A1 (en) 2014-08-01 2017-08-10 INSERM (Institut National de la Santé et de la Recherche Médicale) An anti-cd45rc antibody for use as drug
GB201601073D0 (en) 2016-01-20 2016-03-02 Ucb Biopharma Sprl Antibodies
WO2017155937A1 (en) 2016-03-07 2017-09-14 Actinium Pharmaceuticals, Inc. Stabilized radiolabeled anti-cd45 immunoglobulin compositions
US11499168B2 (en) 2016-04-25 2022-11-15 Universitat Basel Allele editing and applications thereof
CN109641051A (zh) 2016-06-17 2019-04-16 美真达治疗公司 用于耗尽细胞的组合物和方法
LT3535392T (lt) 2016-11-02 2024-04-25 Universität Basel Imunologiškai atpažįstami ląstelių paviršiaus variantai, skirti naudoti ląstelių terapijoje
RU2019130504A (ru) 2017-02-28 2021-03-30 Вор Байофарма, Инк. Композиции и способы ингибирования линиеспецифических белков
WO2019084273A1 (en) 2017-10-25 2019-05-02 Actinium Pharmaceuticals, Inc. METHODS OF ANTI-CD45-BASED LYMPHODEPPLICATION AND USES THEREOF IN COMBINATION WITH ACT-BASED ANTICANCER THERAPIES
EP3498293A1 (en) 2017-12-15 2019-06-19 Institut National De La Sante Et De La Recherche Medicale (Inserm) Treatment of monogenic diseases with an anti-cd45rc antibody
CN109991410B (zh) 2017-12-29 2022-07-05 上海白泽医学检验所有限公司 一种含抗cd45单抗的组合物及其使用方法
WO2020018580A1 (en) 2018-07-16 2020-01-23 Fred Hutchinson Cancer Research Center Bispecific affinity reagent and related methods for pretargeted radioimmunotherapy against cd45+ cell
EP3626265A1 (en) 2018-09-21 2020-03-25 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-human cd45rc antibodies and uses thereof
EP3877416A4 (en) 2018-10-30 2022-07-27 Magenta Therapeutics, Inc. ANTI-CD45 ANTIBODIES AND CONJUGATES THEREOF
WO2020092655A1 (en) * 2018-10-30 2020-05-07 Magenta Therapeutics, Inc. Methods for allogeneic hematopoietic stem cell transplantation
WO2020159656A1 (en) 2019-02-01 2020-08-06 Actinium Pharmaceuticals, Inc. Molecules and their derivatives directed against cd45
WO2020170254A1 (en) 2019-02-21 2020-08-27 Ramot At Tel-Aviv University Ltd. Treatment of diseases with multimeric peptides

Also Published As

Publication number Publication date
WO2023118608A1 (en) 2023-06-29
AU2022422572A1 (en) 2024-06-06
CA3240875A1 (en) 2023-06-29
JP2025500288A (ja) 2025-01-09
KR20240119146A (ko) 2024-08-06
MX2024007316A (es) 2024-06-26
CN118541158A (zh) 2024-08-23
ZA202405124B (en) 2025-10-29
IL313785A (en) 2024-08-01

Similar Documents

Publication Publication Date Title
JP7386082B2 (ja) 系統特異的タンパク質の阻害のための組成物および方法
JP6865688B2 (ja) Ror1に特異的な抗体およびキメラ抗原受容体
TWI825431B (zh) FcRH5之人源化及親和力成熟抗體及使用方法
CN103476429B (zh) 新型调节剂及使用方法
CN110066338B (zh) 作为T细胞衔接器的双特异性IgG抗体
JP7323102B2 (ja) 抗psma抗体およびその使用
CN117616123B (zh) 抗ctla-4抗体
JP2020182454A (ja) Cd19に特異的な抗体およびキメラ抗原受容体
WO2020212710A1 (en) Antagonists anti-cd7 antibodies
US20250057951A1 (en) Discernible cell surface protein variants of cd117 for use in cell therapy
CN117545779B (zh) 抗ctla-4抗体的用途
CN115397515A (zh) 人抗cd33抗体和其用途
US20240189424A1 (en) Engineered natural ligand-based car: directed evolution of the stress-receptor nkp30
AU2022422572A1 (en) Discernible cell surface protein variants of cd45 for use in cell therapy
US20250326818A1 (en) Discernible cell surface protein variants for use in cell therapy
WO2024208836A1 (en) Discernible cell surface protein variants of cd33 for use in cell therapy
JP7854975B2 (ja) 系統特異的タンパク質の阻害のための組成物および方法
CN118401558A (zh) 用于细胞疗法的cd117的可辨识细胞表面蛋白变体
WO2025031965A1 (en) Discernible cell surface protein variants of cd52 for use in cell therapy
CN117813110A (zh) 用于在细胞治疗中使用的可辨别细胞表面蛋白变体

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20240717

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR

P01 Opt-out of the competence of the unified patent court (upc) registered

Free format text: CASE NUMBER: APP_60242/2024

Effective date: 20241107

REG Reference to a national code

Ref country code: HK

Ref legal event code: DE

Ref document number: 40111207

Country of ref document: HK

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)