EP4136097A1 - Fusion proteins of ctl antigens for treating melanoma - Google Patents

Fusion proteins of ctl antigens for treating melanoma

Info

Publication number
EP4136097A1
EP4136097A1 EP21723936.7A EP21723936A EP4136097A1 EP 4136097 A1 EP4136097 A1 EP 4136097A1 EP 21723936 A EP21723936 A EP 21723936A EP 4136097 A1 EP4136097 A1 EP 4136097A1
Authority
EP
European Patent Office
Prior art keywords
seq
clt
fusion protein
antigen
nucleic acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP21723936.7A
Other languages
German (de)
English (en)
French (fr)
Inventor
George KASSIOTIS
George Young
Jan ATTIG
Ambrosius SNIJDERS
David Perkins
Fabio MARINO
Ray Jupp
Magdalena VON ESSEN
Peter Mason
Nicola TERNETTE
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Francis Crick Institute Ltd
Enara Bio Ltd
Original Assignee
Francis Crick Institute Ltd
Enara Bio Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Francis Crick Institute Ltd, Enara Bio Ltd filed Critical Francis Crick Institute Ltd
Publication of EP4136097A1 publication Critical patent/EP4136097A1/en
Pending legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4748Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/00119Melanoma antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • A61K2039/876Skin, melanoma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • the present invention relates to fusion proteins and their corresponding polynucleotides for use in the treatment or prevention of cancer, in particular for use in treating or preventing melanoma (e.g. cutaneous melanoma or uveal melanoma).
  • the present invention further relates inter alia to pharmaceutical and immunogenic compositions comprising said fusion proteins or nucleic acids, medical use of said pharmaceutical and immunogenic compositions and methods of treatment comprising administering said pharmaceutical and immunogenic compositions.
  • MHC Major Histocompatibility Complex
  • This expanded T-cell population can produce effector CD8+ T-cells (including cytotoxic T-lymphocytes - CTLs) that can eliminate the foreign antigen-tagged cells, as well as memory CD8+ T- cells that can be re-amplified when the foreign antigen-tagged cells appear later in the animal’s life.
  • effector CD8+ T-cells including cytotoxic T-lymphocytes - CTLs
  • memory CD8+ T- cells that can be re-amplified when the foreign antigen-tagged cells appear later in the animal’s life.
  • MHC Class II molecules whose expression is normally limited to professional antigen-presenting cells (APCs) such as dendritic cells (DCs), are usually loaded with peptides which have been internalised from the extracellular environment. Binding of a complementary TCR from a naive CD4+ T-cell to the MHC I l-peptide complex, in the presence of various factors, including T-cell adhesion molecules (CD54, CD48) and co stimulatory molecules (CD40, CD80, CD86), induces the maturation of CD4+ T-cells into effector cells (e.g., TH1 , TH2, TH17, TFH, T reg cells).
  • APCs professional antigen-presenting cells
  • DCs dendritic cells
  • effector CD4+T-cells can promote B-cell differentiation to antibody-secreting plasma cells as well as facilitate the differentiation of antigen-specific CD8+ CTLs, thereby helping induce the adaptive immune response to foreign antigens, that include both short-term effector functions and longer-term immunological memory.
  • DCs can perform the process of cross presentation of peptide antigens by delivering exogenously-derived antigens (such as a peptide or protein released from a pathogen or a tumor cell) onto their MHC I molecules, contributing to the generation of immunological memory by providing an alternative pathway to stimulating the expansion of naive CD8+ T-cells.
  • Immunological memory (specifically antigen-specific B cells/antibodies and antigen-specific CTLs) are critical players in controlling microbial infections, and immunological memory has been exploited to develop numerous vaccines that prevent the diseases caused by important pathogenic microbes. Immunological memory is also known to play a key role in controlling tumor formation, but very few efficacious cancer vaccines have been developed.
  • Cancer is the second leading cause of morbidity, accounting for nearly 1 in 6 of all deaths globally. Of the 8.8 million deaths caused by cancer in 2015, the cancers which claimed the most lives were from lung (1.69 million), liver (788,000), colorectal (774,000), stomach (754,000) and breast (571 ,000) carcinomas. The economic impact of cancer in 2010 was estimated to be USD1 .16 Trillion, and the number of new cases is expected to rise by approximately 70% over the next two decades (World Health Organisation Cancer Facts 2017).
  • HERVs Human endogenous retroviruses
  • LTRs Long Terminal Repeats
  • MaLRs Mammalian apparent LTR Retrotransposons
  • ERV sequences encode defective proviruses which share the prototypical retroviral genomic structure consisting of gag, pro , po/ and env genes flanked by LTRs.
  • Some intact ERV ORFs produce retroviral proteins which share features with proteins encoded by exogenous infectious retroviruses such as HIV-1 . Such proteins may serve as antigens to induce a potent immune response (Hurst & Magiorkinis, 2015, J. Gen. Virol 96:1207- 1218), suggesting that polypeptides encoded by ERVs can escape T and B-cell receptor selection processes and central and peripheral tolerance.
  • Immune reactivity to ERV products may occur spontaneously in infection or cancer, and ERV products have been implicated as a cause of some autoimmune diseases (Kassiotis & Stoye, 2016, Nat. Rev. Immunol. 16:207-219).
  • ERV-derived sequences Due to the accumulation of mutations and recombination events during evolution, most ERV-derived sequences have lost functional open reading frames for some or all of their genes and therefore their ability to produce infectious virus. However, these ERV elements are maintained in germline DNA like other genes and still have the potential to produce proteins from at least some of their genes. Indeed, HERV-encoded proteins have been detected in a variety of human cancers. For example, splice variants of the HERV-K env gene, Rec and Np9, are found exclusively in malignant testicular germ cells and not in healthy cells (Ruprecht et. al, 2008, Cell Mol Life Sci 65:3366- 3382). Increased levels of HERV transcripts have also been observed in cancers such as those of the prostate, as compared to healthy tissue (Wang-Johanning, 2003,
  • a wide range of vaccine modalities are known.
  • One well-described approach involves directly delivering an antigenic polypeptide to a subject with a view to raising an immune response (including B- and T-cell responses) and stimulating immunological memory.
  • a polynucleotide may be administered to the subject by means of a vector such that the polynuceotide-encoded immunogenic polypeptide is expressed in vivo.
  • viral vectors for example adenovirus vectors, has been well explored for the delivery of antigens in both prophylactic vaccination and therapeutic treatment strategies against cancer (Wold et al. Current Gene Therapy, 2013, Adenovirus Vectors for Gene Therapy, Vaccination and Cancer Gene Therapy, 13:421 — 433).
  • Immunogenic peptides, polypeptides, or polynucleotides encoding them can also be used to load patient-derived antigen presenting cells (APCs), that can then be infused into the subject as a vaccine that elicits a therapeutic or prophylactic immune response.
  • APCs patient-derived antigen presenting cells
  • An example of this approach is Provenge, which is presently the only FDA- approved anti-cancer vaccine.
  • Cancer antigens may also be exploited in the treatment and prevention of cancer by using them to create a variety of non-vaccine therapeutic modalities. These therapies fall into two different classes: 1) antigen-binding biologies, 2) adoptive cell therapies.
  • Antigen-binding biologies typically consist of multivalent engineered polypeptides that recognize antigen-decorated cancer cells and facilitate their destruction.
  • the antigen-binding components of these biologies may consist of TCR-based biologicals, including, but not limited to TCRs, high-affinity TCRs, and TCR mimetics produced by various technologies (including those based on monoclonal antibody technologies).
  • Cytolytic moieties of these types of multivalent biologies may consist of cytotoxic chemicals, biological toxins, targeting motifs and/or immune stimulating motifs that facilitate targeting and activation of immune cells, any of which facilitate the therapeutic destruction of tumor cells.
  • Adoptive cell therapies may be based on a patient’s own T-cells that are removed and stimulated ex vivo with vaccine antigen preparations (cultivated with T- cells in the presence or absence of other factors, including cellular and acellular components) (Yossef et al., JCI Insight. 2018 Oct 4;3(19). pii: 122467. doi:
  • adoptive cell therapies can be based on cells (including patient- or non-patient-derived cells) that have been deliberately engineered to express antigen-binding polypeptides that recognize cancer antigens. These antigen binding polypeptides fall into the same classes as those described above for antigen binding biologies.
  • lymphocytes autologous or non-autologous
  • cancer antigen-binding polypeptides can be administered to a patient as adoptive cell therapies to treat their cancer.
  • HERV-derived antigens in raising an effective immune response to cancer has shown promising results in promoting tumor regression and a more favourable prognosis in murine models of cancer (Kershaw et al. , 2001 , Cancer Res. 61 :7920- 7924; Slansky et al., 2000, Immunity 13:529-538).
  • HERV antigen-centric immunotherapy trials have been contemplated in humans (Sacha et al.,2012, J. Immunol 189:1467-1479), although progress has been restricted, in part, due to a severe limitation of identified tumor-specific ERV antigens.
  • WO 2005/099750 identifies anchored sequences in existing vaccines against infectious pathogens, which are common in raising cross-reactive immune responses against the HERV-K Mel tumor antigen and confers protection to melanoma.
  • WO 00/06598 relates to the identification of HERV-AVL3-B tumor associated genes which are preferentially expressed in melanomas, and methods and products for diagnosing and treating conditions characterised by expression of said genes.
  • WO 2006/119527 provides antigenic polypeptides derived from the melanoma- associated endogenous retrovirus (MERV), and their use for the detection and diagnosis of melanoma as well as prognosis of the disease.
  • MMV melanoma-associated endogenous retrovirus
  • the use of antigenic polypeptides as anticancer vaccines is also disclosed.
  • WO 2007/137279 discloses methods and compositions for detecting, preventing and treating HERV-K+ cancers, for example with use of a HERV-K+ binding antibody to prevent or inhibit cancer cell proliferation.
  • WO 2006/103562 discloses a method for treating or preventing cancers in which the immunosuppressive Np9 protein from the env gene of HERV-K is expressed.
  • the invention also relates to pharmaceutical compositions comprising nucleic acid or antibodies capable of inhibiting the activity of said protein, or immunogen or vaccinal composition capable of inducing an immune response directed against said protein.
  • WO 2007/109583 provides compositions and methods for preventing or treating neoplastic disease in a mammalian subject, by providing a composition comprising an enriched immune cell population reactive to a HERV-E antigen on a tumor cell.
  • Humer J, et al., 2006, Cane. Res., 66:1658-63 identifies a melanoma marker derived from melanoma-associated endogenous retroviruses.
  • RNA transcripts which comprise LTR elements or are derived from genomic sequences adjacent to LTR elements which are found at high levels in cutaneous melanoma cells, but are undetectable or found at very low levels in normal, healthy tissues (see Example 1). Such transcripts are herein referred to as cancer-specific LTR-element spanning transcripts (CLTs). Further, the inventors have shown that a subset of the potential polypeptide sequences (i.e.
  • CLT antigens open reading frames (ORFs)) encoded by these CLTs are translated in cancer cells, processed by components of the antigen-processing apparatus, and presented on the surface of cells found in tumor tissue in association with the class I and class II major histocompatibility complex (MHC Class I, and MHC Class II) and class I and class II human leukocyte antigen (HLA Class I, HLA Class II) molecules (see Example 2).
  • MHC Class I, and MHC Class II major histocompatibility complex
  • HLA Class I, HLA Class II human leukocyte antigen
  • cancer cell presentation of CLT antigens is expected to render these cells susceptible to elimination by T-cells that bear cognate T-cell receptors (TCRs) for the CLT antigens, and CLT antigen-based vaccination methods/regimens that amplify T-cells bearing these cognate TCRs are expected to elicit immune responses against cancer cells (and tumors containing them), particularly melanoma particularly cutaneous melanoma tumors.
  • T-cells from melanoma subjects are indeed reactive to peptides derived from CLT antigens disclosed herein and amplify T-cells and amplify T-cell receptor sequences (see Example 3).
  • T-cells specific for CLT antigens have not been deleted from normal subject’s T-cell repertoire by central tolerance (see Example 4).
  • the presence and killing activity of CLT antigen specific T-cells in ex vivo cultures of healthy donor T-cells has been determined (see Example 5).
  • qRT- PCR and RNA Scope studies have confirmed that CLTs are specifically expressed in RNA extracted from melanoma cell lines or melanoma tumor tissue as compared to non-melanoma cells lines or tissues (see Example 6).
  • the inventors have also produced fusion proteins comprising unique CLT antigens for vaccine delivery (Example 8).
  • the inventors have also surprisingly discovered that certain CLT antigen encoding CLTs as well as being overexpressed in cutaneous melanoma are also overexpressed in uveal melanoma.
  • the CLT antigen polypeptide sequences encoded by these CLTs and fusion proteins containing them are expected to elicit immune responses against uveal melanoma cells and tumors containing them.
  • the CLTs and the CLT antigens are not canonical sequences which can be readily derived from known tumor genome sequences found in the cancer genome atlas.
  • the CLTs are transcripts resulting from complex transcription and splicing events driven by transcription control sequences of ERV origin. Since the CLTs are expressed at high level and since CLT antigen polypeptide sequences are not sequences of normal human proteins, it is expected that they will be capable of eliciting strong, specific immune responses (as indeed has been established - see Examples 3-5 and 10) and are thus suitable for therapeutic use in a cancer immunotherapy setting.
  • the CLT antigens discovered in the highly expressed transcripts that characterize tumor cells can be used in several formats.
  • fusion proteins that are the subject of the present invention comprising CLT antigen polypeptides can be directly delivered to a subject as a vaccine that elicits a therapeutic or prophylactic immune response to tumor cells.
  • nucleic acids encoding for fusion proteins of the invention where the nucleic acid which encodes the CLT antigens may be codon optimised to enhance the expression of their encoded CLT antigens, can be directly administered or else inserted into vectors for delivery in vivo to produce the encoded protein products in a subject as a vaccine that elicits a therapeutic or prophylactic immune response to tumor cells.
  • the invention provides inter alia a fusion protein comprising six antigenic polypeptides (a) to (f), wherein the antigenic polypeptides (a) to (f) have the amino acid sequences:
  • SEQ ID NO: 4 or a variant thereof or an immunogenic fragment of SEQ ID NO: 4 or a variant thereof
  • SEQ ID NO: 8 or a variant thereof or an immunogenic fragment of SEQ ID NO: 8 or a variant thereof.
  • fusion proteins of the invention (hereinafter referred to as “fusion proteins of the invention”).
  • nucleic acids of the invention also provides a nucleic acid molecule which encodes a fusion protein of the invention (hereinafter referred to as “nucleic acids of the invention”).
  • fusion proteins of the invention and the nucleic acids of the invention are expected to be useful in a range of embodiments in cancer immunotherapy and prophylaxis, particularly immunotherapy and prophylaxis of melanoma, as discussed in more detail below.
  • FIG. 1 shows an extracted MS/MS spectrum (with assigned fragment ions) of a peptide obtained from a tumor sample of a patient and either a bottom panel showing a rendering of the spectrum indicating the positions of the linear peptide sequences that have been mapped to the fragment ions or similar data shown in tabular form.
  • Figure 1 Spectra for the peptide of SEQ ID NO. 9 obtained from a tumor sample of patient Mel-3.
  • Figure 4 Spectra for the peptide of SEQ ID NO. 10 obtained from a tumor sample of patient 2MT3.
  • Figure 5. Spectra for the peptide of SEQ ID NO. 11 obtained from a tumor sample of patient Mel-5.
  • Figure 7 Spectra for the peptide of SEQ ID NO. 11 obtained from a tumor sample of patient Mel-16.
  • Figure 8 Spectra for the peptide of SEQ ID NO. 11 obtained from a tumor sample of patient 2MT3.
  • Figure 9 Spectra for the peptide of SEQ ID NO. 11 obtained from a tumor sample of patient 2MT10.
  • Figure 10 Spectra for the peptide of SEQ ID NO. 12 obtained from a tumor sample of patient Mel-5.
  • Figure 11 Spectra for the peptide of SEQ ID NO. 18 obtained from a tumor sample of patient Mel-26.
  • Figure 12. Spectra for the peptide of SEQ ID NO. 19 obtained from a tumor sample of patient Mel-20.
  • Figure 15 Spectra for the peptide of SEQ ID NO. 31 obtained from a tumor sample of patient Mel-35.
  • Figure 16 Spectra for the peptide of SEQ ID NO. 31 obtained from a tumor sample of patient 2MT3.
  • Figure 17. Spectra for the peptide of SEQ ID NO. 32 obtained from a tumor sample of patient 1 MT1.
  • Figure 20 Spectra for the peptide of SEQ ID NO. 36 obtained from a tumor sample of patient 2MT3.
  • Figure 21 Spectra for the peptide of SEQ ID NO. 36 obtained from a tumor sample of patient 2MT1.
  • Figure 22 Spectra for the peptide of SEQ ID NO. 37 obtained from a tumor sample of patient Mel-40.
  • Figure 23 Spectra for the peptide of SEQ ID NO. 37 obtained from a tumor sample of patient Mel-41 .
  • Figure 24 Spectra for the peptide of SEQ ID NO. 37 obtained from a tumor sample of patient 2MT3.
  • Figure 25 Spectra for the peptide of SEQ ID NO. 38 obtained from a tumor sample of patient Mel-27.
  • Figure 26 Spectra for the peptide of SEQ ID NO. 38 obtained from a tumor sample of patient Mel-39.
  • Figure 27 Spectra for the peptide of SEQ ID NO. 39 obtained from a tumor sample of patient 2MT12.
  • Figure 28 Spectra for the peptide of SEQ ID NO. 45 obtained from a tumor sample of patient Mel-29.
  • Figure 29 Spectra for the peptide of SEQ ID NO. 48 obtained from a tumor sample of patient Mel-41 .
  • Figure 30 Spectra for the peptide of SEQ ID NO. 49 obtained from a tumor sample of patient Mel-41 .
  • Figure 31 Spectra for the peptide of SEQ ID NO. 50 obtained from a tumor sample of patient Mel-41 .
  • Figure 32 Spectra for the peptide of SEQ ID NO. 51 obtained from a tumor sample of patient Mel-41 .
  • Figure 33 Spectra for the peptide of SEQ ID NO. 52 obtained from a tumor sample of patient Mel-21 .
  • Figure 34 Spectra for the peptide of SEQ ID NO. 52 obtained from a tumor sample of patient 2MT3.
  • Figure 35 Spectra for the peptide of SEQ ID NO. 53 obtained from a tumor sample of patient Mel-27.
  • Figure 36 Spectra for the peptide of SEQ ID NO. 54 obtained from a tumor sample of patient Mel-27.
  • Figure 37 Spectra for the peptide of SEQ ID NO. 54 obtained from a tumor sample of patient 2MT4.
  • FIG. 38-53 shows an alignment of a native MS/MS spectrum of a peptide obtained from a patient tumor sample (upper) to the native spectrum of a synthetic peptide corresponding to the same sequence (lower).
  • Figure 38 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT3 attributed to SEQ ID NO. 10.
  • Figure 39 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT3 attributed to SEQ ID NO. 11.
  • Figure 40 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT4 attributed to SEQ ID NO. 19.
  • Figure 41 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT3 attributed to SEQ ID NO. 31.
  • Figure 42 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 1 MT1 attributed to SEQ ID NO. 32.
  • Figure 43 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT3 attributed to SEQ ID NO. 36.
  • Figure 44 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT3 attributed to SEQ ID NO. 37.
  • Figure 45 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT12 attributed to SEQ ID NO. 39.
  • Figure 46 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-29 attributed to SEQ ID NO. 45.
  • Figure 47 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-41 attributed to SEQ ID NO. 48.
  • Figure 48 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-41 attributed to SEQ ID NO. 49.
  • Figure 49 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-41 attributed to SEQ ID NO. 50.
  • Figure 50 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-41 attributed to SEQ ID NO. 51.
  • Figure 51 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-21 attributed to SEQ ID NO. 52.
  • Figure 52 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-27 attributed to SEQ ID NO. 53.
  • Figure 53 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-27 attributed to SEQ ID NO. 54.
  • FIG. 54 panels A to C shows tumor antigen-specific T-cell amplification from patient PBMC cultures in response to cultivation with specific tumor antigen-derived peptides.
  • FIG. 55 panels A to D provides a summary of CLT Antigen-derived peptides (SEQ ID NO. 11 , 13-15, 19-29, 33-35, 40-42) that were capable of amplifying specific TCR- bearing T-cells from melanoma patient PBMCs.
  • Figure 56 shows CD8 T-cell responses from a normal blood donor to a HLA-A * 02:01- restricted peptide (SEQ ID NO. 16) from CLT Antigen 1.
  • Figure 57 shows CD8 T-cell responses from a normal blood donor to HLA-A * 02:01- restricted peptide (SEQ ID NO. 30) from CLT Antigen 2.
  • Figure 58 shows CD8 T-cell responses from a normal blood donor to HLA-A * 02:01- restricted peptide (SEQ ID NO. 43) from CLT Antigen 4.
  • Figure 59 shows CD8 T-cell responses from a normal blood donor to HLA-A * 03:01- restricted peptide (SEQ ID NO. 47) from CLT Antigen 5.
  • Figure 60 shows CD8 T-cell responses from a normal blood donor to HLA-B * 07:02- restricted peptide (SEQ ID NO. 50) from CLT Antigen 6.
  • Figure 61 shows CD8 T-cell responses from a normal blood donor to HLA-A * 03:01- restricted peptide (SEQ ID NO. 52) from CLT Antigen 7.
  • Figure 62 shows CD8 T-cell responses from a normal blood donor to HLA-A * 02:01- restricted peptide (SEQ ID NO. 55) from CLT Antigen 8.
  • Figure 63 panels A to D shows responsiveness to HLA-B * 07:02 restricted peptides (SEQ ID NO. 17 and 44) from CLT Antigen 1 and CLT Antigen 4 respectively in memory CD45RO-positive CD8 T-cells as compared with naive CD45RO-negative CD8 T-cells from the same donor.
  • Figure 64 shows expanded, pentamer-sorted CD8 T-cells killing C1 RB7-target cells pulsed with a peptide (SEQ ID NO. 44) derived from CLT Antigen 4.
  • Figure 65 shows expanded, pentamer-sorted CD8 T-cells killing of CaSki cells transfected with the open reading frame of CLT Antigen 8 (SEQ ID NO. 8).
  • Figure 66 panels A to G shows qRT-PCR assay results to verify the transcription of the CLT encoding CLT Antigen 1 (SEQ ID NO. 56), the CLT encoding CLT Antigen 2 (SEQ ID NO. 57), the CLT encoding CLT Antigen 3 and 4 (SEQ ID NO. 58), the CLT encoding CLT Antigen 5 (SEQ ID NO. 59), the CLT encoding CLT Antigen 6 (SEQ ID NO. 60), the CLT encoding CLT Antigen 7 (SEQ ID NO. 61) and the CLT encoding CLT Antigen 8 (SEQ ID NO. 62) in melanoma cancer cell lines or primary tissue samples.
  • SEQ ID NO. 56 shows qRT-PCR assay results to verify the transcription of the CLT encoding CLT Antigen 1 (SEQ ID NO. 56), the CLT encoding CLT Antigen 2 (SEQ ID NO. 57), the CLT encoding CLT Antigen 3 and 4 (SEQ ID
  • Figure 67 shows schematically the construction of CLT Antigen Fusion Protein 1 (SEQ ID NO. 76), the linker sequences between CLT Antigens and likely HLA binding of linker-derived epitopes.
  • FP fusion protein.
  • Figure 68 shows schematically the construction of CLT Antigen Fusion Protein 2 (SEQ ID NO. 77), the linker sequences between CLT Antigens and likely HLA binding of linker-derived epitopes.
  • FP fusion protein.
  • Figure 69 shows schematically the construction of CLT Antigen Fusion Protein 3 (SEQ ID NO. 78), the linker sequences between CLT Antigens and likely HLA binding of linker-derived epitopes.
  • FP fusion protein.
  • Figure 70 shows schematically the construction of CLT Antigen Fusion Protein 4 (SEQ ID NO. 79), the linker sequences between CLT Antigens and likely HLA binding of linker-derived epitopes.
  • FP fusion protein.
  • Figure 71 provides a schematic explanation of the murine immunogenicity data supporting CLT Antigen Fusion Protein 1 (SEQ ID NO. 76) and CLT Antigen Fusion Protein 2 (SEQ ID NO. 77).
  • SEQ ID NO. 1 is the polypeptide sequence of CLT Antigen 1
  • SEQ ID NO. 2 is the polypeptide sequence of CLT Antigen 2
  • SEQ ID NO. 3 is the polypeptide sequence of CLT Antigen 3
  • SEQ ID NO. 4 is the polypeptide sequence of CLT Antigen 4
  • SEQ ID NO. 5 is the polypeptide sequence of CLT Antigen 5
  • SEQ ID NO. 6 is the polypeptide sequence of CLT Antigen 6
  • SEQ ID NO. 7 is the polypeptide sequence of CLT Antigen 7
  • SEQ ID NO. 8 is the polypeptide sequence of CLT Antigen 8
  • SEQ ID NOs. 9-17 are peptide sequences derived from CLT Antigen 1
  • SEQ ID Nos. 18-30 are peptide sequences derived from CLT Antigen 2
  • SEQ ID NOs. 31-35 are peptide sequences derived from CLT Antigen 3
  • SEQ ID Nos. 36-44 are peptide sequences derived from CLT Antigen 4
  • SEQ ID Nos. 45-47 are peptide sequences derived from CLT Antigen 5
  • SEQ ID Nos. 48-51 are peptide sequences derived from CLT Antigen 6
  • SEQ ID NOs. 52 is a peptide sequence derived from CLT Antigen 7
  • SEQ ID NOs. 53-55 are peptide sequences derived from CLT Antigen 8
  • SEQ ID NO. 56 is the cDNA sequence of the CLT encoding CLT Antigen 1
  • SEQ ID NO. 57 is the cDNA sequence of the CLT encoding CLT Antigen 2
  • SEQ ID NO. 58 is the cDNA sequence of the CLT encoding CLT Antigens 3 and 4
  • SEQ ID NO. 59 is the cDNA sequence of the CLT encoding CLT Antigen 5
  • SEQ ID NO. 60 is the cDNA sequence of the CLT encoding CLT Antigen 6
  • SEQ ID NO. 61 is the cDNA sequence of the CLT encoding CLT Antigens 7
  • SEQ ID NO. 62 is the cDNA sequence of the CLT encoding CLT Antigen 8
  • SEQ ID NO. 63 is a cDNA sequence encoding CLT Antigen 1
  • SEQ ID NO. 64 is a cDNA sequence encoding CLT Antigen 2
  • SEQ ID NO. 65 is a cDNA sequence encoding CLT Antigen 3
  • SEQ ID NO. 66 is a cDNA sequence encoding CLT Antigen 4
  • SEQ ID NO. 67 is a cDNA sequence encoding CLT Antigen 5
  • SEQ ID NO. 68 is a cDNA sequence encoding CLT Antigen 6
  • SEQ ID NO. 69 is a cDNA sequence encoding CLT Antigen 7
  • SEQ ID NO. 70 is a cDNA sequence encoding CLT Antigen 8
  • SEQ ID Nos. 71-75 are linker sequences used to construct CLT Antigen Fusion
  • SEQ ID NO. 76 is the polypeptide sequence of CLT Antigen Fusion Protein 1
  • SEQ ID NO. 77 is the polypeptide sequence of CLT Antigen Fusion Protein 2
  • SEQ ID NO. 78 is the polypeptide sequence of CLT Antigen Fusion Protein 3
  • SEQ ID NO. 79 is the polypeptide sequence of CLT Antigen Fusion Protein 4
  • SEQ ID NO. 80 is a cDNA sequence encoding CLT Antigen Fusion Protein 1
  • SEQ ID NO. 81 is a cDNA sequence encoding CLT Antigen Fusion Protein 2
  • SEQ ID NO. 82 is a cDNA sequence encoding CLT Antigen Fusion Protein 3
  • SEQ ID NO. 83 is a cDNA sequence encoding CLT Antigen Fusion Protein 4
  • SEQ ID NO. 84 is a linker sequence used to construct CLT Antigen Fusion Proteins
  • SEQ ID NOs: 85-87 are TOR VB CDR3 AA sequences shown in Figure 54
  • fusion protein refers to any protein comprising at least two polypeptides that are joined together by peptide bonds, through protein synthesis.
  • the fusion protein may be created through the joining of two or more genes that encode for separate polypeptides that have been joined so that they are transcribed and translated as a single unit producing a single protein.
  • the invention provides a fusion protein comprising at least six polypeptides where each polypeptide is fused to a second or further polypeptide, by creating nucleic acid constructs that fuse together the sequences encoding the individual polypeptides.
  • Fusion proteins of the invention are expected to have the utilities described herein and may have the advantage of superior immunogenic or vaccine activity or prophylactic or therapeutic effect (including increasing the breadth and depth of responses) as compared with the individual component polypeptides, and may be especially valuable in an outbred population. Fusion proteins of the invention may also provide the benefit of increasing the efficiency of construction and manufacture of vaccine antigens and/or vectored vaccines (including nucleic acid vaccines).
  • the invention provides a fusion protein comprising six antigenic polypeptides (a) to (f), wherein the antigenic polypeptides (a) to (f) have the amino acid sequences: (a) SEQ ID NO: 1 or a variant thereof, or an immunogenic fragment of SEQ ID NO: 1 or a variant thereof;
  • the fusion proteins of the invention may further comprise one or more additional antigenic polypeptides selected from antigenic polypeptides (g) and (h), wherein the antigenic polypeptides (g) and (h) have amino acid sequences:
  • the fusion polypeptide comprises six antigenic polypeptides (a) to (f). In one embodiment, the fusion polypeptide comprises eight antigenic polypeptides (a) to (h). In one embodiment, the fusion polypeptide comprises seven antigenic polypeptides (a) to (g). In one embodiment, the fusion polypeptide comprises seven antigenic polypeptides (a) to (f) and (h).
  • One or more of the antigenic polypeptides (a) to (f) may comprise or consist of a sequence lacking an N-terminal methionine amino acid residue.
  • antigenic polypeptide (a) may have the sequence of SEQ ID NO: 1 with the N-terminal methionine amino acid removed and/or antigenic polypeptide (b) may have the sequence of SEQ ID NO: 2 with the N-terminal methionine amino acid removed and/or antigenic polypeptide (c) may have the sequence of SEQ ID NO: 3 with the N-terminal methionine amino acid removed and/or antigenic polypeptide (d) may have the sequence of SEQ ID NO: 4 with the N-terminal methionine amino acid removed and/or antigenic polypeptide (e) may have the sequence of SEQ ID NO: 5 with the N-terminal methionine amino acid removed and/or antigenic polypeptide (f) may have the sequence of SEQ ID NO: 6 with the N-terminal methionine amino acid removed.
  • one or more (e.g. either one or both) of the antigenic polypeptides (g) and (h), may comprise or consist of a sequence lacking an N-terminal methionine amino acid residue.
  • antigenic polypeptide (g) may have the sequence of SEQ ID NO: 7 with the N-terminal methionine amino acid removed and/or antigenic polypeptide (h) may have the sequence of SEQ ID NO: 8 with the N-terminal methionine amino acid removed.
  • the invention provides a fusion protein comprising six antigenic polypeptides (a) to (f), wherein the antigenic polypeptides (a) to (f) have the amino acid sequences:
  • the fusion proteins of the invention may further comprise one or more additional antigenic polypeptides selected from antigenic polypeptides (g) and (h), wherein the antigenic polypeptides (g) and (h) have amino acid sequences:
  • the fusion proteins of the invention comprise an antigenic polypeptide having the amino acid sequence of SEQ ID NO: 2 minus the N-terminal methionine residue. In an embodiment, the fusion proteins of the invention comprise an antigenic polypeptide having the amino acid sequence of SEQ ID NO: 6 minus the N- terminal methionine residue. In an embodiment, the fusion proteins of the invention comprise an antigenic polypeptide having the amino acid sequence of SEQ ID NO: 5 minus the N-terminal methionine residue.
  • the fusion proteins of the invention comprise an antigenic polypeptide having the amino acid sequence of SEQ ID NO: 2 minus the N-terminal methionine residue, an antigenic polypeptide having the amino acid sequence of SEQ ID NO: 6 minus the N-terminal methionine residue, and an antigenic polypeptide having the amino acid sequence of SEQ ID NO: 5 minus the N-terminal methionine residue.
  • the fusion protein of the invention comprises six antigenic polypeptides (a) to (f) wherein the antigenic polypeptides (a) to (f) have the amino acid sequences:
  • the fusion protein of the invention comprises eight antigenic polypeptides (a) to (h) wherein the antigenic polypeptides (a) to (h) have the amino acid sequences:
  • the fusion protein of the invention comprises eight antigenic polypeptides (a) to (h) wherein the antigenic polypeptides (a) to (h) have the amino acid sequences: (a) SEQ ID NO: 1 ;
  • the antigenic polypeptides of the fusion protein of the present invention may be arranged in various sequential orders from the N terminus to the C terminus.
  • the design and order of the polypeptides in the fusion proteins of the invention are described in Example 8.
  • the order of the polypeptides in the fusion protein is important because such an order can in some cases lead to superior processing and presentation of desirable immunogenic peptide regions of a polypeptide and in other cases is necessary for optimal fusion design to reduce the likelihood of unnatural immunogenic peptides, derived from the junctions between the natural cancer-specific CLT Antigens could be presented on surface displayed Class I HLA molecules during vaccination, thus eliciting undesireable T cell responses.
  • the fusion proteins of the invention provide for a strong antigenic response to the component CLT Antigens, see Examples 9 & 10, and are expected to elicit minimal antigenic responses to their junction regions, see Example 8.
  • the six antigenic polypeptides are arranged in the order from N to C of (a), (b), (c), (d), (e) and (f).
  • the six antigenic polypeptides have the sequences of SEQ ID NOs. 1-2, 4, 6-8 and are arranged in the order from N to C of SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 4 and SEQ ID NO: 8.
  • a corresponding sequence in which the N-terminal methionine is omitted may optionally be used as explained above.
  • SEQ ID NO: 1 is present at the N terminus and SEQ ID NO: 8 is present at the C terminus.
  • the N-terminal methionine of SEQ ID NO: 2 is omitted.
  • the fusion protein has the sequence of SEQ ID NO: 76.
  • the six antigenic polypeptides are arranged in the order from N to C of (c), (f), (d), (b), (e) and (a).
  • the six antigenic polypeptides have the sequences of SEQ ID NOs. 1-2, 4, 6-8 and are arranged in the order from N to C of SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 7, SEQ ID NO: 2, SEQ ID NO: 4 and SEQ ID NO: 1.
  • a corresponding sequence in which the N-terminal methionine is omitted may optionally be used as explained above.
  • SEQ ID NO: 6 is present at the N terminus and SEQ ID NO: 1 is present at the C terminus.
  • the N-terminal methionine of SEQ ID NO: 2 is omitted.
  • the fusion protein has the sequence of SEQ ID NO: 77.
  • the fusion protein comprises eight antigenic polypeptides (a) to (h)
  • the eight antigenic polypeptides are arranged in the order from N to C of (a), (b), (g), (d), (e), (h), (c) and (f).
  • the eight antigenic polypeptides have the sequences of SEQ ID NOs. 1-8 and are arranged in the order from N to C of SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 and SEQ ID NO: 8.
  • a corresponding sequence in which the N-terminal methionine is omitted may optionally be used as explained above.
  • SEQ ID NO: 1 present at the N-terminal and SEQ ID NO: 8 is present at the C terminus.
  • the fusion protein has the sequence of SEQ ID NO: 78.
  • the fusion protein comprises eight antigenic polypeptides (a) to (h)
  • the eight antigenic polypeptides are arranged in the order from N to C of (c), (g), (a), (h), (e), (f), (d) and (b).
  • the eight antigenic polypeptides have the sequences of SEQ ID NOs. 1-8 and are arranged in the order from N to C of SEQ ID NO: 6, SEQ ID NO: 3, SEQ ID NO: 1 , SEQ ID NO: 5, SEQ ID NO: 4, SEQ ID NO: 8, SEQ ID NO: 7 and SEQ ID NO: 2.
  • a corresponding sequence in which the N- terminal methionine is omitted may optionally be used as explained above.
  • SEQ ID NO: 6 is present at the N-terminal and SEQ ID NO: 2 is present at the C terminus.
  • the N-terminal methionine of SEQ ID NO: 2 is omitted.
  • the fusion protein has the sequence of SEQ ID NO: 79.
  • Fusion proteins of the invention may be fused to a second or further polypeptide selected from (i) other polypeptides which are melanoma associated antigens; (ii) polypeptide sequences which are capable of enhancing an immune response (i.e. immunostimulant sequences); and (iii) polypeptide sequences, e.g. comprising universal CD4 helper epitopes, which are capable of providing strong CD4+ help to increase CD8+ T cell responses to antigen epitopes.
  • the invention also provides nucleic acids encoding the aforementioned fusion polypeptides and other aspects of the invention (vectors, compositions, cells etc) mutatis mutandis as for the polypeptides of the invention.
  • protein protein
  • polypeptide peptide
  • peptide refers to any peptide-linked chain of amino acids, regardless of length, co-translational or post-translational modification.
  • amino acid refers to any one of the naturally occurring amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner which is similar to the naturally occurring amino acids.
  • Naturally occurring amino acids are those 20 L-amino acids encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, y-carboxyglutamate, and O-phosphoserine.
  • amino acid analogue refers to a compound that has the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group but has a modified R group ora modified peptide backbone as compared with a natural amino acid. Examples include homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium and norleucine.
  • Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
  • an amino acid is a naturally occurring amino acid or an amino acid analogue, especially a naturally occurring amino acid and in particular one of those 20 L-amino acids encoded by the genetic code.
  • Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the lUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
  • variants of polypeptide sequences of the fusion proteins of the invention include sequences having a high degree of sequence identity thereto.
  • variants suitably have at least about 80% identity, more preferably at least about 85% identity and most preferably at least about 90% identity (such as at least about 95%, at least about 98% or at least about 99%) to the associated reference sequence over their whole length.
  • the variant is an immunogenic variant.
  • a variant is considered to be an immunogenic variant where it elicits a response which is at least 20%, suitably at least 50% and especially at least 75% (such as at least 90%) of the activity of the reference sequence (i.e.
  • the sequence of which the variant is a variant e.g., in an in vitro restimulation assay of PBMC or whole blood with the polypeptide as antigen (e.g., restimulation for a period of between several hours to up to 1 year, such as up to 6 months, 1 day to 1 month or 1 to 2 weeks), that measures the activation of the cells via lymphoproliferation (e.g., T-cell proliferation), production of cytokines (e.g., IFN-gamma) in the supernatant of culture (measured by ELISA etc.) or characterisation of T-cell responses by intra and extracellular staining (e.g., using antibodies specific to immune markers, such as CD3, CD4, CD8, IL2, TNF-alpha, IFNg, Type 1 IFN, CD40L, CD69 etc.) followed by analysis with a flow cytometer.
  • lymphoproliferation e.g., T-cell proliferation
  • cytokines e.g., IFN-gamma
  • the variant may, for example, be a conservatively modified variant.
  • a “conservatively modified variant” is one where the alteration(s) results in the substitution of an amino acid with a functionally similar amino acid or the substitution/deletion/addition of residues which do not substantially impact the biological function of the variant.
  • such biological function of the variants will be to induce an immune response against a melanoma e.g. a cutaneous melanoma cancer antigen.
  • Variants can include homologues of polypeptides found in other species.
  • Fusion proteins of the invention may comprise a polypeptide having a variant sequence that contains a number of substitutions, for example, conservative substitutions (for example, 1-25, such as 1-10, in particular 1-5, and especially 1 amino acid residue(s) may be altered) when compared to the reference sequence.
  • the number of substitutions for example, conservative substitutions, may be up to 20% e.g., up to 10% e.g., up to 5% e.g., up to 1 % of the number of residues of the reference sequence.
  • conservative substitutions will fall within one of the amino-acid groupings specified below, though in some circumstances other substitutions may be possible without substantially affecting the immunogenic properties of the antigen.
  • the following eight groups each contain amino acids that are typically conservative substitutions for one another:
  • substitutions do not alter the immunological structure of an epitope (e.g., they do not occur within the epitope region as mapped in the primary sequence), and do not therefore have a significant impact on the immunogenic properties of the antigen.
  • Polypeptide variants also include those wherein additional amino acids are inserted compared to the reference sequence, for example, such insertions may occur at 1-10 locations (such as 1-5 locations, suitably 1 or 2 locations, in particular 1 location) and may, for example, involve the addition of 50 or fewer amino acids at each location (such as 20 or fewer, in particular 10 or fewer, especially 5 or fewer). Suitably such insertions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen.
  • One example of insertions includes a short stretch of histidine residues (e.g., 2-6 residues) to aid expression and/or purification of the antigen in question.
  • Polypeptide variants include those wherein amino acids have been deleted compared to the reference sequence, for example, such deletions may occur at 1-10 locations (such as 1-5 locations, suitably 1 or 2 locations, in particular 1 location) and may, for example, involve the deletion of 50 or fewer amino acids at each location (such as 20 or fewer, in particular 10 or fewer, especially 5 or fewer). Suitably such deletions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen.
  • a particular protein variant may comprise substitutions, deletions and additions (or any combination thereof).
  • substitutions/deletions/additions might enhance (or have neutral effects) on binding to desired patient HLA molecules, potentially increasing immunogenicity (or leaving immunogenicity unchanged).
  • Immunogenic fragments of the polypeptides of the fusion proteins according to the present invention will typically comprise at least 9 contiguous amino acids from the full-length polypeptide sequence (e.g., at least 9 or 10), such as at least 12 contiguous amino acids (e.g., at least 15 or at least 20 contiguous amino acids), in particular at least 50 contiguous amino acids, such as at least 100 contiguous amino acids (for example at least 200 contiguous amino acids) depending on the length of the CLT antigen.
  • the immunogenic fragments will be at least 10%, such as at least 20%, such as at least 50%, such as at least 70% or at least 80% of the length of the full- length polypeptide sequence.
  • Immunogenic fragments typically comprise at least one epitope.
  • Epitopes include B cell and T-cell epitopes and suitably immunogenic fragments comprise at least one T-cell epitope such as a CD4+ or a CD8+ T-cell epitope.
  • T-cell epitopes are short contiguous stretches of amino acids which are recognised by T-cells (e.g., CD4+ or CD8+ T-cells) when bound to HLA molecules. Identification of T-cell epitopes may be achieved through epitope mapping experiments which are well known to the person skilled in the art (see, for example, Paul, Fundamental Immunology, 3rd ed., 243-247 (1993); Bei barth et al., 2005, Bioinformatics, 21(Suppl. 1):i29-i37).
  • fragments of the full-length polypeptides of SEQ ID NOs. 1-8 which contain at least one T-cell epitope may be immunogenic and may contribute to immunoprotection.
  • an immunogenic fragment contains a plurality of the epitopes from the full-length sequence (suitably all epitopes within a CLT antigen).
  • Particular fragments of the antigenic polypeptides of SEQ ID NOs. 1-8 which may be of use include those containing at least one CD8+ T-cell epitope, suitably at least two CD8+ T-cell epitopes and especially all CD8+ T-cell epitopes, particularly those associated with a plurality of HLA alleles, e.g., those associated with 2, 3, 4, 5 or more alleles). Particular fragments of the antigenic polypeptides of SEQ ID NOs.
  • CD4+ T-cell epitope 1-8 which may be of use include those containing at least one CD4+ T-cell epitope, suitably at least two CD4+ T-cell epitopes and especially all CD4+ T-cell epitopes (particularly those associated with a plurality of HLA alleles, e.g., those associated with 2, 3, 4, 5 or more alleles).
  • a person skilled in design of vaccines could combine exogenous CD4+ T-cell epitopes with CD8+ T-cells epitopes and achieve desired responses to the CD8+ T-cell epitopes.
  • an individual fragment of the full-length polypeptide is used, such a fragment is considered to be immunogenic where it elicits a response which is at least 20%, suitably at least 50% and especially at least 75% (such as at least 90%) of the activity of the reference sequence (i.e., the sequence of which the fragment is a fragment) e.g., activity in an in vitro restimulation assay of PBMC or whole blood with the polypeptide as antigen (e.g., restimulation for a period of between several hours to up to 1 year, such as up to 6 months, 1 day to 1 month or 1 to 2 weeks,) that measures the activation of the cells via lymphoproliferation (e.g., T-cell proliferation), production of cytokines (e.g., IFN-gamma) in the supernatant of culture (measured by ELISA etc.) or characterisation of T-cell responses by intra and extracellular staining (e.g., using antibodies specific to immune markers, such as CD3, CD4, CD8,
  • a plurality of fragments of the full-length polypeptide may be used to obtain an equivalent biological response to the full- length sequence itself.
  • at least two immunogenic fragments such as three, four or five as described above, which in combination provide at least 50%, suitably at least 75% and especially at least 90% activity of the reference sequence in an in vitro restimulation assay of PBMC or whole blood (e.g., a T-cell proliferation and/or IFN-gamma production assay).
  • Example immunogenic fragments of antigenic polypeptides of SEQ ID NOs. 1-8, and thus example component peptides of fusion proteins of the invention, include polypeptides which comprise or consist of the sequences of SEQ ID NOs. 9-55.
  • the sequences of SEQ ID NOs. 9-12, 18-19, 30, 31-32 and 37-39, 45, 48-54 were identified as being bound to HLA Class I molecules from immunopeptidomic analysis (see Example 2).
  • the sequences of SEQ ID NOs 13-17, 20-29, 33-35, 40-44 were predicted by NetMHC software as being bound to HLA Class I molecules and were used in immunological validation assays (see Examples 3, 4 and 5).
  • the antigenic polypeptide component (a) of the fusion protein may comprise or consist of SEQ ID NO. 1 or a variant thereof, or an immunogenic fragment of SEQ ID NO: 1 or a variant thereof.
  • Exemplary fragments comprise or consist of any one of SEQ ID NOs. 9-12.
  • Further exemplary fragments comprise two, three or four of SEQ ID NOs. 9-12.
  • Further exemplary fragments comprise or consist of any one of SEQ ID NOs. 13-17.
  • Further exemplary fragments comprise all of SEQ ID NOs. 9-17 (allowance being taken for possible sequence overlap so that any overlapping sequence does not need to be present more than once).
  • the antigenic polypeptide component (b) of the fusion protein may comprise or consist of SEQ ID NO. 2 or a variant thereof, or an immunogenic fragment of SEQ ID NO: 2 or a variant thereof.
  • Exemplary fragments comprise or consist of SEQ I D NO. 18 or SEQ ID NO. 19.
  • Further exemplary fragments comprise SEQ ID NO. 18 and SEQ ID NO. 19.
  • Further exemplary fragments comprise or consist of any one of SEQ ID NOs. 20-30.
  • Further exemplary fragments comprise all of SEQ ID NOs. 18-30 (allowance being taken for possible sequence overlap so that any overlapping sequence does not need to be present more than once).
  • the antigenic polypeptide component (c) of the fusion protein may comprise or consist of SEQ ID NO. 6 or a variant thereof, or an immunogenic fragment of SEQ ID NO: 6 or a variant thereof.
  • Exemplary fragments comprise or consist of SEQ ID NO. 48-51.
  • the antigenic polypeptide component (d) of the fusion protein may comprise or consist of SEQ ID NO. 7 or a variant thereof, or an immunogenic fragment of SEQ ID NO: 7 or a variant thereof.
  • Exemplary fragments comprise or consist of SEQ ID NO. 52.
  • the antigenic polypeptide component (e) of the fusion protein may comprise or consist of SEQ ID NO. 4 or a variant thereof, or an immunogenic fragment of SEQ ID NO: 4 or a variant thereof.
  • Exemplary fragments comprise or consist of SEQ ID NO. 36.
  • Further exemplary fragments comprise or consist of SEQ ID NO. 37 or SEQ ID NO. 38.
  • Further exemplary fragments comprise or consist of SEQ ID NO. 39.
  • Further exemplary fragments comprise or consist of any one of SEQ ID NOs. 40-44.
  • Further exemplary fragments comprise SEQ ID NO. 36 and either SEQ ID NO. 37 or SEQ ID NO. 38.
  • Further exemplary fragments comprise SEQ ID NO. 39 and either SEQ ID NO. 37 or SEQ ID NO. 38.
  • exemplary fragments comprise all of SEQ ID NOs. 36-44 (allowance being taken for possible sequence overlap so that any overlapping sequence does not need to be present more than once).
  • the antigenic polypeptide component (f) of the fusion protein may comprise or consist of SEQ ID NO. 8 or a variant thereof, or an immunogenic fragment of SEQ ID NO: 8 or a variant thereof.
  • Exemplary fragments comprise or consist of SEQ ID NO. 53-55.
  • the antigenic polypeptide component (g) of the fusion protein may comprise or consist of SEQ ID NO. 3 or a variant thereof, or an immunogenic fragment of SEQ ID NO: 3 or a variant thereof.
  • Exemplary fragments comprise or consist of SEQ I D NO. 31 .
  • Further exemplary fragments comprise SEQ ID NO. 31.
  • Further exemplary fragments comprise or consist of any one of SEQ ID NOs. 32-35.
  • Further exemplary fragments comprise SEQ ID NO. 31 and SEQ ID NO. 32.
  • Further exemplary fragments comprise all of SEQ ID NOs. 31-35 (allowance being taken for possible sequence overlap so that any overlapping sequence does not need to be present more than once).
  • the antigenic polypeptide component (h) of the fusion protein may comprise or consist of SEQ ID NO. 5 or a variant thereof, or an immunogenic fragment of SEQ ID NO: 5 or a variant thereof.
  • Exemplary fragments comprise or consist of any one of SEQ ID NOs. 45-47.
  • the invention provides for fusion proteins wherein the antigenic polypeptides of the fusion proteins are joined together by one or more peptide linkers.
  • the antigenic polypeptides of the fusion protein of the present invention are joined together by one or more linkers (e.g. two, three, four, five, six or seven linkers).
  • a linker may separate each of the antigenic polypeptides of the fusion protein.
  • the linkers may be ‘internal’, i.e. the linkers are not present at the N terminus of the first polypeptide and the C terminus of the last polypeptide of the fusion protein.
  • the one or more linkers are positioned between antigenic polypeptides (a) and (b), (b) and (c), (c) and (d), (d) and (e), (e) and (f). In another embodiment of the invention, the one or more linkers are positioned between antigenic polypeptides (c) and (f), (f) and (d), (d) and (b), (b) and (e), (e) and (a). In a further embodiment of the invention, the linkers are positioned between antigenic polypeptides (a) and (b), (b) and (g), (g) and (d), (d) and (e), (e) and (h), (h) and (c), (c) and (f).
  • the linkers are positioned between antigenic polypeptides (c) and (g), (g) and (a), (a) and (h), (h) and (e), (e) and (f), (f) and (d), (d) and (b).
  • the linker may refer to the cDNA encoding the linker peptide sequence, or the encoded peptide.
  • the linkers are placed between the individual antigens of each fusion protein of the invention by creating a single construct in which the linker sequence is inserted between the C terminus of one antigenic polypeptide and the N terminus of the following antigenic polypeptide, thereby linking the antigenic polypeptides of the fusion protein together.
  • the individual linkers used in a fusion protein may have the same sequence or they may have different sequences.
  • the linkers are selected from the peptide linkers having the sequences of SEQ ID NOs: 71-75 and 84.
  • the fusion protein comprises or consists of a sequence selected from SEQ ID NOs: 76-79.
  • the linkers of the present invention are glycine based linkers, which may also include lysines, in a connector of 3 to 6 amino acids in length (see of SEQ ID NOs: 71- 75 and 84).
  • the linkers of the present invention reduce the risk of introducing unwanted immunogenic epitopes which contain the linker itself; they also prevent the unwanted epitopes created by direct fusion of the individual antigenic polypeptides.
  • the fusion proteins of the present invention may be created through the joining of six or more genes (e.g. six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen) that encode for separate antigenic polypeptides and cDNAs that encode linkers that have been joined so that the resulting open reading frames are transcribed and translated as a single unit producing a single protein.
  • Nucleic acids encoding the fusion proteins of the present invention may comprise or consist of a sequence selected from SEQ ID NOs: 80-83.
  • the invention provides an isolated nucleic acid encoding the fusion proteins of the invention (referred to as a nucleic acid of the invention).
  • nucleic acid and “polynucleotide” are used interchangeably herein and refer to a polymeric macromolecule made from nucleotide monomers particularly deoxyribonucleotide or ribonucleotide monomers.
  • the term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are naturally occurring and non-naturally occurring, which have similar properties as the reference nucleic acid, and which are intended to be metabolized in a manner similar to the reference nucleotides or are intended to have extended half-life in the system.
  • nucleic acid refers to naturally occurring polymers of deoxyribonucleotide or ribonucleotide monomers.
  • nucleic acid molecules of the invention are recombinant.
  • nucleic acid molecule is the product of at least one of cloning, restriction or ligation steps, or other procedures that result in a nucleic acid molecule that is distinct from a nucleic acid molecule found in nature (e.g., in the case of cDNA).
  • nucleic acid of the invention is an artificial nucleic acid sequence (e.g., a cDNA sequence or nucleic acid sequence with non-naturally occurring codon usage).
  • the nucleic acids of the invention are DNA.
  • the nucleic acids of the invention are RNA.
  • DNA deoxyribonucleic acid
  • RNA ribounucleic acid
  • the sugar moieties may be linked to bases which are the 4 natural bases (adenine (A), guanine (G), cytosine (C) and thymine (T) in DNA and adenine (A), guanine (G), cytosine (C) and uracil (U) in RNA).
  • a “corresponding RNA” is an RNA having the same sequence as a reference DNA but for the substitution of thymine (T) in the DNA with uracil (U) in the RNA.
  • the sugar moieties may also be linked to unnatural bases such as inosine, xanthosine, 7-methylguanosine, dihydrouridine and 5-methylcytidine.
  • Natural phosphodiester linkages between sugar (deoxyribosyl/ribosyl) moieties may optionally be replaced with phosphorothioates linkages.
  • nucleic acids of the invention consist of the natural bases attached to a deoxyribosyl or ribosyl sugar backbone with phosphodiester linkages between the sugar moieties.
  • the nucleic acid of the invention is a DNA.
  • the nucleic acid comprises or consists of a sequence selected from SEQ ID NOs. 56-62 and 63-70.
  • a nucleic acid which comprises or consists of a variant of sequence selected from SEQ ID NOs. 56-62 or 63-70 which variant encodes the same amino acid sequence but has a different nucleic acid based on the degeneracy of the genetic code.
  • nucleic acids can encode any given polypeptide.
  • the codons GCA, GCC, GCG and GCU all encode the amino acid alanine.
  • the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
  • Such nucleic acid variations lead to “silent” (sometimes referred to as “degenerate” or “synonymous”) variants, which are one species of conservatively modified variations. Every nucleic acid sequence disclosed herein which encodes a polypeptide also enables every possible silent variation of the nucleic acid.
  • each codon in a nucleic acid can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid that encodes a polypeptide is implicit in each described sequence and is provided as an aspect of the invention.
  • Degenerate codon substitutions may also be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed- base and/or deoxyinosine residues (Batzer et al., 1991 , Nucleic Acid Res. 19:5081 ; Ohtsuka et al., 1985, J. Biol. Chem. 260:2605-2608; Rossolini et al., 1994, Mol. Cell. Probes 8:91-98).
  • a nucleic acid of the invention which comprises or consists of a sequence selected from SEQ ID NOs. 56-62 and 63-70 may contain a number of silent variations (for example, 1-50, such as 1-25, in particular 1-5, and especially 1 codon(s) may be altered) when compared to the reference sequence.
  • the nucleic acid of the invention is an RNA.
  • RNA sequences are provided which correspond to a DNA sequence provided herein and have a ribonucleotide backbone instead of a deoxyribonucleotide backbone and have the sidechain base uracil (U) in place of thymine (T).
  • RNA equivalent is meant an RNA sequence which contains the same genetic information as the reference cDNA sequence (i.e. contains the same codons with a ribonucleotide backbone instead of a deoxyribonucleotide backbone and having the sidechain base uracil (U) in place of thymine (T)).
  • the invention also comprises sequences which are complementary to the aforementioned cDNA and RNA sequences.
  • nucleic acids of the invention are codon optimised for expression in a human host cell.
  • nucleic acids of the invention are capable of being transcribed and translated into fusion proteins of the invention in the case of DNA nucleic acids, and translated into fusion proteins of the invention in the case of RNA nucleic acids.
  • Polypeptides and Nucleic acids are capable of being transcribed and translated into fusion proteins of the invention in the case of DNA nucleic acids, and translated into fusion proteins of the invention in the case of RNA nucleic acids.
  • nucleic acids used in the present invention are isolated.
  • An “isolated” nucleic acid is one that is removed from its original environment.
  • a naturally- occurring nucleic acid is isolated if it is separated from some or all of the coexisting materials in the natural system.
  • a nucleic acid is considered to be isolated if, for example, it is cloned into a vector that is not a part of its natural environment.
  • Naturally occurring when used with reference to a polypeptide or nucleic acid sequence means a sequence found in nature and not synthetically modified.
  • “Artificial” when used with reference to a polypeptide or nucleic acid sequence means a sequence not found in nature which is, for example, a synthetic modification of a natural sequence, or contains an unnatural sequence.
  • heterologous when used with reference to the relationship of one nucleic acid or polypeptide to another nucleic acid or polypeptide indicates that the two or more sequences are not found in the same relationship to each other in nature.
  • a “heterologous” sequence can also mean a sequence which is not isolated from, derived from, or based upon a naturally occurring nucleic acid or polypeptide sequence found in the host organism.
  • fusion proteins of the invention may comprise a polypeptide having a variant sequence, preferably having at least about 80% identity, more preferably at least about 85% identity and most preferably at least about 90% identity (such as at least about 95%, at least about 98% or at least about 99%) to the associated reference sequence over their whole length.
  • the “% sequence identity" between a first sequence and a second sequence may be calculated.
  • Polypeptide sequences are said to be the same as or identical to other polypeptide sequences, if they share 100% sequence identity over their entire length. Residues in sequences are numbered from left to right, i.e. from N- to C- terminus for polypeptides.
  • identity in the context of two or more polypeptide sequences, refer to two or more sequences or sub-sequences that are the same or have a specified percentage of amino acid residues that are the same (i.e., 70% identity, optionally 75%, 80%, 85%, 90%, 95%, 98% or 99% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window.
  • the comparison is performed over a window corresponding to the entire length of the reference sequence.
  • one sequence acts as the reference sequence, to which the test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percentage sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • a “comparison window”, as used herein, refers to a segment in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequences for comparison are well-known in the art.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, 1981 , Adv. Appl. Math. 2:482, by the homology alignment algorithm of Needleman & Wunsch, 1970, J. Mol. Biol. 48:443, by the search for similarity method of Pearson & Lipman, 1988, Proc. Nat’l. Acad. Sci.
  • PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments to show relationship and percent sequence identity. It also plots a tree or dendogram showing the clustering relationships used to create the alignment.
  • PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, 1987, J. Mol. Evol. 35:351-360. The method used is similar to the method described by Higgins & Sharp, 1989, CABIOS 5:151-153.
  • the program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids.
  • the multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences.
  • This cluster is then aligned to the next most related sequence or cluster of aligned sequences.
  • Two clusters of sequences are aligned by a simple extension of the pairwise alignment of two individual sequences.
  • the final alignment is achieved by a series of progressive, pairwise alignments.
  • the program is run by designating specific sequences and their amino acid coordinates for regions of sequence comparison and by designating the program parameters.
  • PILEUP a reference sequence is compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps.
  • PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux etai, 1984, Nuc. Acids Res. 12:387-395).
  • HSPs high scoring sequence pairs
  • T is referred to as the neighbourhood word score threshold (Altschul et ai., supra). These initial neighbourhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score.
  • Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, 1993, Proc. Nat’l. Acad. Sci. USA 90:5873- 5787).
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
  • a “difference” between sequences refers to an insertion, deletion or substitution of a single residue in a position of the second sequence, compared to the first sequence.
  • Two sequences can contain one, two or more such differences. Insertions, deletions or substitutions in a second sequence which is otherwise identical (100% sequence identity) to a first sequence result in reduced % sequence identity. For example, if the identical sequences are 9 residues long, one substitution in the second sequence results in a sequence identity of 88.9%. If the identical sequences are 17 amino acid residues long, two substitutions in the second sequence results in a sequence identity of 88.2%.
  • the number of additions, substitutions and/or deletions made to the first sequence to produce the second sequence may be ascertained.
  • An addition is the addition of one residue into the first sequence (including addition at either terminus of the first sequence).
  • a substitution is the substitution of one residue in the first sequence with one different residue.
  • a deletion is the deletion of one residue from the first sequence (including deletion at either terminus of the first sequence).
  • Fusion proteins of the invention can be obtained and manipulated using the techniques disclosed for example in Green and Sambrook 2012 Molecular Cloning: A Laboratory Manual 4th Edition Cold Spring Harbour Laboratory Press.
  • artificial gene synthesis may be used to produce polynucleotides (Nambiar et al., 1984, Science, 223:1299-1301 , Sakamar and Khorana, 1988, Nucl. Acids Res., 14:6361- 6372, Wells et al., 1985, Gene, 34:315-323 and Grundstrom et al., 1985, Nucl. Acids Res., 13:3305-3316) followed by expression in a suitable organism to produce polypeptides.
  • a gene encoding a polypeptide of the fusion proteins of the invention can be synthetically produced by, for example, solid-phase DNA synthesis. Entire genes may be synthesized de novo , without the need for precursor template DNA.
  • the building blocks are sequentially coupled to the growing oligonucleotide chain in the order required by the sequence of the product. Upon the completion of the chain assembly, the product is released from the solid phase to solution, deprotected, and collected. Products can be isolated by high-performance liquid chromatography (HPLC) to obtain the desired oligonucleotides in high purity (Verma and Eckstein, 1998, Annu. Rev. Biochem. 67:99-134).
  • nucleic acids of the invention will comprise suitable regulatory and control sequences (including promoters, termination signals etc) and sequences to promote polypeptide secretion suitable for protein production in the host.
  • fusion proteins of the invention could be produced by transducing cultures of eukaryotic cells (e.g., Chinese hamster ovary cells or drosophila S2 cells) with nucleic acids of the invention which have been combined with suitable regulatory and control sequences (including promoters, termination signals etc) and sequences to promote polypeptide secretion suitable for protein production in these cells.
  • Improved isolation of the fusion proteins of the invention produced by recombinant means may optionally be facilitated through the addition of a stretch of histidine residues (commonly known as a His-tag) towards one end of the protein.
  • His-tag a stretch of histidine residues
  • Fusion proteins may also be produced synthetically.
  • nucleic acid e.g., DNA
  • the nucleic acid may be present within any of a variety of delivery systems known to those of ordinary skill in the art, including nucleic acid expression systems, bacteria and some viral expression systems. Numerous gene delivery techniques are well known in the art, such as those described by Rolland, 1998, Crit. Rev. Therap. Drug Carrier Systems 15:143-198, and references cited therein. Several of these approaches are outlined below for the purpose of illustration.
  • a vector also referred to herein as a ⁇ NA expression construct’ or ‘construct’
  • a nucleic acid molecule of the invention comprising a nucleic acid molecule of the invention.
  • the vector comprises nucleic acid encoding regulatory elements (such as a suitable promoter and terminating signal) suitable for permitting transcription of a translationally active RNA molecule in a human host cell.
  • regulatory elements such as a suitable promoter and terminating signal
  • a “translationally active RNA molecule” is an RNA molecule capable of being translated into a protein by a human cell’s translation apparatus. Accordingly, there is provided a vector comprising a nucleic acid of the invention (herein after a “vector of the invention”).
  • the vector may be a viral vector.
  • the viral vector may be an adenovirus, adeno-associated virus (AAV) (e.g., AAV type 5 and type 2), alphavirus (e.g., Venezuelan equine encephalitis virus (VEEV), Sindbis virus (SIN), Semliki Forest virus (SFV)), herpes virus, arenavirus (e.g., lymphocytic choriomeningitis virus (LCMV)), measles virus, poxvirus (such as modified vaccinia Ankara (MVA)), paramyxovirus, lentivirus, or rhabdovirus (such as vesicular stomatitis virus (VSV)) vector i.e. the vector may be derived from any of the aforementioned viruses.
  • the viral vector is an adenovirus.
  • the viral vector is a pox virus, e.g. MVA.
  • Adenoviruses are particularly suitable for use as a gene transfer vector because of its mid-sized genome, ease of manipulation, high titre, wide target-cell range and high infectivity. Both ends of the viral genome contain 100-200 base pair inverted repeats (ITRs), which are cis elements necessary for viral DNA replication and packaging.
  • ITRs inverted repeats
  • the early (E) and late (L) regions of the genome contain different transcription units that are divided by the onset of viral DNA replication.
  • the E1 region (E1A and E1B) encodes proteins responsible for the regulation of transcription of the viral genome and a few cellular genes.
  • the expression of the E2 region results in the synthesis of the proteins for viral DNA replication.
  • MLP major late promoter
  • TPL 5‘-tripartite leader
  • Replication-deficient adenovirus which are created by from viral genomes that are deleted for one or more of the early genes are particularly useful, since they have limited replication and less possibility of pathogenic spread within a vaccinated host and to contacts of the vaccinated host.
  • the expression construct comprising one or more polynucleotide sequences may simply consist of naked recombinant DNA plasmids. See Ulmer et ai, 1993, Science 259:1745-1749 and reviewed by Cohen, 1993, Science 259:1691-1692. Transfer of the construct may be performed, for example, by any method which physically or chemically permeabilises the cell membrane. This is particularly applicable for transfer in vitro but it may be applied to in vivo use as well. It is envisioned that DNA encoding a gene of interest may also be transferred in a similar manner in vivo and express the gene product. Multiple delivery systems have been used to deliver DNA molecules into animal models and into man. Some products based on this technology have been licensed for use in animals, and others are in phase 2 and 3 clinical trials in man.
  • the expression construct comprising one or more polynucleotide sequences may consist of naked, recombinant DNA-derived RNA molecules (Ulmer et al. , 2012,
  • RNA molecules As for DNA-based expression constructs, a variety of methods can be utilized to introduce RNA molecules into cells in vitro or in vivo.
  • the RNA-based constructs can be designed to mimic simple messenger RNA (mRNA) molecules, such that the introduced biological molecule is directly translated by the host cell’s translation machinery to produce its encoded polypeptide in the cells to which it has been introduced.
  • mRNA simple messenger RNA
  • RNA molecules may be designed in a manner that allows them to self-amplify within cells they are introduced into, by incorporating into their structure genes for viral RNA-dependent RNA polymerases.
  • SAMTM self-amplifying mRNA
  • RNA-based viral vectors Either mRNA-based or SAMTM RNAs may be further modified (e.g., by alteration of their sequences, or by use of modified nucleotides) to enhance stability and translation (Schlake et al., RNA Biology, 9: 1319-1330), and both types of RNAs may be formulated (e.g., in emulsions (Brito et al., Molecular Therapy, 201422:2118-2129) or lipid nanoparticles (Kranz et al., 2006, Nature, 534:396-401)) to facilitate stability and/or entry into cells in vitro or in vivo.
  • Myriad formulations of modified (and non-modified) RNAs have been tested as vaccines in animal models and in man, and multiple RNA- based vaccines are being used in ongoing clinical trials.
  • compositions of the invention may be formulated for delivery in pharmaceutical compositions such as immunogenic compositions and vaccine compositions (all hereinafter “compositions of the invention”).
  • compositions of the invention suitably comprise a fusion protein, nucleic acid or vector of the invention together with a pharmaceutically acceptable carrier.
  • an immunogenic pharmaceutical composition comprising a fusion protein, nucleic acid or vector of the invention together with a pharmaceutically acceptable carrier.
  • compositions of the invention comprising a fusion protein, nucleic acid or vector of the invention together with a pharmaceutically acceptable carrier.
  • a pharmaceutically acceptable carrier Preparation of pharmaceutical compositions is generally described in, for example, Powell & Newman, eds., Vaccine Design (the subunit and adjuvant approach), 1995.
  • Compositions of the invention may also contain other compounds, which may be biologically active or inactive.
  • the composition of the invention is a sterile composition suitable for parenteral administration.
  • compositions of the invention which comprise one or more (e.g. one) fusion proteins of the invention in combination with a pharmaceutically acceptable carrier.
  • compositions of the invention which comprise one or more (e.g. one) nucleic acids encoding a fusion protein of the invention or one or more (e.g., one) vectors of the invention in combination with a pharmaceutically acceptable carrier.
  • compositions of the invention may comprise one or more (e.g., one) polynucleotide and one or more (e.g., one) fusion protein components.
  • the compositions may comprise one or more (e.g., one) vector and one or more (e.g., one) fusion protein components.
  • the compositions may comprise one or more (e.g., one) vector and one or more (e.g., one) polynucleotide components.
  • Such compositions may provide for an enhanced immune response.
  • composition of the invention may contain pharmaceutically acceptable salts of the nucleic acids or fusion proteins provided herein.
  • Such salts may be prepared from pharmaceutically acceptable non-toxic bases, including organic bases (e.g., salts of primary, secondary and tertiary amines and basic amino acids) and inorganic bases (e.g., sodium, potassium, lithium, ammonium, calcium and magnesium salts).
  • compositions of the present invention may be formulated for any appropriate manner of administration, including for example, parenteral, topical, oral, nasal, intravenous, intracranial, intraperitoneal, subcutaneous or intramuscular administration, preferably parenteral e.g., intramuscular, subcutaneous or intravenous administration.
  • the carrier preferably comprises water and may contain buffers for pH control, stabilising agents e.g., surfactants and amino acids and tonicity modifying agents e.g., salts and sugars.
  • the formulation may contain a lyoprotectant e.g., sugars such as trehalose.
  • a lyoprotectant e.g., sugars such as trehalose.
  • any of the above carriers or a solid carrier such as mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, sucrose, and magnesium carbonate, may be employed.
  • compositions of the invention may comprise buffers (e.g., neutral buffered saline or phosphate buffered saline), carbohydrates (e.g., glucose, mannose, sucrose or dextrans), mannitol, proteins, polypeptides or amino acids such as glycine, antioxidants, bacteriostats, chelating agents such as EDTA or glutathione, solutes that render the formulation isotonic, hypotonic or weakly hypertonic with the blood of a recipient, suspending agents, thickening agents and/or preservatives.
  • buffers e.g., neutral buffered saline or phosphate buffered saline
  • carbohydrates e.g., glucose, mannose, sucrose or dextrans
  • mannitol e.g., proteins, polypeptides or amino acids
  • proteins e.glycine
  • antioxidants e.g., mannitol
  • proteins e.g., polypeptides or
  • compositions of the invention may also comprise one or more immunostimulants.
  • An immunostimulant may be any substance that enhances or potentiates an immune response (antibody and/or cell-mediated) to an exogenous antigen.
  • immunostimulants which are often referred to as adjuvants in the context of vaccine formulations, include aluminium salts such as aluminium hydroxide gel (alum) or aluminium phosphate, saponins including QS21 , immunostimulatory oligonucleotides such as CPG, oil-in-water emulsion (e.g., where the oil is squalene), aminoalkyl glucosaminide 4-phosphates, lipopolysaccharide or a derivative thereof e.g., 3-de-O-acylated monophosphoryl lipid A (3D-MPL®) and other TLR4 ligands, TLR7 ligands, TLR8 ligands, TLR9 ligands, IL-12 and interferon
  • the one or more immunostimulants of the composition of the invention are selected from aluminium salts, saponins, immunostimulatory oligonucleotides, oil-in-water emulsions, aminoalkyl glucosaminide 4-phosphates, lipopolysaccharides and derivatives thereof and other TLR4 ligands, TLR7 ligands, TLR8 ligands and TLR9 ligands.
  • Immunostimulants may also include monoclonal antibodies which specifically interact with other immune components, for example monoclonal antibodies that block the interaction of immune checkpoint receptors, including PD-1 and CTLA4.
  • the genes encoding protein-based immunostimulants may be readily delivered along with the genes encoding fusion proteins of the invention.
  • compositions described herein may be administered as part of a sustained- release formulation (i.e., a formulation such as a capsule, sponge, patch or gel (composed of polysaccharides, for example)) that effects a slow/sustained release of compound following administration.
  • a sustained- release formulation i.e., a formulation such as a capsule, sponge, patch or gel (composed of polysaccharides, for example)
  • compositions of the invention may be presented in unit-dose or multi-dose containers, such as sealed ampoules or vials. Such containers are preferably hermetically sealed to preserve sterility of the formulation until use.
  • formulations may be stored as suspensions, solutions or emulsions in oily or aqueous vehicles.
  • a composition of the invention may be stored in a freeze-dried condition requiring only the addition of a sterile liquid carrier (such as water or saline for injection) immediately prior to use.
  • each composition of the invention may be prepared in such a way that a suitable dosage for therapeutic or prophylactic use will be obtained.
  • Factors such as solubility, bioavailability, biological half-life, route of administration, product shelf life, as well as other pharmacological considerations will be contemplated by one skilled in the art of preparing such compositions, and as such, a variety of dosages and treatment regimens may be desirable.
  • compositions comprising a therapeutically or prophylactically effective amount deliver about 0.1 ug to about 1000 ug of fusion protein of the invention per administration, more typically about 2.5 ug to about 100 ug of fusion protein per administration. If delivered in the form of short, synthetic long peptides, doses could range from 1 to 200ug/peptide/dose.
  • these typically deliver about 10 ug to about 20 mg of the nucleic acid of the invention per administration, more typically about 0.1 mg to about 10 mg of the nucleic acid of the invention per administration.
  • SEQ ID NOs. 1-8 are polypeptide sequences corresponding to CLT antigens of the fusion proteins of the invention which are over-expressed in cutaneous melanoma.
  • the invention provides a fusion protein, nucleic acid, vector or composition of the invention for use in medicine.
  • Further aspects of the invention relate to a method of raising an immune response in a human which comprises administering to said human the fusion protein, nucleic acid, vector or composition of the invention.
  • the present invention also provides a fusion protein, nucleic acid, vector or composition of the invention for use in raising an immune response in a human.
  • fusion protein, nucleic acid, vector or composition in raising an immune response in a human against a cancer depends on corresponding antigenic sequences (or one or more of them) being expressed by the cancer.
  • antigenic sequences or one or more of them
  • the immune response is raised against a cancer expressing a corresponding sequence selected from (a) to (f), optionally (g) and (h) orvariant or immunogenic fragment thereof,.
  • corresponding means that if the tumor expresses (or is likely to express), say, SEQ ID NO. A (A being one of SEQ ID NOs.
  • the fusion protein, nucleic acid, vector or composition of the invention and medicaments involving these will include SEQ ID NO. A or a variant or immunogenic fragment thereof.
  • the immune response comprises CD8+ T-cell, a CD4+ T-cell and/or an antibody response, particularly CD8+ cytolytic T-cell response and a CD4+ helper T-cell response.
  • the immune response is raised against a tumor, particularly one expressing a sequence selected from (a) to (f), optionally (g) and (h) or variant or immunogenic fragment thereof.
  • the tumor is a melanoma tumor e.g. a cutaneous melanoma tumor.
  • the tumor may be a primary tumor or a metastatic tumor.
  • Further aspects of the invention relate to a method of treating a human patient suffering from cancer wherein the cells of the cancer express a sequence selected from SEQ ID NOs. 1-8 and immunogenic fragments and variants of any one thereof, or of preventing a human from suffering from cancer which cancer would express a sequence selected from SEQ ID NOs. 1-8 and immunogenic fragments and variants of any one thereof, which method comprises administering to said human a fusion protein, nucleic acid, vector or composition of the invention.
  • the present invention also provides a fusion protein, nucleic acid, vector or composition of the invention for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1- 8 and immunogenic fragments of any one thereof.
  • the present invention also provides a method of treating a human suffering from cancer, comprising the steps of: (a) determining if the cells of said cancer express a polypeptide sequence selected from antigenic polypeptides (a) to (h) or a nucleic acid encoding said antigenic polypeptide or variant or immunogenic fragment thereof; and if so, (b) administering to said human a corresponding fusion protein, nucleic acid, vector, composition according to the invention.
  • Transcripts corresponding to SEQ ID NOs. 14 and 20 were also overexpressed in uveal melanoma. Consequently, in an alternative embodiment, the tumor is a uveal melanoma tumor and/or the tumor expresses a sequence selected from SEQ ID NOs. 1 , 3 and 4. Thus, fusion proteins of the present invention may therefore be indicated in subjects having uveal cancer.
  • a therapeutic regimen may involve either simultaneous (such as co administration) or sequential (such as a prime-boost) delivery of (i) a fusion protein, nucleic acid or vector of the invention with (ii) one or more further fusion proteins, nucleic acids or vectors of the invention and/or (iii) a further component such as a variety of other therapeutically useful compounds or molecules such as antigenic proteins optionally simultaneously administered with adjuvant.
  • co administration include homo-lateral co-administration and contra-lateral co administration.
  • “Simultaneous” administration suitably refers to all components being delivered during the same round of treatment. Suitably all components are administered at the same time (such as simultaneous administration of both DNA and protein), however, one component could be administered within a few minutes (for example, at the same medical appointment or doctor’s visit) or within a few hours.
  • a “priming” or first administration of a fusion protein, nucleic acid or vector of the invention may be followed by one or more “boosting” or subsequent administrations of a fusion protein, nucleic acid or vector of the invention (“prime and boost” method).
  • the fusion protein, nucleic acid or vector of the invention may be used in a prime-boost vaccination regimen.
  • Both the prime and boost may be a fusion protein of the invention, the same fusion protein of the invention in each case.
  • Both the prime and boost may be a fusion protein of the invention, where different fusion proteins of the invention are used in each case.
  • Both the prime and boost may be a nucleic acid or vector of the invention, the same nucleic acid or vector of the invention in each case.
  • Both the prime and boost may be a nucleic acid or vector of the invention, where different nucleic acids or vectors of the invention are used in each case.
  • the prime may be performed using a nucleic acid or vector of the invention and the boost performed using a fusion protein of the invention or the prime may be performed using a fusion protein of the invention and the boost performed using a nucleic acid or vector of the invention.
  • first or “priming” administration and the second or “boosting” administration are given about 1-12 weeks later, or up to 4-6 months later.
  • Subsequent “booster” administrations may be given as frequently as every 1-6 weeks or may be given much later (up to years later).
  • a prime fusion protein comprises six antigenic polypeptides (a) to (f) wherein the antigenic polypeptides (a) to (f) are arranged in the order from N to C of (a), (b), (c), (d), (e) and (f) as exemplified by CLT Antigen Fusion Protein 1 (SEQ ID NO.
  • a boost fusion protein comprises six antigenic polypeptides (a) to (f) wherein the antigenic polypeptides (a) to (f) are arranged in the order from N to C of (c), (f), (d), (b), (e) and (a) as exemplified by CLT Antigen Fusion Protein 2 (SEQ ID NO.
  • a prime fusion protein comprises eight antigenic polypeptides (a) to (h) wherein the antigenic polypeptides (a) to (h) are arranged in the order from N to C of (a), (b), (g), (d), (e), (h), (c) and (f) as exemplified by CLT Antigen Fusion Protein 3 (SEQ ID NO. 78).
  • the boost fusion protein comprises eight antigenic polypeptides (a) to (h) wherein the antigenic polypeptides (a) to (h) are arranged in the order from N to C of (c), (g), (a), (h), (e), (f), (d) and (b) as exemplified by CLT Antigen Fusion Protein 4 (SEQ ID NO. 79).
  • SEQ ID NO. 79 CLT Antigen Fusion Protein 4
  • (a) is present at the N terminus and (f) is present at the C terminal of the prime and (c) is present at the N terminus and (b) is present at the C terminal of the boost.
  • the fusion proteins, nucleic acids or vectors of the invention can be used in combination with one or more other antigenic polypeptides (or polynucleotides or vectors encoding them) which cause an immune response to be raised against melanoma e.g. cutaneous or uveal melanoma.
  • antigenic polypeptides could be derived from diverse sources, they could include well-described melanoma- associated antigens, such as GPR143, PRAME, MAGE-A3 or pMel (gp100). Alternatively they could include other types of melanoma antigens, including patient- specific neoantigens (Lauss et al. (2017). Nature Communications, 8(1), 1738.
  • melanoma antigens that fit within the category known as antigens encoding T-cell epitopes associated with impaired peptide processing (TIEPPs; Gigoux, M., & Wolchok, J. (2016). JEM, 215, 2233, Marijt et al. (2016). JEM 215, 2325), or to-be discovered neoantigens (including CLT antigens).
  • TIEPPs impaired peptide processing
  • JEM 215, 2233, Marijt et al. (2018). JEM 215, 2325
  • neoantigens including CLT antigens.
  • the antigenic peptides from these various sources could also be combined with (i) non-specific immunostimulant/adjuvant species and/or (ii) an antigen, e.g.
  • CD4 helper epitopes known to elicit strong CD4 helper T-cells (delivered as a polypeptides, or as polynucleotides or vectors encoding these CD4 antigens), to amplify the anti-melanoma-specific responses elicited by co-administered antigens.
  • Nucleic acids and vectors comprising them may be provided which encode the aforementioned proteins. Different proteins, nucleic acids or vectors may be formulated in the same formulation or in separate formulations.
  • a number of components are contained within a single fusion protein or a polynucleotide encoding a single fusion protein (see below). All components may be provided within a single fusion protein. Alternatively, all components may be provided as polynucleotides (e.g., a single polynucleotide, such as one encoding a single fusion protein).
  • the objective was to identify cancer-specific transcripts that entirely or partially consist of LTR elements.
  • RNA-sequencing reads from 768 patient samples obtained from The Cancer Genome Atlas (TCGA) consortium to represent a wide variety of cancer types (24 gender-balanced samples from each of 32 cancer types (31 primary and 1 metastatic melanoma); Table S1), were used for genome-guided assembly.
  • TCGA Cancer Genome Atlas
  • HMMs hidden Markov models representing known Human repeat families (Dfam 2.0 library v150923) were used to annotate GRCh38 using RepeatMasker Open-3.0 (Smit, A., R. Hubley, and P. Green, http://www.repeatmasker.org, 1996-2010), configured with nhmmer (Wheeler et al., 2013, Bioinform., 29:2487-2489).
  • HMM-based scanning increases the accuracy of annotation in comparison with BLAST-based methods (Hubley et al., 2016, Nuc. Acid. Res., 44:81-89).
  • RepeatMasker annotates LTR and internal regions separately, thus tabular outputs were parsed to merge adjacent annotations for the same element.
  • This process yielded 181,967 transcripts that contained one or more, complete or partial LTR element.
  • Transcripts per million (TPM) were estimated for all transcripts using Salmon and expression within each cancer type was compared with expression across 811 healthy tissue samples (healthy tissue-matched controls for all cancer types, where available, from TCGA and, separately from, GTEx (The Genotype-Tissue Expression Consortium, 2015, Science, 348:648-60).
  • Transcripts were considered expressed in cancer if detected at more than 1 TPM in any sample and as cancer-specific if the following criteria were fulfilled: i, expressed in >6 of the 24 samples of each cancer type; ii, expressed at ⁇ 10 TPM in >90% of all healthy tissue samples; iii, expressed in the cancer type of interest >3x the median expression in any control tissue type; and iv, expressed in the cancer type of interest >3x the 90th percentile of the respective healthy tissue, where available.
  • the list of cancer-specific transcripts was then intersected with the list of transcripts containing complete or partial LTR elements to produce a list of 5,923 transcripts that fulfilled all criteria (referred to as CLTs for Cancer-specific LTR element- spanning Transcripts).
  • CLTs specifically expressed in melanoma to exclude potentially misassembled contigs and those corresponding to the assembly of cellular genes. Additional manual assessment was conducted to ensure that splicing patterns were supported by the original RNA-sequencing reads from melanoma. CLTs were additionally triaged such that those where the median expression in any GTEx normal tissue exceeded 1 TPM were discarded.
  • Mass spectrometry (MS)-based immunopeptidomics analysis is a powerful technology that allows for the direct identification of specific peptides associated with HLA molecules (pHLA) and presented on the cell surface.
  • the technique consists of affinity purification of the pHLA from biological samples such as cells or tissues by anti- HLA antibody capture.
  • the isolated HLA molecules and bound peptides are then separated from each other and the eluted peptides are analyzed by nano-ultra performance liquid chromatography coupled to mass spectrometry (nUPLC-MS) (Freudenmann et al., 2018, Immunology 154(3):331-345).
  • MS/MS mass spectrometry
  • MS/MS spectral interpretation and subsequent peptide sequence identification relies on the match between experimental data and theoretical spectra created from peptide sequences found in a reference database. Although it is possible to search MS data by using pre-defined lists corresponding to all open reading frames (ORFs) derived from the known transcriptome or even the entire genome (Nesvizhskii et al., 2014, Nat. Methods 11 : 1114-1125), interrogating these very large sequence databases leads to very high false discovery rates (FDR) that limit the identification of presented peptides.
  • ORFs open reading frames
  • the inventors procured frozen tumor tissue from 6 patients diagnosed with melanoma. Samples between 0.05-1 g were homogenized, the lysate was centrifugate at high speed and the cleared lysate was mixed with protein A (ProA) beads covalently linked to an anti-human HLA class I monoclonal antibody (W6/32). The mixture was incubated overnight at 4°C to improve HLA Class I molecule binding to antibody (Ternette et al., 2018 Proteomics 18, 1700465).
  • ProA protein A
  • the HLA Class l-bound peptides were eluted from the antibody by using 10% acetic acid, and the peptides were then separated from other high molecular mass components using reversed-phase column chromatography (Ternette et al., 2018).
  • the purified, eluted peptides were subjected to nUPLC-MS, and specific peptides of defined charge-to-mass ratio (m/z) were selected within the mass spectrometer, isolated, fragmented, and subjected to a second round of mass spectrometry (MS/MS) to reveal the m/z of the resulting fragment ions (Ternette et al. , 2018), producing an MS/MS dataset corresponding to the immunopeptidome for each of these tumor samples.
  • MS/MS mass spectrometry
  • HLA Class I molecules The detection of these peptides associated with the HLA Class I molecules confirms, that the 8 ORFs from which they were derived, were first translated in melanoma tissues, processed through the HLA Class I pathway and finally presented to the immune system in a complex with HLA Class I molecules.
  • Table 1 shows the properties of the peptides found in the CLT antigens.
  • Figures 1-37 show representative MS/MS spectra from each of the peptides shown in Table 1.
  • the figures show fragment spectra for indicated peptide sequences as detected in individual patient SKCM tumors by nUPLC-MS 2 (images extracted by PEAKSTM software from the inventors’ internal dataset or from Bassani-Sternberg et aL dataset stored in PRIDE).
  • HLA types were not reported by Bassani-Sternberg et al. (2016, Nature Commun., 7: 13404) for every patient associated with the peptides we discovered, but where this was reported, we found matches between the known and predicted HLA types.
  • the upper spectrum corresponds to the tumor sample (from the PRIDE database (Bassani-Sternberg et al., 2016, Nature Commun., 7: 13404; database link: https://www.ebi.ac.uk/pride/archive/projects/PXD004894 or in the inventors’ database) and the lower spectrum corresponds to the synthetically produced peptide of the same sequence. Selected m/z values of detected ion fragments are shown above/below each fragment peak in these MS/MS spectra.
  • the inventors processed 37 normal tissue samples (10 normal skin, 9 normal lung and 18 normal breast tissue) and prepared for immunopeptidomic analysis. The inventors interrogated the spectra of the HLA-Class I dataset from these normal tissue samples, searching for all possible peptide sequences derived from the polypeptide sequences of CLT antigens 1, 2, 3, 4,
  • Table 1 List of peptides identified by immunopeptidomic analyses of melanoma tumor samples, along with CLT antigen name and cross reference to SEQ ID NOs.
  • FEST Functional expansion of specific T-cells
  • MANA mutation- associated neoantigen
  • Application of FEST technology to CLT antigens discovered by using the methods elucidated in Example 1 & 2 (Tables 1-3, Figures 1- 53) can be used to identify therapeutically relevant T-cell responses to CLT antigens in cancer patients.
  • FEST technologies derive their specificity by activating/expanding the cognate T-cells in ex vivo cultures that include antigen- presenting cells and suitable antigenic peptides.
  • the technique differs from other immunological assays in that it utilizes next-generation sequencing of the T-cell receptor (TCR) DNA sequences present in these amplified cultures (specifically: TCRseq targeting the TCR- /b CDR3 region) to detect the specific TCRs that are expanded in the cells cultured with individual peptides from a panel of target peptides derived from an antigen (or antigens).
  • TCR T-cell receptor
  • TCRseq to tumor tissues in the same patient can also be used to demonstrate if TCRs/T-cells detected in the ex vivo, peptide- stimulated cultures are also present within the tumor-infiltrating lymphocytes found in cancer tissues in situ.
  • MANAFEST has proven to be a powerful technology for identifying MANA epitopes that are recognized by patient T-cells, permitting identification of functionally relevant MANA peptides among the multitude of mutant peptides found by whole-exome sequencing of normal and tumor tissues from cancer patients (Le et al., Science 2017; Forde et al., NEJM 2018; Danilova et al., Cancer Immunol. Res. 2018; Smith et al., J Immunother Cancer 2019).
  • Step 1 Peptides predicted to contain epitopes that efficiently bind selected HLA Class I alleles were identified in CLT Antigens.
  • Step 2 PBMCs from suitable melanoma patients were matched by HLA Class I type to the peptide library selected in step 1.
  • Step 3 PBMCs from these patients were separated into T-cell and non T-cell fractions.
  • Non T-cells were added back to the patient’s T-cells, and then divided into 20-50 wells (containing 250,000 T-cells per culture) and propagated with various T-cell growth factors and individual CLT Antigen- derived synthetic peptides (selected in step 1/2) for 10 days.
  • Step 4 TCRseq (sequencing of the TCR- /b CDR3 sequences) was performed on all wells, and TCR- /b CDR3 sequences that were amplified in the presence of individual CLT Antigen-derived peptides (but not amplified in the presence of control peptides or in the absence of peptide stimulation) were identified.
  • TCRseq may also be performed on tumor samples to determine whether the T-cells bearing the CLT-Antigen amplified TCRs homed to patient tumors, providing additional evidence that T-cells bearing these TCRs recognize CLT Antigen-derived peptides within a patient’s tumor.
  • HERVFEST assays were performed with peptides derived from CLT Antigens 1- 4 (SEQ ID NOs 1-4).
  • the panel of peptides (see step 1 above) used for these studies was based on NetMHC predictions of CLT Antigen-derived peptides that were predicted to strongly bind the 8 HLA Class I types commonly found in patient tumor samples available for our analyses.
  • CLT Antigen-derived peptides that amplified one or more TCRs in these HERVFEST assays are provided in Table 4.
  • Table 4 also indicates the HLA Class I type(s) of the CLT antigen peptides that were tested with each patient’s PBMC-derived cultures.
  • Figure 54 panel A shows published data demonstrating TCR amplification with NSCLC patient-specific MANA peptides (Forde et al., NEJM 2018). The vertical axis shows the prevalence of each indicated TCR nb CDR3 AA Sequence for wells of cells cultivated in the presence of the MANA or control peptides listed on the horizontal axis. The amplification in the well containing MANA7 indicates the patient’s T-cell repertoire include T-cells that are reactive to this peptide.
  • Panels B and C of Figure 54 show representative TCR amplification data from PBMCs from 2 melanoma patients that were incubated in the presence of the indicated CLT Antigen peptides and control peptides.
  • Panel B shows the frequency of TCRs detected in the LMSSFSTLASL-stimulated well of PBMCs from melanoma patient 222B in all wells stimulated with the panel 15 Class I HLA-A * 02 peptides from CLT Antigens 1 , 2 & 4.
  • LMSSFSTLASL SEQ ID NO. 23 is an HLA-A * 02 binding peptide derived from CLT Antigen 2.
  • Panel C shows the frequency of TCRs detected in the MVACRIKTFR-stimulated well of PBMCs from melanoma patient 224B in all wells stimulated with the panel of 15 Class I HLA-A * 02 peptides from CLT Antigens 1 , 2 & 4 and 24 Class I HLA-A * 03 peptides from CLT Antigens 1 , 2, 3, & 4.
  • MVACRIKTFR (SEQ ID NO. 26) is an HLA-A * 03 binding peptide derived from CLT Antigen 2.
  • control peptides/conditions used in these experiments were as follows:
  • CEF mixture of CMV, EBV, and influenza peptides
  • SL9, TV9 and QK1 HIV-1 control peptides
  • no peptide cultivation in absence of peptide
  • Baseline T-cells before culture.
  • FIG 55 shows a summary of all CLT Antigen peptides for CLT Antigens 1 -4 which amplified one or more TCRs in studies completed with these patients.
  • Each panel displays the amino acid sequences of CLT Antigens 1-4 overlaid with peptides detected by immunopeptidomic analyses (denoted by da_shed_underlmed or bold text; see Example 2). Below these sequences, the HERVFEST-detected peptides (see Figure 54) are displayed with the numeric identifier of the melanoma patient in which they were detected (Table 5) and the targeted HLA Class I type.
  • Table 4 CLT Antigen-derived peptides that amplified one or more TCRs in HERVFEST assays
  • Table 5 Characteristics of the melanoma patient PBMCs used in HERVFEST assays
  • An ELISPOT assay may be used to show that CLT antigen-specific CD8 T-cells are present in the normal T-cell repertoire of healthy individuals, and thus have not been deleted by central tolerance due to the expression of cancer-specific CLT antigens in naive and thymic tissues in these patients.
  • This type of ELISPOT assay comprises multiple steps. Step 1 : CD8 T-cells and CD14 monocytes can be isolated from the peripheral blood of normal blood donors, these cells are HLA Class l-typed to match the specific CLT antigens being tested. CD8 T-cells can be further sub-divided into naive and memory sub-types using magnetically labelled antibodies to the memory marker CD45RO.
  • Step 2 CD14 monocytes are pulsed with individual or pooled CLT antigen peptides for three hours prior to being co-cultured with CD8 T-cells for 14 days.
  • Step 3 Expanded CD8 T-cells are isolated from these cultures and re-stimulated overnight with fresh monocytes pulsed with peptides.
  • These peptides may include; individual CLT antigen peptides, irrelevant control peptides or peptides known to elicit a robust response to infectious (e.g., CMV, EBV, Flu, HCV) or self (e.g. MART-1) antigens.
  • Re stimulation is performed on anti-lnterferon gamma (IFNy) antibody-coated plates.
  • IFNy anti-lnterferon gamma
  • the antibody captures any IFNy secreted by the peptide-stimulated T-cells. Following overnight activation, the cells are washed from the plate and IFNy captured on the plate is detected with further anti- IFNy antibodies and standard colorimetric dyes. Where IFNy -producing cells were originally on the plate, dark spots are left behind. Data derived from such assays includes spot count, median spot size and median spot intensity. These are measures of frequency of T-cells producing IFNy and amount of IFNy per cell. Additionally, a measure of the magnitude of the response to the CLT antigen can be derived from the stimulation index (SI) which is the specific response, measured in spot count or median spot size, divided by the background response to monocytes with no specific peptide.
  • SI stimulation index
  • a metric of stimulation strength is derived by multiplying the stimulation index for spot number by the stimulation index for spot intensity.
  • comparisons of the responses to CLT antigens and control antigens can be used to demonstrate that naive subjects contain a robust repertoire of CLT antigen-reactive T-cells that can be expanded by vaccination with CLT antigen- based immunogenic formulations.
  • Table 6 provides a list of CLT Antigen-derived peptides that induced significant CD8 T-cell responses from HLA-matched normal blood donors. The results are shown in Figures 56-63. Horizontal bars represent the mean of the data. M+t indicates the no peptide, negative control (monocytes and T cells).
  • CEF indicates the positive control (a mixture of 23 CMV, EBV and influenza peptides).
  • Statistical significance was measured with Kruskall Wallis test One-way Anova with correction for repeated measures with Dunns correction.
  • Figure 56 shows significant CD8 T-cell responses from a normal blood donor to HLA-A * 02:01 -restricted peptides from CLT Antigen 1 (CLT001 in the figure).
  • the example shown in Figure 57 demonstrates CD8 responses from a normal donor to a peptide derived from CLT Antigen 2 (CLT002 in the figure) also restricted by HLA-A * 02:01.
  • Figure 58 shows significant CD8 T-cell responses from a normal blood donor to an HLA-A * 02:01- restricted peptide from CLT Antigen 4 (CLT004 in the Figure).
  • Figure 59 shows significant CD8 T-cell responses from a normal blood donor to HLA-A * 03:01 -restricted peptide from CLT Antigen 5 (CLT005 in the Figure).
  • Figure 60 shows significant CD8 T- cell responses from a normal blood donor to an HLA-B * 07:02-restricted peptide from CLT Antigen 6 (CLT006 in the Figure).
  • Figure 61 shows significant CD8 T-cell responses from a normal blood donor to an HLA-A * 03: 01 -restricted peptide from CLT Antigen 7 (CLT007 in the Figure).
  • Figure 62 shows significant CD8 T-cell responses from a normal blood donor to an HLA-A * 02:01 -restricted peptide from CLT Antigen 8 (CLT008 in the Figure).
  • Figure 63 shows a lack of response to HLA-B * 0702 restricted peptides from CLT Antigens 1 and 4 (CLT001 and CLT004 in the figure) in memory CD45RO-positive CD8 T-cells (panels A and C).
  • Naive CD45RO-negative CD8 T-cells from the same donor respond significantly to peptides from both CLT001 and CLT004 ( Figure 63, panels B and D).
  • Example 5 Staining reactive T-cells with CLT antigen peptide pentamers and demonstration of their killing of peptide-pulsed or CLT-expressinq target cells.
  • the presence and activity of circulating CD8 T-cells specific for CLT antigens in healthy donors and melanoma patients can be measured by using HLA Class l/peptide- pentamer (“pentamer”) staining and/or in vitro killing assays.
  • pentamer HLA Class l/peptide- pentamer
  • CD8 T-cells isolated from healthy donor or patient blood are expanded using various cultivation methods, for example anti-CD3 and anti-CD28 coated microscopic beads plus lnterleukin-2. Expanded cells can then be stained for specific CLT antigen-reactivity of their T-cell receptors using CLT peptide pentamers, which consist of pentamers of HLA Class I molecules bound to the relevant CLT Antigen peptide in the peptide-binding groove of the HLA molecule. Binding is measured by detection with phycoerythrin or allophycocyanin-conjugated antibody fragments specific for the coiled-coil multimerisation domain of the pentamer structure.
  • CLT peptide pentamers consist of pentamers of HLA Class I molecules bound to the relevant CLT Antigen peptide in the peptide-binding groove of the HLA molecule. Binding is measured by detection with phycoerythrin or allophycocyanin-conjugated antibody fragments specific for
  • Pentamer stained cells may also be sorted and purified using a fluorescence activated cell sorter (FACS). Sorted cells may then be further tested for their ability to kill target cells in in vitro killing assays. These assays comprise a CD8 T-cell population, and a fluorescently labelled target cell population. In this case, the CD8 population is either CLT antigen-specific or CD8 T-cells pentamer-sorted and specific for a positive- control antigen known to induce a strong killing response such as Mart-1.
  • FACS fluorescence activated cell sorter
  • the target cells for these studies may include peptide-pulsed T2 cells which express HLA-A * 02, peptide-pulsed C1 R cells transfected with HLA-A * 02,03, B * 07, melanoma cells lines previously shown to express the CLTs/CLT antigens, patient tumor cells or cell lines such as CaSki transfected with the CLT open reading frames.
  • Peptides used to pulse the T2 or C1 R cells include CLT antigen peptides or positive control peptides.
  • Target cell death is indicated by take up of 7AAD. In this way, as target cells are killed, by apoptosis mediated by CD8 T-cells, they gain red fluorescence.
  • CLT antigen-specific CD8 T-cells can be used to enumerate the cytotoxic activity of CLT-antigen-specific T-cells in ex vivo cultures of melanoma patient or healthy donor T-cells.
  • Figure 64 shows HLA pentamer staining of healthy donor CD8 T-cells with a peptide-derived from CLT Antigen 4, peptide APPLGSEPL (top panel).
  • the bottom panel shows antigen-specific killing of peptide pulsed C1 R.B7 target cells by these CD8 T cells.
  • the negative controls for the in vitro killing assay include an irrelevant peptide derived from human cytomegalovirus (HCMV) and no peptide.
  • Figure 65 shows HLA pentamer staining of healthy donor CD8 T-cells with peptides-derived from CLT Antigen 8, peptide SLYGHIHNEA following fluorescence activated cell sorting of pentamer positive cells and 14 days of expansion using anti-CD3 and anti-CD28 coated beads plus IL-2.
  • the right-hand side panel shows very weak antigen-specific killing of peptide- pulsed A2 target cells by these CD8 T cells but effective antigen specific killing of CaSki cells transfected with the open reading frame of CLT Antigen 8.
  • the negative controls for this in vitro killing assay include an irrelevant T2 cells with no peptide and untransfected CaSki cells.
  • qRT-PCR Quantiative real-time polymerase chain reaction
  • COLO 829 ATCC reference CRL-1974
  • MeWo ATCC reference HTB- 65
  • SH-4 ATCC reference CRL-7724
  • HepG2 hepatocellular carcinoma, ATCC reference HB-8065
  • Jurkat T-cell leukemia
  • MCF7 adenocarcinoma, ATCC reference HTB-22.
  • RNA was extracted from each sample and reverse transcribed into cDNA following standard procedures.
  • RQ 2[Ct(REFERENCE)-Ct(TARGET)].
  • Panel A shows results from a qRT-PCR assay with two primer sets (1+2 and 3+4) targeting different regions of the CLT encoding CLT Antigen 1 (SEQ ID 56) on RNA extracted from three melanoma cell lines and four non-melanoma cell lines.
  • Panel B shows results from qRT- PCR assay with two primer sets (5+6 and 7+8) targeting different regions of the CLT encoding CLT Antigen 2 (SEQ ID 57) on RNA extracted from three melanoma cell lines and four non-melanoma cell lines.
  • Panel C shows results from qRT-PCR assay with two primer sets (9+10 AND 11 + 12) targeting different regions of the CLT encoding CLT Antigens 3/4 (SEQ ID 58) on RNA extracted from three melanoma cell lines and four non-melanoma cell lines.
  • Panel D shows results from qRT-PCR assay with one primer set (88+89) targeting the CLT encoding CLT Antigen 5 (SEQ ID 59) on RNA extracted from three melanoma cell lines and four non-melanoma cell lines.
  • Panel E shows results from qRT-PCR assay with two primer sets (76+77 AND 78+79) targeting different regions of the CLT encoding CLT Antigen 6 (SEQ ID 60) on RNA extracted from 12 melanoma tissue samples and one non-melanoma cell line.
  • Panel F shows results from qRT-PCR assay with two primer sets (44+45 AND 46+47) targeting different regions of the CLT encoding CLT Antigen 7 (SEQ ID 61) on RNA extracted from 12 melanoma tissue samples and one non-melanoma cell line.
  • Panel G shows results from qRT-PCR assay with two primer sets (80-81 AND 82-83) targeting different regions of the CLT encoding CLT Antigen 8 (SEQ ID 62) on RNA extracted from 12 melanoma tissue samples and one non-melanoma cell line. These results confirmed the specific expression of CLTs in RNA extracted from melanoma cell lines or tissue samples, compared to non-melanoma cell lines. Each CLT was detected in two or more cell lines or tissue samples analysed, with little to no expression detected in non melanoma control cell lines. b) RNAScope validation of CLT expression in melanoma cells in situ
  • ISH In situ hybridisation
  • RNAScope probes were designed against the CLTs and assayed on sections of 12 formalin-fixed, paraffin-embedded cutaneous melanoma tumor cores. Scoring of the expression signal was performed on representative images from each core as follows:
  • T cells from a healthy donor or patient with a given cancer can be stimulated outside of the body (ex vivo) to activate T cell clones that recognise specified CLT Antigens, and subseguently rapidly expanded to generate large numbers of CLT- reactive T cells, where resultant anti-tumor activity might be anticipated.
  • a number of steps are involved to employ this method.
  • T cells from the donor must be isolated but also autologous antigen presenting cells (APCs) may be reguired.
  • the source of the immune cells can be obtained from peripheral blood through a blood draw or apheresis.
  • T cells can be isolated from the tumor infiltrating lymphocytes (TILs) obtained from fresh biopsy or resection of a patient’s tumor.
  • APCs may be CD14- positive monocytes or alternatively dendritic cells (DCs) which would be derived from the monocyte fraction of the apheresis product.
  • DCs can be generated by methods such as positive isolation via CD14 capture (for example, anti-CD14 antibodies conjugated to magnetic beads, where CD14-positive cells are labelled with the beads and captured on a magnetic column) or isolation via their adhesive properties, for example, adherence to tissue culture plastics by incubation of peripheral blood mononuclear cells (PBMCs) with cell culture dishes for a period of 4-48 hr to allow adherence of monocytes.
  • PBMCs peripheral blood mononuclear cells
  • DCs can be generated from the CD14-positive or adherent immune cell fractions by well-described methods utilising cytokines such as, but not limited to: GM-CSF, IL-4, TNFa, I L-1 b, IL-6, Prostaglandin E2.
  • T cells for selection and/or stimulation could be the monocyte-depleted fraction of PBMC (in the case of apheresis origin of T cells), pan-T cell isolation using isolation technigues based on the expression of markers such as CD3, or presence or absence of markers of specific T cell subsets, for example but not limited to, CD4, CD8, CD45RO, CD45RA, CCR7, CD62L, CD27 etc.
  • Methods can be employed to select T cells prior to stimulation with APCs. Such methods would include peptide-HLA (pHLA) multimer approaches such as tetramer, pentamer, dextramer or similar, to label T cells that express TCRs that recognise the given pHLA. Such pHLAs would be defined based on mass spectrometry (MS) experiments as described in Example 2, and/or peptides predicted to bind specific HLA allotypes based on prediction algorithms.
  • the multimer could possess a tag, such as phycoerythrin (PE) which could be isolated using fluorescent activated sorting or via an anti-PE antibody conjugated to magnetic beads. Alternatively, an antibody to the tag could be directly conjugated to magnetic beads.
  • PE phycoerythrin
  • an antibody to the tag could be directly conjugated to magnetic beads.
  • multimers could be generated with the same or different tags, or different multimers could be conjugated to magnetic beads.
  • the patient’s T cells can be exposed to APCs that are presenting peptides derived from CLT Antigens on the surface in the context of Class I and Class II HLA complexes. This could involve the introduction of multiple CLT Antigens (anticipated to be expressed by a patient’s tumor) into the APCs, such as autologous DCs generated from the patient’s apheresis product.
  • CLT Antigens could be through concatenated polypeptide delivery of multiple CLT Antigens, such as viral vector delivery, or as individual pooled CLT Antigens, such as mRNA-based methods of delivery.
  • Methods of stabilized, mature, mRNA delivery to the APC could include classical reagents such as polyethylenimine (PEI) or calcium phosphate for nucleic acid delivery into cells.
  • PKI polyethylenimine
  • CaPO calcium phosphate
  • efficient transfection can be achieved using lipid-based reagents for transfection into APCs.
  • transfection reactions use synthetic, in vitro transcription reaction (IVT)-derived mRNAs formulated in lipid complexes such as such as lipid nanoparticles (LNP) or lipid- based lipoplexes (formed by simple mixing of mRNAs with lipid reagents).
  • IVTT in vitro transcription reaction
  • recombinant DNA constructs containing the well-described promoter element for phage T7 DNA-dependent, RNA polymerase, followed by a cDNA encoding high-stability mRNA 5’UTR , a cDNA encoding a codon-optimized open reading frame (ORF) for a CLT Antigen, a cDNA encoding a high stability mRNA 3’UTR, a poly-A sequence of >20 nucleotides, and a unique restriction endonuclease site designed to release a functional poly-A tail, can be used as a template for in vitro transcription (IVT) of suitable CLT Antigen-encoding mRNAs.
  • IVTT in vitro transcription
  • APCs monoocytes or DCs
  • a lipid-based transfection reagent for example, LipotectamineTM MessengerMAXTM or FuGENE ® HD or similar
  • serum-free medium such as Opti-MEMTM
  • Incubation times of the mRNA with the lipid reagent would be short (5 - 10 minutes) and at room temperature.
  • the resultant mRNA-lipid complex would be added to APCs and incubated at 37°C/5% CO2 for 16 - 72 hours, depending on optimal timepoint for presentation of translated peptides from the CLT-encoding mRNA molecules.
  • CLT Antigens Delivery of CLT Antigens to APCs with such methods described should result in the expression of CLT Antigen polypeptides in the cytoplasm of the APC, which in turn will result in cellular processing of peptide fragments from the polypeptides for presentation on Class I and Class II HLA molecules.
  • T cells either selected as described in (b) or unselected T cells from apheresis or TIL sources
  • APCs expressing CLT Antigen-derived peptide-HLA complexes at the cell surface
  • those T cells possessing TCRs that have specificity for a given pHLA will be stimulated by engaging with the pHLA complex in addition to co-stimulatory molecules and signals from the APC.
  • autologous CD3+ isolated T cells would be co-cultured with the APCs at a ratio of excess T cell to APC, for example 10 T cells per 1 APC (10:1), in cytokine-containing medium (such as IL-6 and IL-12 or other cytokines supplemented in the basal media used).
  • cytokine-containing medium such as IL-6 and IL-12 or other cytokines supplemented in the basal media used.
  • the cells would be co-cultured for as little as overnight or up to 1 week to stimulate T cells, but typically 18 - 48 hours after which the T cells could be subjected to enrichment prior to expansion, if required.
  • T cells that have been stimulated by APCs that are expressing CLT Antigens can be further enriched prior to an expansion step if required.
  • Markers of T cell activation such as CD137, CD107a, CD69, 0X40 or other surface marker associated with an activated state
  • T cell functional responses for example, T cells secreting cytokines such as TNFa or IFNy
  • Such enrichment methods could include cell sorting by FACS or bead-based methods of capture, for example, using antibodies to CD137 or similar that are conjugated to magnetic beads.
  • Multiple enrichment strategies could be employed, either in parallel (for example, cells double positive for CD137 and CD69) or sequentially (for example, selecting cells positive for CD137 and subsequently selecting CD137+ cells positive for CD69). Such a positive selection should remove those T cells that are likely not stimulated by the CLT Antigen-expressing APCs.
  • T cells can be rapidly expanded to achieve numbers > 10 8 total cells, using methods based on those described in the literature, with potential modifications for optimisation (for example, Jin et al, J Immunother, 2012). Such methods utilise cytokines such as IL-2 and stimulatory antibodies such as anti-CD3 as well as potential irradiated autologous cells from PBMC (termed “feeder” cells). Alternatively stimulatory antibodies to CD3 and CD28 can be used to avoid the use of feeder cells.
  • the process can be further automated or enhanced using specialized gas-permeable flasks (for example G-Rex flasks) or closed expansion system (for example WAVE bioreactor).
  • gas-permeable flasks for example G-Rex flasks
  • closed expansion system for example WAVE bioreactor
  • cytokine release assays could be performed to test for T cell activation from co-cultivation of the ex-vivo stimulated T cells with the target cells (for example, IFNy ELISpot assays).
  • T-cell mediated killing of target cells could be measured with cytotoxicity assays such as FACS-based methods to assess cell death of target cells (e.g. by 7-AAD measurement) co-cultured with the T cells, or other methods such as those that monitor markers of apoptosis of target cells or measure impedance (electrical measure of cell viability) of adherent target cells plated onto specialized surfaces.
  • a variety of methods could be used to create target cells for such assays. For example appropriate human cells with HLAs that match APCs used in the ex vivo stimulation could be pulsed with peptides derived from CLT Antigens that are known to be presented on Class I HLA molecules (as deconvoluted from mass spectrometry experiments - see Example 2). Further, tumor cell lines matching the HLA type of the APCs could also be assessed. Finally, primary tumor cells (in particular tumor cells from the same patient donor from which the starting T cells and APCs used for the process were derived) could be assessed.
  • these methods can be used to demonstrate that human T cells are able to be “immunized” with CLT Antigens ex vivo, producing immunologically reactive/cytolytic T cells, confirming the likelihood that vaccination of cancer patients with one or more CLT Antigen would have therapeutic value in controlling cancer.
  • Simple short linkers are used in this algorithm, since these would be superior for achieving the above-mentioned goals.
  • multiple Gly-based linkers were selected, some of which also contained Lys residues to eliminate identity to normal human proteins and facilitate processing at the ends of the component CLT antigens (GGG, GGGG, KGG, GGKGG, GGGKGG, GGK; SEQ ID NO. 71-75, 84 respectively).
  • CLT Antigen Fusion Protein 1 and 2 CLT Antigen Fusion Protein 1 and 2
  • CLT Antigen Fusion Protein 3 and 4 CLT Antigen Fusion Protein 3 and 4
  • fusion protein sequences were designed so that no 9-mer peptides containing any portion of a linker peptide could be identical to the human proteome, as determined by a blastp search performed by Standalone Blast ver2.9.0 (AltSchul et al,
  • fusion protein sequences were designed so that no 9-mer peptide containing any portion of a linker peptide could be a strong predicted binder (rank ⁇ 0.5) for an MHC class I supertype (see below) by NetMHCpan 4.0. (Andreatta & Nielsen, Bioinformatics 2016).
  • fusion protein sequences were designed so that CLT Antigens for which HLA-bound peptides (see Example 2) were found precisely aligned with their C-termini were prioritized for positioning at the C-terminus of the fusion protein designs to help ensure that the C-terminal anchor residues (normally released by a stop codon when expressed in tumor tissues) would be similarly produced in the context of a fusion protein.
  • linker sequences were further optimized based on proteasomal cleavage site predictions made with the NetChop 3.1 Server (Nielsen et al., Immunogenetics 2005) to select linker sequences expected to produce the C-termini found in the authentic (stop-codon- generated) CTA antigen polypeptides.
  • fusion protein sequences were designed so that all 9-mer peptide sequences containing any portion of a linker peptide that were predicted to be weak binders (rank score ⁇ 2.0) for a selected MHC class I supertype (see above) were altered to eliminate or reduce binding by adjusting linkers or, in some cases, by removing the N-terminal methionines from component CLT antigens.
  • the pairs of the fusion protein designs used for this purpose were designed so that there were not allowed to directly repeat CLT antigen junctions to reduce epitope repetition.
  • pairs of fusion proteins were refined to remove predicted weak binding epitopes repeated between prime and boost constructs (implemented for CLT Antigen Fusion Protein 3 and 4). This was achieved by either excluding N-terminal methionine residues (see rationale described above for N-terminal methionine removal) or by the use of alternative linkers (see above).
  • CLT Antigen Fusion Protein 1 SEQ ID N0.76
  • CLT Antigen Fusion Protein 2 SEQ ID NO.77
  • CLT Antigen Fusion Protein 3 SEQ ID N0.78
  • CLT Antigen Fusion Protein 4 SEQ ID N0.79
  • Example 9 Fusion protein antigenicity CLT Antigen Fusion Proteins designed as described in Example 8 are expected to be translated, proteolytically processed in the cytosol, and presented in association with HLA class I molecules on the cell surface.
  • cDNA constructs encoding the fusion protein cassettes were transduced into human cells, and the HLA class I molecules were immunoprecipitated and subjected to MS analyses described in Example 2 for the discovery of the CLT antigens. This is done in order to demonstrate that the CLT Antigen fusion protein cassettes maintained similar antigen presentation properties of the component CLT Antigens previously identified in tumors tissues (shown Example 2).
  • MS-based immunopeptidomics analysis is a powerful technology that allows for the direct detection of specific peptides associated with HLA class I molecules.
  • the ability to detect individual peptides is influenced by their biophysical properties, it is restricted by the proteolytical activity present in the cells and HLA alleles expressed in the cell lines used for these studies. Thus, the method will not likely discover all previously identified HLA-bound peptides in a tissue or cell sample. Nevertheless, the repertoire of HLA class l-bound peptides detected will confirm the value of the fusion protein designs tested in delivering peptide epitopes from CLT Antigens.
  • cultured human cells are transduced with plasmid DNAs encoding the CLT Antigen fusion protein cassettes under control of suitable poll I promoter and 5’ and 3’ UTRs. After expansion, the cultured cells encoding the CLT Antigen fusion protein cassettes are lysed and the HLA class I— peptide complexes are affinity purified by anti-HLA Class I antibody capture. The isolated HLA molecules and bound peptides are then separated from each other and the eluted peptides are analyzed by nUPLC-MS/MS.
  • the MS/MS spectra acquired from these HLA Class I pull downs are then interrogated by using the PEAKSTM software (v8.5 and vX, Bioinformatics Solutions Inc).
  • the software evaluates side-by-side all theoretical spectra of polypeptides contained in the human proteome with the polypeptide of the relevant fusion protein.
  • the repertoire of analyzed sequences contains sequences of the relevant CLT Antigen fusion protein construct AND the human proteome since the great majority of Class I HLA-bound peptides found in cells are derived from constitutively expressed proteins.
  • Example 10 Killing of Fusion protein expressing cell lines.
  • the immunogenicity of antigens derived from cells expressing CLT Antigen Fusion Protein open reading frames can be demonstrated using transfected cell lines combined with the CLT-peptide-reactive T cells described in Example 5. Killing of CLT Antigen Fusion Protein -transfected cell lines by CLT Antigen-specific CD8 T cells is used to demonstrate the existence of therapeutically relevant T-cell responses to the concatenated combination of CLT Antigens in cancer patients.
  • CaSki cells which have been transfected with constructs encoding the CLT Antigen Fusion Proteins 1 , 2, 3 or 4 (SEQ ID NO. 76-79) described in Examples 8 and 9 are used as targets for killing assays as described in Example 5.
  • CD8 T cell lines isolated from healthy donors and melanoma patients using HLA-pentamers derived from CLT Antigens 1 , 2, 3, 4, 5, 6, 7 and 8 are tested individually for killing ability of these CLT Antigen Fusion Protein transfected target cells.
  • the negative control cells are untransfected CaSki or CaSki cells transfected with an irrelevant construct.
  • mice can be administered a priming immunization with ChAdOxl vectors (a replication-deficient chimpanzee adenovirus vector) encoding a priming CLT antigen fusion protein sequences (CLT Antigen Fusion Protein 1 or CLT Antigen Fusion Protein 3; Figures 67 and 69; SEQ ID NO.76 and SEQ ID NO.
  • ChAdOxl vectors a replication-deficient chimpanzee adenovirus vector
  • CLT Antigen Fusion Protein 1 or CLT Antigen Fusion Protein 3 Figures 67 and 69; SEQ ID NO.76 and SEQ ID NO.
  • outbred mice (laboratory mice derived from a population with diverse Major Histocompatibility class I and II molecules) will be used, to more closely mimic the outbred-nature of humans.
  • the experiment will use priming (CLT Antigen Fusion Protein 1 , CLT Antigen Fusion Protein 3; Figures 67 and 69; SEQ ID N0.76 and SEQ ID NO. 78) and boosting vectors (CLT Antigen Fusion Protein 2, CLT Antigen Fusion Protein 4; Figures 68 and 70, SEQ ID NO. 77 and SEQ ID NO. 79) to mimic the use of fusion protein antigens in a prime/boost clinical application.
  • priming CLT Antigen Fusion Protein 1 , CLT Antigen Fusion Protein 3; Figures 67 and 69; SEQ ID N0.76 and SEQ ID NO. 78
  • boosting vectors CLT Antigen Fusion Protein 2, CLT Antigen Fusion Protein 4; Figures 68 and 70, SEQ ID NO. 77 and SEQ ID NO. 79
  • mice vaccinated as described above are humanely euthanized, and spleen cells prepared from these animals are loaded into wells of a multi-well dish derivatized with monoclonal antibodies to murine I FNy, in the presence (or absence) of overlapping peptides corresponding to sequences of one or more of the authentic CLT antigens (see schematic in Figure 71).
  • the immobilized IFNy secreted by the peptide-activated T cells is stained with a second anti-IFNy monoclonal antibody (selected to specifically detect IFNy in the presence of the immobilizing monoclonal antibody), permitting enumeration of the cells/spots which indicate the presence of vaccine-elicited murine T cells that recognize the CLT Antigen peptides loaded into the wells.
  • the spot numbers are normalized to the numbers of IFNy-stained spots found in wells of splenocytes from the same animal, that have been incubated in the absence of peptides.
  • SEQ ID NO. 1 Polypeptide sequence of CLT Antigen 1 MWNFFRRELTSNGFPENFSLDVPANTYNALKSRLCDPNADHTSCPSPCSLHAAGALP GTGRQRWRVELAHLADRKLSLRDVSRLRQGGERRSGIAVKVVRGGAGFAARLQGSV TLVQQGWFFP RLGGCQAWWR M GAWWCG ELLTCTS
  • SEQ ID NO. 2 Polypeptide sequence of CLT Antigen 2
  • SEQ ID NO. 3 Polypeptide sequence of CLT Antigen 3
  • SEQ ID NO. 4 Polypeptide sequence of CLT Antigen 4
  • SEQ ID NO. 5 Polypeptide sequence of CLT Antigen 5
  • SEQ ID NO. 6 Polypeptide sequence of CLT Antigen 6
  • SEQ ID NO. 7 Polypeptide sequence of CLT Antigen 7
  • SEQ ID NO. 8 Polypeptide sequence of CLT Antigen 8 MCALQGRGASPAGAGLFHWTMSPFLLGSLYGHIHNEAV
  • SEQ ID NO. 9 (peptide sequence derived from CLT Antigen 1)
  • SEQ ID NO. 10 (peptide sequence derived from CLT Antigen 1)
  • SEQ ID NO 12 (peptide sequence derived from CLT Antigen 1) ARLQGSVTL
  • SEQ ID NO.13 (peptide sequence derived from CLT Antigen 1) VPANTYNALK
  • SEQ ID NO.14 (peptide sequence derived from CLT Antigen 1) RLGGCQAWWR
  • SEQ ID NO.15 (peptide sequence derived from CLT Antigen 1) ANTYNALKSR
  • SEQ ID NO.16 (peptide sequence derived from CLT Antigen 1) RLQGSVTLV
  • SEQ ID NO.17 (peptide sequence derived from CLT Antigen 1) VPANTYNAL
  • SEQ ID NO. 18 (peptide sequence derived from CLT Antigen 2) ADSLILDF
  • SEQ ID NO. 19 (peptide sequence derived from CLT Antigen 2) SSFSTLASLDK
  • SEQ ID NO.20 (peptide sequence derived from CLT Antigen 2) LVTDMVACRI
  • SEQ ID N0.21 (peptide sequence derived from CLT Antigen 2) LILDFQPLQL
  • SEQ ID N0.23 (peptide sequence derived from CLT Antigen 2) LMSSFSTLASL
  • SEQ ID N0.24 (peptide sequence derived from CLT Antigen 2) LMSSFSTLA
  • SEQ ID N0.26 (peptide sequence derived from CLT Antigen 2) MVACRIKTFR
  • SEQ ID N0.28 (peptide sequence derived from CLT Antigen 2) SPADSLIL
  • SEQ ID NO. 30 (peptide sequence derived from CLT Antigen 2) QLMSSFSTL
  • SEQ ID NO. 31 (peptide sequence derived from CLT Antigen 3) NTPNIVSLR
  • SEQ ID NO. 32 (peptide sequence derived from CLT Antigen 3) RPLRIKGVF
  • SEQ ID NO.33 (peptide sequence derived from CLT Antigen 3) NTPNIVSLRA SEQ ID NO.34 (peptide sequence derived from CLT Antigen 3) VLLMRPLRIK
  • SEQ ID NO.35 (peptide sequence derived from CLT Antigen 3) MRPLRIKGVF
  • SEQ ID NO. 36 (peptide sequence derived from CLT Antigen 4) KTKGSLSVFR
  • SEQ ID NO. 37 (peptide sequence derived from CLT Antigen 4) AAFDRAVHF
  • SEQ ID NO. 38 (peptide sequence derived from CLT Antigen 4) AFDRAVHF
  • SEQ ID NO. 39 (peptide sequence derived from CLT Antigen 4) KTKGSLSVF
  • SEQ ID NO. 40 (peptide sequence derived from CLT Antigen 4) FLFLELWL
  • SEQ ID NO. 41 (peptide sequence derived from CLT Antigen 4) SVFRELHPA
  • SEQ ID NO. 42 (peptide sequence derived from CLT Antigen 4) SPPSSTAPL
  • SEQ ID NO. 43 (peptide sequence derived from CLT Antigen 4) FLELWLPEPML
  • SEQ ID NO. 45 (peptide sequence derived from CLT Antigen 5) LPRTPRPDLIL
  • SEQ ID NO. 46 (peptide sequence derived from CLT Antigen 5) TPRPDLILL
  • SEQ ID NO. 47 (peptide sequence derived from CLT Antigen 5) RPDLILLQL
  • SEQ ID NO. 48 (peptide sequence derived from CLT Antigen 6) ATIFPDPWLLK
  • SEQ ID NO. 49 (peptide sequence derived from CLT Antigen 6) FPFYKDTVL
  • SEQ ID NO. 50 (peptide sequence derived from CLT Antigen 6) FPFYKDTVLL
  • SEQ ID NO. 51 (peptide sequence derived from CLT Antigen 6) TIFPDPWLLK
  • SEQ ID NO. 52 (peptide sequence derived from CLT Antigen 7) IVLDAPVTK
  • SEQ ID NO. 53 (peptide sequence derived from CLT Antigen 8)
  • SEQ ID NO. 54 (peptide sequence derived from CLT Antigen 8)
  • SEQ ID NO. 55 (peptide sequence derived from CLT Antigen 8)
  • SEQ ID NO. 56 (cDNA sequence of CLT encoding CLT Antigen 1 )
  • SEQ ID NO. 57 (cDNA sequence of CLT encoding CLT Antigen 2)
  • SEQ ID NO. 59 (cDNA sequence of CLT encoding CLT Antigen 5)
  • SEQ ID NO. 60 (cDNA sequence of CLT encoding CLT Antigen 6)
  • SEQ ID NO. 61 (cDNA sequence of CLT encoding CLT Antigen 7)
  • SEQ ID NO 62 (cDNA sequence of CLT encoding CLT Antigen 8)
  • SEQ ID NO. 63 (cDNA sequence encoding CLT Antigen 1 ) AT GT GGAACTT CTT CAGGAGAATT AACAT CCAATGGATT CCCAGAAAACTTTT CC CT CGAT GT ACCAGCAAACACCT ACAAT GCCCT GAAAAGCCGCCT CT GCGACCCCA ATGCAGATCACACGTCCTGTCCCAGCCCCTGCAGCCTCCACGCGGCGGGTGCAC TGCCAGGCACGGGAAGGCAGCGCTGGCGAGTAGAACTGGCCCATCTCGCAGATA GGAAGCT GAGCCT CAGGGACGTTT CACGCCTT CGT CAAGGT GGT GAGAGGAGGA GCGGGATTGCCGTGAAGGTGGTGAGAGGAGGAGCGGGGTTTGCTGCCCGACTTC AGGGAT CT GT CACCCT CGT CCAGCAGGGTTGGTT CTT CCCGAGGCT GGGAGGAT G CCAAGCCT GGT GGAGGAT GGGGGCGGT GGT GTGGGGAGCTT CT GACTTC AGGG
  • SEQ ID NO. 64 (cDNA sequence encoding CLT Antigen 2)
  • SEQ ID NO. 65 (cDNA sequence encoding CLT Antigen 3)
  • SEQ ID NO. 66 (cDNA sequence encoding CLT Antigen 4)
  • SEQ ID NO. 67 (cDNA sequence encoding CLT Antigen 5)
  • SEQ ID NO. 68 (cDNA sequence encoding CLT Antigen 6) AT GT GGAACT CT CTGGAGGCCAGAAGT CCAAAAT CAAGAT GTT GCAGCACTGGT C CCT GGGAGGCT GT GCAGGAGAAT CT GCT CTGGGCGT CT CT CCTGGCT CCT GGT G GTGCCACAAT CTT CCCT GAT CCTT GGCTTTT GAAGGCAT CCCCCAGCT CT CT GCCT CAT CTT CACAGG ACTT CTCCCTGTGCCTGTCTGT GCCCAAATTT CCCCTT CT AT AAG GACACAGT CCT ACT GCAT CAGGGCCCACGCT AA
  • SEQ ID NO. 69 (cDNA sequence encoding CLT Antigen 7)
  • SEQ ID NO. 70 (cDNA sequence encoding CLT Antigen 8)
  • SEQ ID NO. 72 (linker sequence used in CLT Antigen Fusion Proteins 1 , 2 and 4) GGGG
  • SEQ ID NO. 75 (linker sequence used in CLT Antigen Fusion Proteins 1 , 2, 3 and 4) GGGKGG
  • SEQ ID NO. 76 polypeptide sequence of CLT Antigen Fusion Protein 1 MWNFFRRELTSNGFPENFSLDVPANTYNALKSRLCDPNADHTSCPSPCSLHAAGALP
  • SEQ ID NO. 77 polypeptide sequence of CLT Antigen Fusion Protein 2
  • SEQ ID NO. 78 polypeptide sequence of CLT Antigen Fusion Protein 3
  • SEQ ID NO. 79 polypeptide sequence of CLT Antigen Fusion Protein 4
  • SEQ ID NO. 80 (codon-optimised cDNA sequence encoding CLT Antigen Fusion Protein 1 )
  • SEQ ID NO. 81 (codon-optimised cDNA sequence encoding CLT Antigen Fusion Protein 2)
  • SEQ ID NO. 82 (codon-optimised cDNA sequence encoding CLT Antigen Fusion Protein 3)
  • SEQ ID NO. 83 (codon-optimised cDNA sequence encoding CLT Antigen Fusion Protein 4)
  • ATGT GG AACT CCCT AG AAGCGAG AT CCCCG AAAT CT AG AT GTT GTT CT ACT GG ACC GTGGGAAGCCGT ACAAGAAAAT CT ACT ATGGGCCT CT CT ACT AGCACCAGGT GGT GCAACAATTTTT CCAGAT CCGT GGCT ATT GAAGGCCT CGCCAT CTT CTTT ACCGCA T CT ACACAGAACAT CCCCGT GT GCTT GT CT AT GT CCGAACTTT CCGTT CT ACAAGG ACACCGT ACT ACT ACAT CAAGGACCAAGAGGTGGTGGTGGAAT GAAT ACT CCGAA CAT CGTATCTCT AAG AGCGCAT CAACCGG AAGTT GGAATT ATCCCGTCCGTCCT AC T AAT GAGACCGCT AAGAAT CAAGGGAGT GTT CCACCAT AT GTTT ACAAGGT GCT CCT CT AGT GT T GGAGGT GG
  • SEQ ID NO: 84 (linker sequence used in CLT Antigen Fusion Protein 3) GGK

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biophysics (AREA)
  • Toxicology (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Oncology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Dermatology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
EP21723936.7A 2020-04-17 2021-04-19 Fusion proteins of ctl antigens for treating melanoma Pending EP4136097A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP20170174 2020-04-17
PCT/US2021/028029 WO2021212123A1 (en) 2020-04-17 2021-04-19 Fusion proteins of ctl antigens for treating melanoma

Publications (1)

Publication Number Publication Date
EP4136097A1 true EP4136097A1 (en) 2023-02-22

Family

ID=70295067

Family Applications (1)

Application Number Title Priority Date Filing Date
EP21723936.7A Pending EP4136097A1 (en) 2020-04-17 2021-04-19 Fusion proteins of ctl antigens for treating melanoma

Country Status (6)

Country Link
US (1) US20230167163A1 (enExample)
EP (1) EP4136097A1 (enExample)
JP (1) JP2023522198A (enExample)
CN (1) CN116057067A (enExample)
CA (1) CA3179694A1 (enExample)
WO (1) WO2021212123A1 (enExample)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2020309202A1 (en) * 2019-07-05 2021-12-09 Enara Bio Limited Novel cancer antigens and methods
JP2023522193A (ja) * 2020-04-17 2023-05-29 ザ フランシス クリック インスティチュート リミティッド 抗原プール
WO2025202937A1 (en) 2024-03-26 2025-10-02 BioNTech SE Cancer vaccines

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CZ298364B6 (cs) * 1998-02-05 2007-09-05 Smithkline Beecham Biologicals S. A. Deriváty antigenu asociovaných s nádory z MAGE rodiny a sekvence nukleových kyselin kodující tyto deriváty, jejich použití pro prípravu fúzních proteinu a prostredku pro vakcinaci
HUP0203035A3 (en) * 1998-07-14 2007-12-28 Corixa Corp Compositions and methods for therapy and diagnosis of prostate cancer
US6770456B1 (en) 1998-07-29 2004-08-03 Ludwig Institute For Cancer Research Endogenous retrovirus tumor associated nucleic acids and antigens
US20040142325A1 (en) * 2001-09-14 2004-07-22 Liat Mintz Methods and systems for annotating biomolecular sequences
EP1586330A1 (en) 2004-04-16 2005-10-19 Georg-August-Universität Göttingen Vaccination against malignant melanoma
DK1871391T3 (da) 2005-03-30 2012-04-16 Viroxis Endogen retrovirus og proteiner, der kodes af env som target for cancerbehandling
AT502292B1 (de) * 2005-05-11 2010-04-15 Avir Green Hills Biotechnology Melanomdiagnose
US8921050B2 (en) 2006-03-17 2014-12-30 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Methods of diagnosing renal cell carcinoma
US20080019979A1 (en) 2006-05-22 2008-01-24 Feng Wang-Johanning HERV-K Antigens, Antibodies, and Methods
CN101638440B (zh) * 2008-07-29 2011-10-26 中国人民解放军军事医学科学院基础医学研究所 一种可诱发机体抗肿瘤免疫的异种抗原-Fc融合蛋白及其应用
BR112021006941A2 (pt) * 2018-10-19 2021-08-31 The Francis Crick Institute Limited Antígenos de câncer inovadores e métodos
MX2021015765A (es) * 2019-06-28 2022-01-27 The Francis Crick Institute Ltd Nuevos antigenos y metodos contra el cancer.
AU2020309202A1 (en) * 2019-07-05 2021-12-09 Enara Bio Limited Novel cancer antigens and methods

Also Published As

Publication number Publication date
JP2023522198A (ja) 2023-05-29
US20230167163A1 (en) 2023-06-01
CA3179694A1 (en) 2021-10-21
WO2021212123A1 (en) 2021-10-21
CN116057067A (zh) 2023-05-02

Similar Documents

Publication Publication Date Title
US20250360206A1 (en) Cancer antigens and methods
US20220218807A1 (en) Novel cancer antigens and methods
US20230167163A1 (en) Fusion proteins of ctl antigens for treating melanoma
US20220213159A1 (en) Novel cancer antigens and methods
US20220211760A1 (en) Novel cancer antigens and methods
US20220220175A1 (en) Novel cancer antigens and methods
US20230302109A1 (en) Antigen pool
EA052615B1 (ru) Новые раковые антигены и сопутствующие способы
EA053293B1 (ru) Новые раковые антигены и сопутствующие способы
EA052067B1 (ru) Новые раковые антигены и сопутствующие способы

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20221115

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
REG Reference to a national code

Ref country code: HK

Ref legal event code: DE

Ref document number: 40087518

Country of ref document: HK

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

17Q First examination report despatched

Effective date: 20240712