EP1668037A1 - Polypeptide d'interaction comprenant un motif heptapeptidique et un domaine de penetration cellulaire - Google Patents
Polypeptide d'interaction comprenant un motif heptapeptidique et un domaine de penetration cellulaireInfo
- Publication number
- EP1668037A1 EP1668037A1 EP04787492A EP04787492A EP1668037A1 EP 1668037 A1 EP1668037 A1 EP 1668037A1 EP 04787492 A EP04787492 A EP 04787492A EP 04787492 A EP04787492 A EP 04787492A EP 1668037 A1 EP1668037 A1 EP 1668037A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- seq
- polypeptide
- interaction
- sequence
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
- G01N33/56988—HIV or HTLV
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
Definitions
- the present invention relates to interaction polypeptides comprising a heptapeptide motif and a cell penetration domain, and to screening methods for the identification of interaction polypeptides capable of modifying the phenotype of a cell and for the identification of other molecules capable of interacting with an intracellular target.
- the present invention also relates to uses of the interaction polypeptides as mentioned in phenotypic screens or for therapeutic purposes.
- the present invention is directed to particular interaction polypeptides capable of modifying the function of the viral protein Rev and their uses in screening methods to identify other molecules capable of interacting with Rev.
- Peptide interactions are responsible for an important part of intra and intercellular communication; it is through a complex set of interactions between a protein and its ligand that the cell functions and adapts to its environment.
- this knowledge may seem, at first, devoid of interest as long as the partners of this new protein are not, in turn, identified, which makes it possible to determine the cellular function of the protein. .
- a protein is, in most cases, capable of interacting with different partners. From these interactions can arise either the same function vis-à-vis each of the partners (for example a protein phosphorylating different peptide ligands), or else perfectly distinct functions can thus arise. This is particularly the case for membrane proteins, which independently of their natural function within the cell, also serve as a gateway for viruses. The function of any given protein is therefore largely determined by the peptides or proteins with which this protein interacts.
- Protein interactions are generally the combination of local interactions between very specific sites of the protein (some amino acids) thanks to different bonds, such as electrostatic bonds, hydrogen, and repulsive interactions due to spatial congestion.
- a given protein can interact specifically with a protein domain so that this protein can interact with a whole class of other proteins that share that same domain.
- the identification of new interaction partners is in general! performed in two different situations.
- a partner for a specific target intracellular or extracellular.
- the sequence of this polypeptide is determined by taking into account in particular the structure of the target protein with which it must interact, the distribution of charges, the attractive and repulsive forces.
- This step is carried out most of the time by molecular modeling. This approach requires a very thorough knowledge of the target protein and in particular of its three-dimensional structure. It is also possible to perform a screen to test a very large number of potential polypeptides against the target.
- a screen generally used in this case is the two-hybrid screen ("two-hybrid system") in yeast (US Pat. No. 5,580,736), where the determined target and the potential polypeptide are expressed simultaneously.
- the target protein is not determined, that is to say new interaction partners can also be screened for their ability to modify a given phenotype of the cell, without the target protein with which they interact with is known.
- phenotypic screens are used which consist in making the cell express different polypeptides and in identifying those capable of modifying the phenotype in the expected direction (US Pat. No. 6,153,380).
- a variant of this situation consists in screening new interaction partners capable of preventing, destroying, modifying or destabilizing an interaction between two other proteins.
- phenotypic screens are generally used. The mode by which the partner acts on the interaction between the two other proteins is not necessarily known.
- Another approach is to develop protein mimes by modeling, but this method is not yet developed. In addition, we often end up with molecules which are not or hardly able to cross the cell membrane, and which therefore do not generate the interaction for which they were developed. If a motif ensuring cell penetration has to be grafted onto these molecules, then, as in the previous case, there is no guarantee that they are still capable of interacting with the protein of which they have been chosen to be a ligand. .
- the object of the present invention is to propose new interaction peptides having a particular construction such that a cell penetration domain is associated with the interaction partner.
- the interaction peptides according to the invention have the dual property of cell penetration, for example in lymphocytes and / or in macrophages, and of interaction with a partner.
- the inventors have developed a process making it possible to produce proteins of small size having a heptapeptide motif and capable of binding to a protein target, of viral or cellular origin, and thereby inhibiting its activity. These small proteins have been designed to be able to enter cells.
- the interaction polypeptide of the invention may also have a stabilization domain, linkers or other components.
- the present invention also provides various screening methods making it possible to obtain new polypeptides capable of modifying a given phenotype or of interacting with a given target.
- the present invention also provides a method of screening for chemical molecules capable of interacting with a given protein target.
- virus replication One area where determining such partners is important is virus replication. Indeed, the replication of certain viruses in human or animal cells is allowed by the expression of a limited number of viral proteins, some of which have an activity essential for the realization of this process. By blocking these proteins with an interaction polypeptide defined according to the screens of the present invention, therefore capable of penetrating into cells and preventing the necessary contacts with other viral or cellular proteins, it is possible to prevent replication. of the virus.
- the implementation of the invention made it possible to identify partners capable of interacting with the Rev protein and in particular the Rev protein of HIV-1 and thus preventing replication of the virus. These polypeptides are also part of the present invention.
- the invention can also be implemented in methods aimed at identifying partners capable of interacting with different proteins implicated in certain cancers.
- Heptapeptide or heptapeptide motif linear sequence of 7 consecutive amino acids covalently linked.
- Domain (peptide) peptide sequence comprising at least 5 amino acids, and which, within a sequence comprising it, can be delimited by a deletion-mutation analysis. Such a domain is generally responsible for a function or a role and is characterized by the presence of essential amino acids whose mutation results in the loss of function.
- NLS Nuclear Localization Signal
- the cell penetration domain the NES (Nuclear Export Signal) domain
- the protein-protein interaction domains the catalytic domains.
- Domain or motif of cell penetration or transduction peptide sequence, comprising from 5 to 35 amino acids, capable of ensuring, in vivo, ex vivo or in vitro, the penetration inside the cell of a protein containing this field.
- the domain may need to be placed at one end of the protein, for example at the C-terminal end; the cell penetration function can also be indifferent to the positioning of the motif within the protein.
- the cell penetration function is possibly limited to a certain size of the protein, a size beyond which penetration is no longer ensured.
- the pattern of cell penetration is either general to all cell types, or specific to certain membranes, for example to membranes of prokaryotic cells or to membranes of Gram + bacteria or - or to the membranes of certain human cell types, such as lymphocytes, for example primary lymphocytes, and / or macrophages.
- the pattern of penetration can also ensure penetration inside the nucleus for eukaryotic cells.
- Stabilization domain or motif amino acid sequence, comprising at least 30 amino acids, the secondary structure of which is stable over time and under certain stress conditions, and which has the capacity to stabilize any chimeric protein which comprises it.
- the structure must be insensitive to denaturation and to degradation by proteases and to stress conditions in general; this structure must also be only slightly disturbed when inserted within or at the ends of this domain.
- the stabilization domain is also characterized by a weak immunogenic character.
- a stabilization domain is of relatively moderate size, therefore has less than 300 amino acids, preferably less than 200 amino acids.
- a stabilization domain is in most cases a fragment of a protein naturally present within the cell, a protein which must be chosen from proteins abundant in the cell, ubiquitous, and not involved in processes of degradation.
- Random sequence sequence which is defined or constructed by a random process.
- the random process consists in choosing, one by one, deoxyribonucleotides, among the four possible, each having (equiprobability) or not (biased choice), the same probability of being chosen. Due to the degeneracy of the genetic code, a random DNA sequence, with equiprobability of the 4 bases, will generate a random peptide sequence, but with a bias, because the amino acids coded by several codons will be overrepresented compared to the others.
- the probability that a 21 base random DNA sequence (ie 7 amino acids) does not contain a stop codon in phase is 71.5%. It can also be a randomly defined peptide sequence, that is to say that the amino acids are determined successively, by choice from among all the possible amino acids, with equiprobability or not.
- Bait in a screen having the objective of determining new molecules capable of interacting with each other, the bait is the defined, determined molecule, for which a ligand is sought by means of the screen. The bait may or may not be fused to a molecule acting as a reporter.
- the prey in this same screen, is the molecule which is tested for its ability to interact with a determined bait.
- Two-hybrid screen (or double hybrid) (“two-hybrid system”): this is a special screen, which was first developed in yeast but whose principle can be adapted to other cell types.
- the DNA sequence coding for the bait is fused in phase to a sequence "d1" coding for a first domain "D1".
- the sequence coding for the prey is in turn fused in phase to a sequence "d2" coding for a second domain "D2”.
- the domains “D1” and “D2” are characterized by the fact that their union “D1 + D2” has a particular property or function which the elements “D1” and “D2” do not have taken separately. The meeting of "D1” and “D2” requires an external intervention to put them and keep them in contact.
- Chimeric polypeptide polypeptide comprising a covalent fusion of at least two amino acid sequences which are not, naturally, contiguous within the same protein.
- the covalent fusion can be carried out by a direct or indirect covalent bond (via a linker).
- Linker or "spacer” amino acid sequence, very short, generally comprising 1 to 10 amino acids, preferably 1 to 5, present between two domains of a polypeptide which it separates.
- the linkers are chosen so as not to interfere functionally with the two domains that they separate. The use of linkers is also particularly recommended to allow each domain to adopt a three-dimensional folding independently of each other.
- Linkers are generally rich in amino acids glycines because they have a very small footprint at the side chain and are not very reactive. Pralines are also very often inserted in linkers for their properties promoting the formation of elbows and therefore greater independence of the two domains that the linker separates.
- Percentage of identity between two protein sequences This percentage indicates the degree of identity between two amino acid sequences along the entire sequence. If the sequences considered are of different size, the% identity is expressed as a function of the total length of the longest sequence. To calculate the% identity, the two sequences are superimposed so as to maximize the number of identical amino acids by allowing discontinuities of finite length, then the number of identical amino acids is divided by the total number of acids longest sequence amines. This definition is that adopted in the context of the present invention.
- the invention relates to an interaction polypeptide comprising a heptapeptide motif of sequence N X 1 X 2 X 3 X 4 X 5 X6X 7 c and a cell penetration domain, where Xi, X 2 , X 3 , X 4 , X 5 , X 6 and X 7 are amino acids.
- the interaction polypeptide according to the invention is a chimeric polypeptide; its “chimeric” character comes from the fusion of the heptapeptide motif and the cell penetration domain, that is to say that this chain is not naturally present in any protein.
- a polypeptide according to the invention is characterized by a particular arrangement of the heptapeptide motif with respect to the cell penetration domain.
- the amino acid X 7 is located between 5 and 35 amino acids from the C-terminal end of said polypeptide, preferably between 7 and 25, preferably between 9 and 20, for example 12 to 15, and the domain of cell penetration is located in C-terminal with respect to the heptapeptide motif.
- the transduction domain can be placed at the C-terminus of the interaction polypeptide; it can also be arranged in a C-terminal relative to the heptapeptide motif, without however being at the C-terminal end, for example it is followed by a His-Tag or another motif allowing the purification of the interaction polypeptide or well its detection.
- the heptapeptide motif present in the interaction polypeptide according to the invention is a sequence of 7 amino acids.
- the amino acids are chosen from the 20 naturally occurring amino acids.
- it can also, in the context of the invention, be incorporated modified amino acids.
- the heptapeptide motif is, for example, generated by a random process. It can also be encoded by a DNA sequence which has itself been generated.
- the heptapeptide motif can be perfectly chosen and determined, possibly after a molecular modeling step when the interaction polypeptide is screened for its ability to interact with a determined protein.
- the length of 7 amino acids for the motif is particularly advantageous, in particular when the motif is coded by a DNA sequence generated by a random process. Indeed, when the DNA sequence is generated randomly, this can lead to obtaining "stop codons" (TAA, TAG and TGA).
- a length of 7 amino acids, or 21 nucleotides makes it possible to obtain a relatively small occurrence of “stop” codons and of unnecessary sequences while being long enough to obtain a domain capable of interaction. The number 7 for the length of the heptapeptide motif therefore appears to be an advantageous compromise.
- An interaction polypeptide according to the present invention therefore comprises at least 12 to 42 amino acids. It is generally accepted that polypeptides of this size can sometimes be unstable inside the cell and that they are preferred targets for proteases, with the exception, however, of a few peptides such as antimicrobial peptides. Therefore, an interaction polypeptide according to the present invention is preferably coupled to a molecule which will stabilize the whole.
- such stabilization is carried out by integrating a stabilization domain into the sequence of the interaction polypeptide.
- the stabilization domain is characterized by a stability over time of the polypeptide comprising it greater than that of the same polypeptide without stabilization domain. It is also characterized by its stability with respect to stress conditions, for example denaturation and cleavage conditions which can occur in vitro or in vivo.
- a given stabilization domain can also be chosen for its stability in certain particular biological media such as the intestinal medium or the serum medium, for example so that the interaction partners containing such a domain are stable in the event of ingestion, passage in the stream blood. Regardless of its stabilizing role, a stabilization domain can also have characteristics allowing its detection.
- Another advantage of the stabilization domain is its capacity to be produced in bacteria, or in another organism allowing the production of recombinant proteins, in large quantity and in stable form.
- stabilization domains are natural protein fragments. Indeed, certain proteins are particularly abundant in the cell, ubiquitous, non-immunogenic and stable. Fragments of such proteins are then particularly preferred for use as a stabilization domain. This is particularly the case for proteins of the ubiquitin family (ubiquitin-like).
- the interaction polypeptide When the interaction polypeptide is intended to be introduced into a given cell, it is particularly advantageous to choose as a stabilization domain a fragment of a protein present in said cell, or else a protein belonging to the species of which leaves the cell. In the context of the present invention, it is therefore advantageous to choose the stabilization domain from the protein fragments present in human or animal cells.
- the inventors have in particular shown the very interesting properties, as a stabilization domain, of a member of the ubiquitin family, truncated in its C-terminal part in order to suppress the digiycin motif as well as all the sequences which are found downstream of this pattern.
- a particularly preferred protein in the context of the present invention is the protein homologous to Ubiquitin, called SUMO-1.
- a fragment of the SUMO-1 protein which is particularly suitable for implementing the present invention is the fragment illustrated in FIG. 6 (SEQ ID No. 1), where the digiycin motif and all the sequences downstream have also been truncated.
- SEQ ID No. 1 the fragment illustrated in FIG. 6 (SEQ ID No. 1), where the digiycin motif and all the sequences downstream have also been truncated.
- any sequence having at least 80% identity, preferably at least 90%, or at least 95% identity with the previously mentioned sequence is particularly advantageous .
- stabilization domain function of proteins or protein fragments
- chaperone proteins such as shockeat shock proteins' (HSP).
- HSP shockeat shock proteins'
- An alternative to using a stabilization domain is to cyclize the interaction partners, to obtain the same stabilization effect.
- cyclization is meant the peptide fusion of the N-terminal part, upstream of the heptapeptide domain, with the C-terminal end of the interaction polypeptide.
- linker very short amino acid sequences, called linker or “spacer”, are present either between the stabilization domain if there is one and the heptapeptide motif, or between the heptapeptide motif and the transduction domain.
- linker very short amino acid sequences
- This role is therefore for example to isolate the domains in such a way that there is no interaction between the domains, for example simply by separating them by a sufficient number of amino acids not interacting either with a domain , nor with the other.
- the two domains can then adopt a folding which is only little or not even influenced by the presence of the other domain.
- the role of the linker can also be to impose a particular positioning of a domain with respect to the other, in particular by forming a bend, which also generally has the consequence of isolating one domain from the other.
- the field can also include amino acids which are known to be sites of cleavage by certain proteases, preferably intracellular.
- linker can be chosen such that it is particularly resistant to proteases, in order to avoid for example the potential cleavage of the cell penetration domain before the penetration step.
- a linker according to the invention mainly comprises slightly reactive and space-saving amino acids, that is to say amino acids whose side chain contains only a few atoms, this is particularly the case for the amino acids glycine and praline.
- proline generally forms an elbow within the chain in which it is inserted, this property can be exploited to isolate one area from the other.
- a linker according to the present invention comprises 5 amino acids or less than 5 amino acids.
- a linker according to the invention makes it possible to introduce a degree of flexibility between the different functional parts of the protein.
- a linker particularly suitable for the implementation of the present invention comprises less than 5 amino acids and at least about 20% of amino acids Glycine or Proline, preferably at least 50%.
- a linker according to the present invention contains only amino acids chosen from glycine and proline.
- a linker according to the invention can have the sequence GGGG or PG, where G signifies Glycine, P signifies Proline, and the sequences are written according to the conventional convention from the N-terminal end to the C-terminal end.
- An interaction polypeptide according to the invention comprises a cell penetration domain of 5 to 35 amino acids which is in its C-terminal part; this domain of cell penetration allows the penetration of the polypeptide inside the cell.
- Different areas identified in the literature can be used for this purpose.
- the areas particularly preferred in the context of the present invention is the area of penetration of the HIV-Tat protein, or else areas of other viral strains having the same activity.
- the cell penetration domain of the HIV-Tat protein is characterized by the following sequence: N RKKRRQRRR c (SEQ ID No. 9). where the one letter code to represent amino acids was used.
- the intracellular penetration domain of the interaction polypeptide according to the invention can also comprise a polyarginine motif of sequence RRRRRRR, RRRRRRRR or RRRRRRRRRR (7 to 9 amino acids arginine) whose penetration role has been shown in particular for lymphocytes (Wender and al, 2000).
- Another transduction domain also envisaged in the present invention has a sequence partially corresponding to that of the Tat transduction domain but incorporating certain modifications: RRKARRQRRR (SEQ ID No. 21).
- a particular construction for an interaction polypeptide according to the invention consists in placing the amino acid X 7 of the heptapeptide motif between 10 and 30 amino acids of the C-terminal end of the polypeptide, preferably between 12 and 28, preferably between 15 and 25 amino acids from the C-terminus.
- a particularly suitable domain is the protein SUMO-1.
- the SUMO-1 protein fragment the sequence of which is illustrated in FIG. 6 (SEQ ID No. 1), or any domain sharing at least 80% identity, preferably 90% d, is used as the stabilization domain. identity with this sequence.
- Another field which can be used in the context of the invention is the fragment of ubiquitin defined by the sequence illustrated in FIG. 6.
- domains or elements advantageously form part of an interaction polypeptide or are grafted onto such a polypeptide.
- a sequence facilitating detection it is possible to envisage sequences having an easily detectable enzymatic property, or Dien a reactivity with a determined antibody, or else fluorescent properties.
- graft or incorporate into the sequence of a polypeptide a sequence facilitating its purification for example by providing a poly-histidine or His-Tag tail.
- Addressing signals making it possible to deliver the polypeptide of the invention preferentially to certain types of cells are also particularly advantageous in the context of the present invention.
- Particularly attractive target cells are lymphocytes, macrophages, Langerhans cells, dendritic cells, stem cells, muscle cells, etc.
- Such addressing signals can be part of the stabilization domain, they can also be part of a polypeptide of the invention in addition to the stabilization domain, linkers, heptapeptide and the penetration domain.
- cell penetration domains which are specific or preferential to certain types of cells can be used.
- sequences which are particularly preferred for the heptapeptide motif mention may be made of the sequences having at least one of the following characteristics: X 2 is an amino acid Tryptophan, X 4 or / and X 5 is an amino acid Cysteine. Other sequences according to the invention also have a leucine for the amino acid X 6 .
- the sequence of the heptapeptide motif comprises a tryptophan at X 2 and a cysteine at X 4 or / and X 5 .
- a heptapeptide motif preferably has the 3 characteristics listed. Sequences of heptapeptide motifs which are very particularly preferred in the context of the present invention as interacting with the Rev protein of HIV-1 are the following sequences:
- N FWFCGLK G (SEQ ID N ° 2), N NWLCCLN c (SEQ ID N ° 3), N KLGCFWF c (SEQ ID N ° 10), N NLCCLWN c (SEQ ID N ° 11), N FWFCGLA c (SEQ ID N ° 27), N AWLCCLN c (SEQ ID N ° 25), N NWLCCLA c (SEQ ID N ° 26), " FWFCGAK (SEQ ID N Q 45), FWFCGAA (SEQ-ID N ° 46), NWACCLN (SEQ ID N ° 47), NWLACLN (SEQ ID N ° 48), AWACCLN (SEQ ID N ° 49), AWLACLN (SEQ ID N ° 50), AWLCCLA (SEQ ID N ° 51), NWAACLN (SEQ ID N ° 52) , NWACCLA (SEQ ID N ° 53), NWLACLA (SEQ ID N ° 54), AWAA
- sequences which are particularly preferred for an interaction polypeptide according to the invention mention may be made of the following sequences:
- FWFCGLAPGRKKRRQRRRG (SEQ ID N ° 61), FWFCGAAPGRKKRRQRRRG (SEQ ID N ° 62), AWLCCLNPGRKKRRQRRRG (SEQ ID N ° 63), NWACCLNPGRKKRRQRRRG (SEQ ID NR 64) ° 66), AWACCLNPGRKKRRQRRRG (SEQ ID N ° 67), AWLACLNPGRKKRRQRRRG (SEQ ID N ° 68), AWLCCLAPGRKKRRQRRRG (SEQ ID N ° 69),
- NWAACLNPGRKKRRQRRRG (SEQ ID N ° 70), NWACCLAP ⁇ RKKRRQRRRG (SEQ ID N ° 71), NWLACLAPGRKKRRQRRRG (SEQ ID N ° 72), AWAACLNPGRKKRRQRRRRG (SEQ ID NAPRRKRRRRRRRRRRRRRRRRRRRRG) 75),
- a polypeptide of the invention therefore has the capacity to penetrate inside a cell without external intervention when it is brought into contact with the cell, it also has the capacity to interact with a protein or a protein domain which can be intracellular or extracellular.
- the very structure of a polypeptide of the invention provides it with great flexibility, in particular at the level of the variable part which is the motif. heptapeptide. Indeed, this motif is placed within 35 amino acids of the C-terminal part of the polypeptide, preferably less than 25 amino acids.
- This privileged position in a part of the polypeptide undergoing less conformational constraints than in the more central part of the polypeptide, provides the heptapeptide with greater freedom of folding.
- This increased freedom is likely to translate into an increased ability to adapt to one's target. Indeed, when the stresses are low at each end of the heptapeptide, it can adopt a greater number of conformations because the energy barrier to pass from one conformation to another is weaker. This flexibility generates, for the same heptapeptide, different possible conformations, and therefore a greater probability of interaction with the target.
- the present invention relates more particularly to peptides capable of interacting with the Rev protein, in order to inhibit replication thereof, characterized in that they consist of or include the heptapeptide sequence N X ⁇ XaX ⁇ XeX? c , where X- ,, X 3 , X 4 , X 5 , Xe, X, are amino acids independently chosen from natural or modified amino acids and X 4 and / or X is a cysteine, W is tryptophan.
- X 5 is a cysteine.
- the Rev protein is that of a viral strain of HIV type, for example HIV-1 or HIV-2, or else of SIV (simian immunodeficiency virus), SHIV (hybrid between human immunodeficiency virus and simienne), FIV (feline immunodeficiency virus) or any other viral strain having a protein homologous to the HIV-1 Rev protein; it can also be the equivalent Rex protein of HTLV-1, HTLV-2 or BLV.
- Such peptides comprise or consist of a sequence capable of interacting with the Rev protein in a double-hybrid yeast test; in addition, these peptides are also capable of inhibiting viral replication in vivo.
- Preferred heptapeptide sequences are the following sequences: N FWFCGLK c (SEQ ID No 2), N NWLCCLN c (SEQ ID No 3), N FWFCGLA c (SEQ ID No 27), N AWLCCLN c (SEQ ID No 25) and N NWLCCL c (SEQ ID N ° 26), FWFCGAK (SEQ ID N ° 45), FWFCGAA (SEQ ID N ° 46), NWACCLN (SEQ ID N ° 47), NWLACLN (SEQ ID N ° 48), AWACCLN (SEQ ID N ° 49), AWLACLN (SEQ ID N ° 50), AWLCCLA (SEQ ID N ° 51), NWAACLN (SEQ ID N ° 52), NWACCLA (SEQ ID N ° 53), NWLACLA (SEQ ID N ° 54), AWAACLN (SEQ ID N ° 55), AWACCLA (SEQ ID N ° 56), AWLAC
- Bait plasmid pLexRev (see Example 1)
- Prey plasmid containing the activation domain of GAL4 in fusion with the sequence coding for the peptide to be tested, for example a plasmid derived from pGAD424.
- Yeast HF7c strain of S. cerevisiae.
- Example 1 provides more information on possible operating conditions for the implementation of this test.
- Virus reference lymphotropic strain HIV-1-LAI (Barré-Sin ⁇ ussi et al; 1983). Protocol: the cells are pretreated for 30 minutes with 5 concentrations of the peptide to be tested and then infected with the HIV-1-LAI strain. The peptide is maintained in the medium throughout the time of the culture; the cell supernatant is collected 7 days after infection and the reverse transcription activity is measured. The experimental part provides more information on the operating conditions, concentrations and buffers which can be used to carry out this test.
- Polypeptides comprising the sequences N FWFCGLKPGRKKRRQRRRG c (SEQ ID No. 4), N NWLCCLNPGRKKRRQRRRG c (SEQ ID No. 5), FWFCGAKPGRKKRRQRRRG (SEQ ID No. 60), FWFCGLAPGRKKRRRRRRRRRR # 62)
- AWLCCLNPGRKKRRQRRRG (SEQ ID N ° 63), NWACCLNPGRKKRRQRRRG (SEQ ID N ° 64), NWLACLNPGRKKRRQRRRG (SEQ ID N ° 65), NWLCCLAPRKKRRQRRRG (SEQ ID NR 66) 68),
- AWLCCLAPGRKKRRQRRRG (SEQ ID N ° 69), NWAACLNPGRKKRRQRRRG (SEQ ID N ° 70), NWACCLAPGRKKRRQRRRG (SEQ ID N ° 71),
- NWLACLAPGRKKRRQRRRG (SEQ ID N ° 72), AWAACLNPGRKKRRQRRRG (SEQ ID N ° 73), AWACCLAPGRKKRRQRRRG (SEQ ID N ° 74), AWLACLAPGRKKRRQRRRG (SEQ ID NG 75RRQR) ID No. 76) and AWAACLAPGRKKRRQRRRG (SEQ ID No. 77) are particularly preferred for use as inhibitors or modulators of the Rev protein and very particularly of the Rev protein of HIV-1.
- Such peptides are capable of interacting either globally with the Rev protein, or possibly with one of its domains.
- proteins are generally characterized by the presence of different domains with sometimes different functions within their sequence. Depending on the three-dimensional structure and the folding adopted by the protein, these domains sometimes have the particularity of being accessible to partners independently of each other.
- NES Nuclear Export Signal
- the present invention also relates to a family of interaction polypeptides according to the invention, or population of interaction molecules according to the invention, the members of the family / population being interaction polypeptides do not differentiating from each other only by the sequence of the heptapeptide motif.
- a family / population is defined by the presence of at least two members of which only the sequence of the heptapeptide motif differs. However, a family generally comprises more than two members, in general at least 10 and preferably at least 50. Families which are particularly preferred in the context of the present invention are families comprising at least 100 members distinct, preferably 1000. It is not excluded that a family or population has a certain number of members which are identical. In the case where the heptapeptide motif consists of 7 amino acids chosen from the 20 natural ones, a family or population as defined according to the invention comprises up to 20 7 distinct members.
- a family of interaction polypeptides according to the present invention comprises the sequence N c (SEQ ID No. 6), where the sequence N X ⁇ X 2 X 3 X 4 X 5 X 6 X 7 c corresponds to the sequence of the heptapeptide motif as defined in the invention and the sequence PGKKRRQRRRG (SEQ ID No. 1 2) corresponds to the sequence of a linker and a cell penetration domain, where the one letter code to represent the amino acids is used.
- X 1 ⁇ X 2 , X 3 , X, X 5 , Xe and X 7 represent amino acidos.
- the heptapeptide domain is the only variable region of a family member polypeptide (or population) compared to another family member polypeptide.
- a family of interaction polypeptides comprises members whose sequence comprises or consists of the following sequence: (SEQ ID NO: 7), or the sequence MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQG VPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTARGGGGSX ⁇ ⁇ xsx sXe PGKKRRQRRRG X 7 (SEQ ID NO: 78).
- the heptapeptide motif, corresponding to the sequence N X., X 2 X 3 X X5X 6 X 7 c is the only region different from one member of the family to another.
- X- ,, X 2 , X 3 , X, X 5 , X 6 and X 7 represent amino acids.
- Interaction polypeptides of this family are called "SUMO-1 Heptapeptide Protein Transduction Domain" or SHP.
- the PGKKRRQRRRG sequence (SEQ ID No. 12) comprises the cell penetration domain required for the polypeptides of the invention.
- a sequence exhibiting less than 3 modifications with respect to this sequence is also a preferred sequence within the framework of the invention. By modification, one understands addition or deletion of an amino acid, or substitution of an amino acid of this sequence by another amino acid.
- the sequence :
- Sequences sharing at least 80%, preferably at least 90%, of identity with this sequence are also sequences which can be used in order to constitute the stabilization domain of a family of polypeptides according to the invention.
- the invention also relates to all the DNA sequences coding for a polypeptide of the invention, unique or belonging to a family or population, or coding for any other fragment or domain mentioned in the present invention. It can be double stranded DNA or single stranded DNA. It is considered in the context of the present invention that a single-stranded DNA codes for a polypeptide when this sequence or indeed the complementary sequence indeed contains the coding part.
- the DNA sequence is in linear or circular form, for example in a plasmid.
- RNAs which could be derived from the transcription of a DNA sequence coding for a polypeptide of the invention are also included in the invention.
- An interaction polypeptide as defined in the present invention has the potential ability to interact with a protein partner, determined or not, in order to modify the behavior of the cell. Inside the cell, the presence of such a polypeptide can therefore make it possible to block certain cellular functions, in particular by playing the role of competitive inhibitors. This action has therapeutic effects in many conditions if the cellular modification consists in attenuating or preventing a harmful cellular function to the cell. It is also envisaged that the presence of the polypeptide outside the cell modifies the property of the cell by interacting with a messenger or else with a protein on the surface of the cell. Therefore, the polypeptides of the invention as defined have a privileged application in the field of therapy where they can be used as active ingredient in medicaments. They are then very often accompanied by various pharmaceutically acceptable excipients. By therapy is meant both curative and prophylactic aims.
- the interaction polypeptides according to the invention specifically tested for their interaction with the Rev protein are very particularly preferred for uses in therapy against HIV infections, preferably in human therapy.
- the polypeptides of the invention can also be used in veterinary applications, to treat animals infected with HIV homologous viruses having a Rev protein or a strong homolog. They can also be used as a preventive measure.
- they can be administered in a variety of forms, without limitation. They can in particular be ingested in the form of a tablet, capsule, syrup, or else be injected muscularly or intravenously, by penetration of a lotion, a gel or an ointment. Any other form of administration can also be considered. They can also be packaged in the form of liposomes and then administered in this form.
- the medicament also consists of the DNA molecule coding for an interaction polypeptide of the invention. This is particularly the case when gene therapy is used.
- the invention also relates to cells containing a polypeptide of the invention, unique or belonging to a family, or any other fragment or domain mentioned in the present invention, and also cells containing DNA sequences encoding such polypeptides.
- Preferred cells are lymphocytes and macrophages, dendritic cells, Langerhans cells, stem cells, preferably such cells are mammalian and in particular human cells. Other cells are yeast cells and bacterial cells.
- Cells as presented can be obtained by transformation, gene therapy, or by contacting the cell and an interaction polypeptide of the invention. Such cells have particularly interesting applications in therapy.
- Transformed cells, especially bacteria with a DNA coding for an interaction polypeptide according to the invention, are particularly advantageous for producing said polypeptide.
- the polypeptide produced in bacteria is then optionally purified and can be used as an active ingredient in a medicament.
- the present invention also relates to screening methods involving interaction polypeptides as described. Indeed, these polypeptides are specially designed to act against protein targets against which they have been tested.
- a first screening method envisaged by the invention aims to identify polypeptides which are capable of modifying the phenotype of a cell. The method comprises a step of bringing a polypeptide of the invention into contact with the cell whose phenotype is sought to be modified. This step is followed by the detection of the change in cell phenotype. These steps are then optionally supplemented by a step of determining the sequence of the heptapeptide motif included in the sequence of the polypeptide which has been tested.
- phenotype should be understood in the broad sense as encompassing all the morphological or functional characteristics of the cell.
- a modification of the phenotype can in particular be characterized by a change in the shape of the cell, a modification of the composition of the membrane, secretion of a given protein, a change in color or a change in reactivity under given conditions.
- the method aims to identify polypeptides which are capable of generally modifying the phenotype of a cell, it may be an expected or sought-after modification, it may also be a surprising modification. or that was not wanted.
- the method can be used in order to identify polypeptides capable of interacting with a given protein.
- the interaction of the polypeptide with its target will lead to a modification of the phenotype which was expected, for example the death of the cell, or resistance or sensitivity to an antibiotic, or to a virus, or to heat.
- the interaction can be demonstrated via a reporter, in particular a reporter gene.
- This reporter element is responsible for the modification of the phenotype, this modification being expected.
- the method can also be used to identify a polypeptide capable of interacting with a given protein group or for example with a given metabolic pathway or immune cascade.
- the modification of the expected phenotype is the modification of the function of the group or else the modification of the immune pathway or cascade. The effect of such a change is not always determined in advance.
- the first step of the method is characterized by bringing a polypeptide of the invention into contact with the cell.
- bringing into contact is understood to mean both the action consisting in bringing the polypeptide close to the cell, the bringing into contact as well as the action consisting in introducing the polypeptide into the cell.
- bringing into contact it is also included the case where the DNA coding for the polypeptide is introduced into the cell and this DNA is then translated to give rise to the polypeptide. In this situation, it is the cell itself that helps generate the polypeptide.
- the first step of the method is therefore for example carried out by the extracellular addition of the polypeptide in a medium containing the cell whose phenotype is to be modified, for example the addition of the polypeptide in a fluid containing the cell.
- the polypeptide according to the invention has a penetration domain, it can optionally cross the cell membrane.
- the method described is either an extracellular screening method or an intracellular screening method. Screening is considered intracellular if the interaction between the polypeptide and its target takes place in the cell, regardless of whether the polypeptide has been added extracellularly or introduced intracellularly. Screening is considered extracellular if, on the contrary, the interaction between the polypeptide and its target takes place outside the cell, for example on its surface.
- the screening method of the invention can be implemented in vivo, or in vitro.
- the bringing together of the polypeptide and the cell can consist of bringing together the polypeptide with a fluid comprising the cell or else a tissue containing such a cell.
- a particularly preferred application of the process of the invention consists in making use of a two-hybrid screen. This application is recommended when the target protein, for which a partner is sought in the form of an interaction polypeptide, is known and when its sequence is available. It is then possible to detect an interaction between the target protein and an interaction polypeptide according to the invention.
- Such an interaction is generally manifested by the induction of a reporter gene - the expression of which modifies the phenotype in an easily detectable manner, for example by a change in cell color.
- a particularly preferred application of the method is in the field of screening for new interaction partners against viral proteins, including the Rev protein.
- a protein is found in various viruses and in particular HIV.
- the gene coding for the Rev protein is for example cloned in a two-hybrid system to serve as bait.
- Such a screen makes it possible to identify polypeptides capable of rendering a cell resistant to HIV infection, by preventing or limiting viral replication in the host cell.
- Another application of the method consists in making use of a triple-hybrid screen.
- a second method covered by the present invention is a method of screening molecules for the identification of one of them which interacts with a determined intracellular target.
- Such a method comprises a first step of generating polypeptides of the invention.
- the polypeptides thus generated are placed in the presence of the intracellular target, a detection of the interactions between the polypeptide and the target is carried out, possibly followed by the determination of the sequence of the heptapeptide motif of the polypeptide.
- the polypeptide can be brought into the presence of the target directly by introducing the polypeptide into the cell, or else indirectly by bringing the polypeptide and the cell into contact, the polypeptide then entering the cell.
- the detection step can be carried out by any technique known to a person skilled in the art. A possible detection is in particular the observation of a change phenotypic; the screen can be adapted so that the modification of the phenotype is the result of the expression of a reporter gene. Detection may also involve the assay of an entity, for example the assay of a protein, or a metabolite.
- the various preferred characteristics or uses mentioned in the context of the first process according to the invention are also applicable for this second process.
- the method can be implemented in vivo or in vitro.
- a third method covered by the invention is a method for modulating the properties of an intracellular target molecule. Such a method comprises a step of bringing into contact a cell which contains the target molecule and an interaction polypeptide of the invention.
- the target molecule is preferably a protein or a protein fragment comprising at least 5 amino acids, preferably at least 10.
- the polypeptide of the invention is specifically designed with a heptapeptide motif which is capable of interacting with the molecule target. Such a heptapeptide motif is advantageously determined by the implementation of the first screening method of the invention.
- modulating properties is meant all the modifications of the target which are likely to affect its function or its properties, in particular the modifications which will modify its ability to interact with its partners; but also the modifications which will lead to greater or lower stability under certain conditions, the modifications of enzymatic kinetics, of specificity or of selectivity.
- the various preferred characteristics or uses mentioned in the context of the first process according to the invention are also applicable for this third process.
- the method can be implemented in vivo or in vitro. It is preferably implemented by making use of a two-hybrid system.
- a preferred application of such a method aims to modify the properties of viral proteins essential for the replication of viruses, and more particularly the HIV Rev protein.
- the invention relates to different uses.
- the invention comprises the use of a DNA sequence coding for a polypeptide of the invention so that the polypeptide then translated serves as prey in a phenotypic screen; preferably the DNA sequence is cloned in a two-hybrid system.
- a two-hybrid system is characterized by the search for an interaction between a given molecule (protein), generally called “bait”, and a potential partner to be tested, generally called “prey”.
- a two-hybrid system generally comprises the introduction into a cell of the sequences coding for the bait, the prey and a reporter gene, linked in a specific way to other elements.
- prey that the DNA sequence coding for a polypeptide of the invention can be used.
- a particularly preferred situation in the context of the invention consists in using the DNA sequence coding for a polypeptide of the invention as prey in a two-hybrid system.
- a potential bait is the Rev protein of the human immunodeficiency virus (HIV). Indeed, this viral protein is a particularly interesting target for the identification of new inhibitors.
- the present invention therefore envisages very particularly the use of the DNA sequence coding for a polypeptide of the invention in a two-hybrid system with the HIV Rev protein.
- the interaction sought between the polypeptide of the invention and a given protein can occur globally, or else with a particular domain of the protein.
- a given protein for example HIV-Rev
- This strategy makes it possible to identify interaction polypeptides specific to this domain. Indeed, it has been discovered by the inventors that the potential for interaction between two given polypeptides is increased when the two polypeptides have comparable sizes.
- the interaction polypeptide of the invention has a fairly short sequence responsible for the interaction, these are the 7 amino acids of the heptapeptide, with possibly the combination of the interaction generated by the penetration motif.
- interaction polypeptides are particularly recommended for their capacity to interact with polypeptides of comparable size, in a preferred manner, with domains of comparable size.
- Particularly advantageous uses of interaction polypeptides in a two-hybrid screen therefore make use, for the bait, of sequences coding for domains of 5 to 30 amino acids, preferably from 6 to 20, more preferably from 7 to 15 amino acids.
- Such domains are for example binding domains, addressing signals, catalytic domains.
- NES Nuclear Export Signal
- One such NES domain is that of the HIV Rev protein.
- Other “NES” signals are known having more or less similar sequences and sizes in the same order of magnitude.
- the two domains NLS and NES have sizes which are perfectly compatible with the optimal sizes for interaction with a polypeptide of the invention.
- a sequence for an NES domain is in particular that of the HIV-1 Rev protein, LQLPPLERLTLD (SEQ ID No. 8).
- the present invention also relates to a screening method for identifying, among candidate molecules, molecules which are capable of interacting with a given intracellular target.
- use is made of the interaction properties of the intracellular target with an interaction polypeptide according to the invention.
- it is sought to detect a variation in this interaction between target and interaction polypeptide, when the candidate molecule to be tested is added.
- the modification of the interaction between target and interaction polypeptide reflects the potential capacity of the candidate molecule to interact with the intracellular target.
- the interaction polypeptide according to the present invention capable of interacting with a given intracellular target, serves as a tool for identifying new drugs, proteinaceous or not, which are also capable of interacting with the target intracellular given.
- the method therefore comprises the following steps: i. bringing the target molecule into contact with an interaction polypeptide according to the invention, ii. detecting the interaction between the target molecule and the interaction polypeptide, iii. adding a candidate molecule, iv. detecting the modification of the interaction between the target molecule and the interaction polypeptide.
- the interaction between the target molecule and the interaction polypeptide according to the invention can be detected by any suitable means, and in particular by the use of a reporter gene. It is conventionally made use of a "two hybrid" system. In such a situation, the interaction between the target molecule and the interaction polypeptide is detected using a reporter gene.
- the present invention also covers the candidate molecules identified by this method, such as protein molecules, polynucleotides, small organic molecules, for example having a molecular weight of less than 1000, lipids, carbohydrates, etc.
- the intracellular target molecule is the Rev protein and the interaction polypeptide used is as defined in the present invention, preferably with one of the following heptapeptide sequences: N FWFCGLK c (SEQ ID N ° 2), N NWLCCLN c (SEQ ID N ° 3), N FWFCGLA c (SEQ ID N ° 27), N AWLCCLN c (SEQ ID N ° 25) and N NWLCCLA c (SEQ ID N ° 26), FWFCGAK (SEQ ID N ° 45), FWFCGAA (SEQ ID N ° 46), NWACCLN (SEQ ID N ° 47), NWLACLN (SEQ ID N ° 48), AWACCLN (SEQ ID N °
- the interaction polypeptide used is one of those described in the experimental part under the name SHPR.
- the present invention also relates to a method for the identification of molecules capable of modulating the properties of an intracellular target molecule.
- This method is characterized in particular by the following different stages: Firstly, nucleic acid molecules are generated comprising sequences coding for different members of a family of interaction polypeptides according to the invention. These different members differ from each other only in the sequence of the heptapeptide motif.
- the method also includes screening the molecules thus generated using a two-hybrid yeast system. In this screening, use is made of the target molecule, for which interaction partners are sought, as bait.
- the molecules generated play the role of prey.
- the method further includes a step of detecting an interaction.
- This interaction can be manifested in particular by the expression of a reporter gene included in the two-hybrid system.
- a phenotypic change in the cell or the assay of an entity can also allow the detection of an interaction.
- the method also includes verifying this interaction in human cells.
- This step can be done in different ways. One way is to create the equivalent of the two-hybrid system but adapted to human cells. The system is advantageously implemented with a cell line. It is also possible to verify the interaction by co-immunoprecipitation or by verifying the effects generated by this interaction. In this way, the screened polypeptide is brought into contact with the cell containing the intracellular target. It is observed whether this polypeptide induces an effect on the cell due to its interaction with the target.
- a subsequent step also envisaged consists in producing in quantity the interaction polypeptide identified in the context of the present invention.
- Such production is advantageously carried out in bacteria, for example under the action of an inducible promoter capable of over-expressing the polypeptide.
- the polypeptide can be produced in soluble form or as an inclusion body.
- the production in quantity is also possible in mammalian cells, for example in Sf9 cells.
- This method is particularly suitable for detecting interaction polypeptides capable of modifying the function of viral proteins, such as those of HIV: Tat, Rev.
- the method for obtaining and characterizing interaction polypeptides according to the invention is carried out in several stages and can be carried out according to the following methodology, employed by the inventors:
- a library of random heptapeptides in fusion with the activating domain of a transcription factor, in this case GAL4, at its N-terminal end, and the nine amino acids of the basic Tat domain at its C-terminal end has been constructed.
- a yeast expression vector The sequence coding for the protein of interest, viral or cellular is cloned downstream from that coding for a DNA binding domain, in this case LexA, in a vector allowing the expression of the protein in yeast.
- the basic Tat domain associated with the heptapeptide motif is used as the motif ensuring intracellular penetration.
- the design of the final protein sequence is such that the different domains are spaced apart by glycine or proline amino acids which ensure their separation.
- the yeast strain L40 which has the reporter genes His and LacZ dependent on LexA binding motifs is transformed by the vector expressing the fusion LexA target protein, which was done with the proteins LexA-Tat, LexA-Rev and LexA- NES Rev, then by the vector bank having the random heptapetides.
- the Tat and Rev proteins of HIV-1 are regulatory proteins essential for viral replication.
- a first selection of the clones is made on medium without histidine.
- the positive clones are then subjected to a ⁇ -galactosidase test on a filter.
- the clearly positive colonies are recovered and the vector containing the heptapeptide motif isolated by transformation in E. coli.
- Vector sequencing allows the identification of the heptapeptide motif.
- the measurement of SEAP activity makes it possible to evaluate the capacity of the heptapeptide motif to interact with the target protein in the nucleus of human cells.
- the vector expressing the heptapeptide motif also makes it possible to evaluate, by immunoblot experiments, made with extracts of cells transfected by this construct, the level of expression of the fusion protein with this motif, and therefore to verify its stability in the cells. These experiments made it possible to confirm the ability of several heptapeptide motifs to interact with Tat and Rev.
- association of the heptapeptide / basic amino acid sequence of Tat with a stabilization protein Short linear peptides sometimes exhibit poor stability in extra- and intra-cellular media.
- the inventors decided to associate the heptapeptide / basic amino acid sequence of Tat with a small, stable and abundant protein in human cells. They initially chose members of the Ubiquitin family. The constructions were made with Ubiquitin (Ub) itself and a homologous protein, SUMO-1. The sequences coding for these proteins were introduced into an expression vector for mammalian cells.
- the heptapeptide / basic amino acid sequence of Tat is introduced downstream of SUMO-1 or Ubiquitin at the digiycin motif which is lost.
- This digiycin motif is normally linked to the side chains of the lysines of proteins modified by these polypeptides.
- the correct expression of the SUMO-1-heptapetide fusion proteins specific for Tat (designated SHPT) and Rev (designated SHPR) could be verified.
- SHPT SUMO-1-heptapetide fusion proteins specific for Tat
- Rev designated SHPR
- the inventors carried out functional tests to evaluate whether the SHPRs and SHPTs directed respectively against Rev and Tat were capable of preventing the function of these proteins.
- the expression vectors SHPTs were co-transfected with a vector expressing Tat and an indicator construct having the HIV-1 promoter in front of the CAT sequence.
- the inventors have developed a system for producing large quantities of interacting peptides in order to be able to assess their capacity to penetrate cells and to inhibit the function of their target protein from the extracellular medium.
- the sequence SUMO-1 / anti-Rev heptapeptide / basic Tat domain was cloned into a vector allowing production in bacteria.
- the first results show that SHPRs are well produced and can be purified by this process. The production of a large batch of these two molecules makes it possible to evaluate the possible pharmacological interest of these proteins.
- the whole process described here made it possible to establish the feasibility of the method of identifying ligands antagonistic to the function of target proteins.
- the interaction peptides obtained can be used directly as therapeutic molecules, or serve as models for developing small organic molecules mimicking their structure.
- Figure 1 It illustrates the different steps and constructs used for the generation of interaction polypeptides capable of interacting with a given target protein.
- the double arrows symbolize an interaction between two molecules.
- the different cell types are indicated for each step.
- Step 3 (functional tests) was carried out with the REV viral protein as target.
- Figure 2 illustrates the maps of the different plasmids used for the "two-hybrid" step in yeast.
- Figure 2 A plasmid pGAD-CR which is derived from pGAD424.
- plasmid pGAD-CR-P which derives from pGAD-CR and includes the sequence coding for the heptapeptide motif inserted between the BamHI and Xmal restriction sites.
- Figure 2B plasmid pLex-Tat which contains the Tat cDNA inserted between the EcoRI and BamHI restriction sites of the plasmid pLex9.
- plasmid pLexNES which contains the sequence coding for the NES motif of Rev inserted between the BamHI and Xhol restriction sites of the plasmid pLex9.
- Figure 2C plasmid pLexRev which contains the Rev cDNA inserted between the BamHI and SalI restriction sites of the plasmid pLex9.
- Figure 3 Figure 3 illustrates the maps of the different plasmids used for the “two-hybrid” step in mammalian cells.
- Figure 3A plamside pSG-FNV-P.
- the X7 PTD motif was amplified from pGAD-CR-P, digested with the restriction enzymes SalI and Bglll and then inserted between the restriction sites Xhol and Bglll of the plasmid pSG-FNV.
- PSG5LexA-Tat plasmid derived from pSG5LexA and includes Tat cDNA.
- PSG5LexA-Rev plasmid derived from pSG5LexA and includes Rev cDNA.
- Figure 4 illustrates the SUMO-1-P expression vector maps for functional tests.
- pTL1-SUMO-1-CP the coding sequence of SUMO-1 including the restriction sites Xhol and Bglll has been inserted in pTL1.
- pTL1-SUMO-1-P the sequence of the X7 PTD motif was inserted between the Xhol and BglII restriction sites of pTL1-SUMO-1-CP.
- Figure 5 Figure 5 illustrates the map of the plasmid pFLAG-SUMO-1-P used as expression vectors in bacteria. This plasmid was constructed by inserting the sequence coding for the SUMO-1-P motif between the Hindlll and
- FIG. 6 illustrates the wild-type sequences of 'SUMO-1' (numbered 1) and of Ubiquitin (numbered 3) as well as the sequences of the interaction peptides according to the invention comprising, as stabilization domain, a fragment of
- SUMO-1 (SUMO interaction peptides numbered 2) or ubiquitin (UB interaction peptides numbered 4).
- the sequences of wild SUMO-1 and of an interaction peptide comprising a fragment of SUMO-1 were aligned.
- the star symbolizes the presence of an identical amino acid in the two sequences.
- the motif XXXXXXXX in the interaction peptides represents the sequence of 7 amino acids which can be defined randomly.
- Figure 7 is a schematic representation of proteins used as bait (A) and prey (B, C) in two-hybrid tests in yeast (A) or in mammalian cells (C).
- the baits consist of the LexA protein in fusion with Tat (amino acids aa 1 to 86), Rev (aa 1 to 116) or the nuclear export domain of Rev (aa 70 to 96).
- B. Yeast prey includes the GAL4 activator domain, a series of 7 amino acids of random sequence and the Protein Transduction Domain PTD.
- FIG. 8 Figure 8 illustrates the analysis of the heptapeptide + PTD modules of Tat, selected against Tat and Rev, by two-hybrid mammalian screening.
- HeLa cells are transfected with the reporter construct pSEAP LEX5X and pSG5LexA-Tat, alone or with pSG-FNV-P-T8, -T9, -T10, or -T24. The quantity of SEAP is measured and the average of the values obtained for two independent transfection points is represented.
- FIG. 8A Figure 9: Figure 9 illustrates the inhibition of Tat and Rev activities for the SHPT and SHPR constructs.
- A schematic representation of the SHP construct which includes the entire sequence of SUMO-1, in which the digiycin (GG) motif has been mutated into AR, associated at its C-terminal end with the Heptapeptide - PTD module from Tat.
- GG digiycin
- HeLa cells are transfected with the LTR HIV-CAT construct with pSG-Tat and either pTL1-SUMO-1, pTL1-SHPT-8, -9, -10, or -24.
- the quantity of these latter plasmids was either 0.5 ⁇ g (light gray bars) or 2 ⁇ g (dark gray bars).
- CAT activity is measured and the average of the values obtained for two independent transfection points is represented. The error bar is half the difference between the two values.
- HeLa cells are transfected with the plasmids pDM128 and pSG-Rev together with either pTL1-SUMO-1, pTL1- SHPR-15, -115, -190, -R7, -R31 and -R142.
- CAT activities are shown as in Figure 9B.
- Figure 10 shows the direct protein-protein interaction between SHPR and Rev.
- GST-Rev was produced in bacteria and loaded onto an agarose-glutathione column.
- SHPR-142, -190 as well as SHPT-8 are loaded in the column.
- the proteins are eluted with glutathione.
- An aliquot of the loading (line 1), washing (line 2) and elution (lines 3, 4, 5) fractions was analyzed by immunoblot for GST-Rev (top graph) and for SHP using antibodies against GST or FLAG, respectively. This shows that there is co-elution of SHPR-142 and SHPR-190 with GST-Rev, except that SHPT-8 does not bind to the protein on the column.
- Figure 11 illustrates the intracellular entry of SHP.
- Mononuclear cells are prepared from peripheral blood, either directly (A) or after activation with PHA (phytohemagglutinin) and IL-2 (interleukin 2) (B), then incubated with 2 ⁇ M of SHPR-190.
- PHA phytohemagglutinin
- IL-2 interleukin 2
- an aliquot of the supernatant is analyzed by immunoblot using antibodies against FLAG (A, lines 1 to 4; B, lines 1 to 3).
- the cells are collected and lysed in RIPA buffer.
- the extract thus obtained is analyzed by immunoblotting as described for the supernatant (A, lines 5 and 6; B, line 4).
- the exposure times are different between lines 5 and 6 (30s) and lines 1 to 4 (5s).
- Jurkat cells were incubated with 2 ⁇ M of SHPT-8, SHPR-15, SHPR-142 or SHPR-190 for one hour and 24 hours later the cells were collected and analyzed by immunofluorescence using an antibody against FLAG. Light transmission and fluorescence images for representative cells are shown. The cells exhibit a diffuse fluorescence which is not observed for the controls.
- Figure 12 shows the inhibition of HIV-1 replication in lymphocytes and macrophages.
- A. mononuclear cells are prepared from peripheral blood and are activated. The cells are treated with different quantities of AZT, Indinavir, SHPR-15, -142, -190 or SHPT-8 and infected with HIV-1-LAI. Viral replication is measured by assaying the reverse transcription activity in the supernatants and the inhibition percentages are represented as a function of the amount of the compound.
- B. Macrophages are prepared from monocytes, treated with different concentrations of drugs and SHPs and infected with HIV-1 / Ba-L. Viral replication is measured by assaying the reverse transcription activity. The percentages of inhibition at 7 days post-infection are represented as in FIG. 12A.
- Example 1 Description of the constructs and operating conditions used to identify peptides interacting with the Tat and Rev proteins of HIV-1.
- HIV-1 expresses several regulatory proteins whose action on essential cellular factors ensures rapid and efficient production of viral particles.
- regulatory proteins whose action on essential cellular factors ensures rapid and efficient production of viral particles.
- Tat activates transcription of the integrated provirus by establishing contacts with the transcription factors and the TAR motif located at the 5 ′ end of the viral RNA.
- Rev also has the dual capacity to interact with RNA, in this case the RRE motif present in the intronic position in the 3 'part of viral RNA, and with nuclear factors of the cell.
- This viral protein includes both a nuclear localization signal (NLS) and a nuclear export sequence (NES) signal, and by shuttling between the nucleus and the cytoplasm, this protein allows the export and therefore the translation of non-spliced and partially spliced viral RNAs.
- NLS nuclear localization signal
- NES nuclear export sequence
- the double hybrid (or two-hybrid) test represents a method of choice for a first step in the selection of such interaction peptides.
- SHPT SHPs developed against the Tat protein
- SHPR Rev protein
- Random peptide bank 1- Construction pGAD-CR:
- This plasmid is a derivative of pGAD424 (Clontech). This vector was digested by
- the fragment containing the linker regions, the cloning sites of the random sequence fragment and the basic Tat domain was obtained by hybridization of the following oligonucleotides: 5 'pAATTG ⁇ GTGGTGGCGGATCCGGTTTGCCCGGGAGAAAGAAGCGTAGACAAAGAAGACGTGGTTA CCCACCACCGCCTAGGCCAAACGGGCCCTCTTTCTTCGCATCTGTTTCTTCTGCACCAATTCTAGp5' (p means phosphate).
- This fragment was inserted between the Ecorl and Bglll sites of pGAD424
- the digestion product was mixed with paramagnetic streptavidin beads to remove the biotinylated ends.
- the BamHI-Xmal fragment contained in the supernatant was inserted between the sites
- the ligation products were transformed into the E.coli XL1-blue strain and striated on LB agar plates containing Pampicillin. 2.10 6 independent colonies were recovered and cultured for 1 hour in LB medium containing ampicillin. The plasmids are then extracted and purified according to the standard PEG procedure.
- Vector pLex9 This vector is a derivative of pGBT9 (Clontech). The DNA binding domain of
- GAL4 has been replaced by that of LexA (Farjot et al., 1999).
- the double hybrid screens with either pLexTat, pLexRev or pLex-NES as bait and pGAD-CR-P as prey were carried out in the HF7c strain of S. cerevisiae as already described (Rousset et al, Oncogene, 1998, 16, 643 -654).
- the colonies were cultivated on a minimal medium, devoid of histidine, and were analyzed for the expression of ⁇ -galactosidase, by the assay on filter. previously described (Rousset et al, Oncogene, 1998, 16, 643-654). Plasmids pGAD-CR-P from positive colonies are recovered and the heptapeptide motif sequenced.
- constructs are derivatives of the plasmid pSG-FNV (Desbois et al., 1996).
- the region containing the heptapeptide was amplified from the pGAD-CR-P constructs using the following oligonucleotides: 5'- TGAAGGTCGACCACCAAACCCAAAAAAAGAG -3 '(OligO 5')
- the PCR fragment was digested with SalI and Bglll and inserted between the Xhol and Bglll sites of the vector pSG-FNV, thus giving the plasmid pSG-FNV-P.
- This vector is a derivative of pSG5 (Green et al., 1988) expressing in mammalian cells the LexA-Rev fusion (Farjot et al., 1999).
- the sequence coding for Tat was introduced downstream from that of LexA in pSG-LexA.
- This plasmid has the SEAP sequence under the control of five binding sites for LexA (Farjot et al., 1999).
- the SUMO-1 sequence was amplified from a cDNA (IMAGE clone obtained from
- HGMP - UK by the following oligos: 5'- GGGTCGACGTCCATATGTCTGACCAGGAGG -3 '5'- AAAAGATCTCTAAACTGTTGAATGACC -3'
- This construction allows the insertion of heptapeptides in fusion with SUMO-1 by suppressing the digiycin motif.
- the SUMO-1 sequence was amplified with the following oligonucleotides:
- the amplified fragment was digested with SalI and Bglll and inserted between the Xhol and Bglll sites of the vector pTL1.
- the sequence containing the heptapeptide and the basic domain of Tat was amplified as described in II. A., digested with Sali and Bglll and inserted between the Xhol and Bglll sites of the vector pTL1-SUMO-CP.
- the Ubiquitin sequence was amplified from a cDNA (IMAGE clone obtained from HGMP - UK) with the following oligonucleotides: 5'- CTAAGAATTCAAAATGCAAATCTTCGTGAAAACC -3 '
- the amplified fragment was digested with EcoRI and Bglll and inserted between the EcoRI and Bglll sites of pTL.1.
- the plasmids pTL1-SUMO-P were digested with Hindlll and Bglll.
- the fragment containing the SUMO-1 sequence in fusion with the heptapeptide / basic Tat domain part was inserted between the Hindlll and Bglll sites of the vector pFLAGMac (IBI FLAG® Biosystems).
- the plasmids pTL1-Ub-P were digested with EcoRI and Bgl11.
- the fragment containing the Ub sequence in fusion with the peptide / basic domain part of Tat was inserted between the EcoRI and Bglll sites of the vector pFLAG-2 (IBI FLAG® Biosystems).
- the HeLa and COS7 cells are cultured in DMEM medium supplemented with 5% fetal calf serum in an atmosphere humidified with 5% CO 2 .
- the transfections were carried out by the calcium / phosphate co-precipitation method.
- the transfection is carried out in 6-well plates seeded with 80,000 HeLa cells.
- the DNA mixture contains 125 ng of the SEAP reporter construct, 25 ng of the expression vectors Tat or Rev in fusion with LexA, with a quantity defined as optimal of plasmid expressing the prey, namely 250 ng for the motifs selected against Tat and 25 ng for the patterns selected against Rev, with the exception of clones 142 and 190 (50ng).
- the SEAP activity is measured using the “SEAP Reporter Gene Assay Chemiluminescent” kit (Roche) according to the manufacturer's instructions.
- the Tat functional test is carried out by transfection of 300,000 HeLa cells into 60 mm petri dishes with the LTR HIV-CAT reporter construct (50ng), pSG-Tat (2ng) and the expression vector of SUMO-1 or an interaction peptide (0.5 and 2 ⁇ g).
- the Rev functional test is carried out in a similar manner by transfecting the reporter plasmid pDM128 (50ng), pSG-Rev (5ng) and the expression vector of SUMO-1 or of an interaction peptide (0.5 and 2 ⁇ g) .
- CAT activity is measured using the CAT ELISA kit (Roche).
- PBMC Human mononuclear blood cells
- monocytes are isolated from the blood of healthy HIV negative donors by density gradient centrifugation using Ficoll-Hypaque (Eurobio).
- Human mononuclear blood cells (PBMC) are activated for 3 days with 1 ⁇ g of phytohemagglutinin-P (PHA-P, Difco Laboratories) and 5 lU / ml of human recombinant interleukin-2 (rhlL-2; Roche products).
- PHA-P phytohemagglutinin-P
- rhlL-2 human recombinant interleukin-2
- PBMC human mononuclear blood cells
- medium A RPMI 1640 cell culture medium; Invitrogen, 10% fetal calf serum (FCS, Bio West) inactivated by heat (+ 56 ° C. for 45 minutes), and 1% tri-antibiotic mixture (penicillin, streptomycin and neomycin; PSN, Invitrogen)
- the cells are maintained at 37 ° C. in a humidified atmosphere, with 5% of CO 2 .
- Macrophages derived from monocytes (“monocyte-derived macrophages” MDM) are differentiated from monocytes at 7 days by adhesion. On day 3, 300,000 cells are dispersed per well in 48-well plates in 1 ml of culture medium. The differentiation of monocytes and the culture of MDMs are carried out in cell culture medium A ': DMEM glutamax TM supplemented with 10% of heat-inactivated FCS and the tri-antibiotic mixture PSN 1X at 37 ° C. in an atmosphere of 5 % of C0 2 , humidified.
- the vectors described in section VI are used to transform E.coli BL21-CodonPlus TM -RP (Stratagene) cells which have been cultured in 2L of LB medium until reaching an optical density of 0.9. After 30 minutes at 18 ° C, 0.1 mM IPTG is added to the cultures which are continued overnight at 18 ° C.
- the bacteria are sonicated in a lysis buffer: 200 mM NaCI, 0.1 M Tris-HCl, pH 7.4, 10 mM MgCI2 which is supplemented with Roche's "complete" antiprotease (Roche complete antiprotease), 0 , 5mg / mL of lysosyme and 20u / mL of Benzonase (Sigma).
- the supernatant is loaded onto a 5mL column of Heparin HyperD (Biosepra). Elution is carried out with the DE 600 buffer (600mM KCI, 20mM Hepes, pH7.9, 10 ⁇ M ZnCI 2 , 1.5mM MgCI 2 , 1mM EDTA and 1mM DTT). The elution product is fractionated by a column of Hiload 16/60 Superdex 200 filtration gel (Amersham Pharmacia Biotech).
- the immunofluorescence tests are carried out with a primary anti-FLAG antibody at a dilution of 1: 500 incubated for 2 hours and a secondary antibody coupled to the fluorophore Alexa Fluor 488 (Molecular Probes) diluted to 1: 1000, incubated for one hour.
- PBMC cells are infected with the reference lymphotropic strain HIV-1-LAI (Barre-Sinoussi et al, Science, 1983, 220, 868-871), and MDM cells with the reference strain having a tropism for HIV macrophages -1 / Ba-L (Gartner et al, Science, 1086, 233, 215-219).
- HIV-1-LAI Barre-Sinoussi et al, Science, 1983, 220, 868-871
- MDM cells with the reference strain having a tropism for HIV macrophages -1 / Ba-L (Gartner et al, Science, 1086, 233, 215-219).
- These viruses are amplified in vitro with umbilical blood mononuclear cells UBMC activated with PHA-P. The cell-free supernatant is centrifuged at 360,000 xg for 10 minutes to remove soluble factors, and the pellet is re-suspended in cell culture medium.
- Virus stocks are titrated using PHMC-P activated PBMC cells and the 50% tissue infection doses in culture (50% Tissue Culture Infectious Doses TCID50) are calculated using the formula of Kârber.
- PBMC cells are pretreated for 30 minutes with 5 concentrations of each molecule and infected with 75 TCID50 of the HIV-1-LAI strain.
- AZT 1.6, 8, 40, 200 and 1 OOOnM
- indinavir 1.6, 8, 40, 200 and 1 OOOnM
- SHPR-8, -15, -190 and SHPT-142 are tested at concentrations of 31, 62.5, 125, 250, 500, 1000 and 2000 nM.
- the molecules of which maintained throughout the culture, and the cell supernatant is harvested 7 days after infection and stored at -20 ° C. in order to measure the viral replication by assaying the reverse transcription activity (“reverse transcriptase »RT).
- PBMC cells are observed microscopically on the seventh day in order to detect possible drug-induced cytotoxicity.
- the MDM cells are pretreated for 30 minutes in 5 concentrations of the different molecules and infected with 30,000 TCID50 of the HIV-1 / Ba-L strain.
- AZT 0.8, 4, 20, 100 and 500 nM
- indinavir 0.8, 4, 20, 100 and 500 nM
- the interaction peptides SHPR-8, -15, -190 and SHPT-142 are tested at concentrations of 62.5, 125, 250, 500, 1000 and 2000 nM.
- the molecules are maintained for 7 days after infection, and the cell supernatant is harvested 7, 14 and 21 days after infection and stored at -20 ° C in order to measure viral replication by assaying the transcription activity reverse (RT reverse transcriptase).
- MDM cells are observed at the microscopic level on days 7, 14 and 21 in order to detect a possible drug-induced cytotoxicity.
- HIV replication is analyzed by assaying RT activity in cell culture supernatants using the RetroSys RT kit (Innovagen).
- the search for interaction peptides against the regulatory proteins Tat and Rev was carried out initially by a two-hybrid screening in yeast.
- the baits contain the LexA sequence in fusion with the entire Tat, Rev or NES sequence of rev ( Figure 7A).
- the prey comprises 3 different parts: the GAL4 activation domain, a random sequence of 7 amino acids and the Tat transduction domain ( Figure 7B).
- the prey expression vector library was constructed by cloning DNA fragments prepared from synthetic oligonucleotides including a series of 21 degenerate positions. This bank was used in 3 different screens with either LexTat, LexRev or LexNES as bait (See Table 1a).
- Table 1b ⁇ -galactosidase test for the clones obtained from the screening carried out with Lex-Tat as bait:
- Table 1c ⁇ -galactosidase test for the clones obtained from the screening carried out with Lex-Rev as bait:
- Table 1d ⁇ -galactosidase test for the clones obtained from the screening carried out with Lex-NES as bait:
- the effect of the 4 SHPTs on the transactivation of the HIV-1 promoter by Tat is evaluated by transient expression experiments in HeLA cells. At low concentrations, the various SHPTs do not reduce the transactivation of Tat; at higher concentrations, a slight reduction in trans-activation is observed, in particular with SHPT-8 (see FIG. 9A). These data show that the selected SHPTs are not very good inhibitors of Tat function.
- the activity of SHPR was evaluated using the reporter construct pDM128 which includes the CAT coding sequence as well as an RRE motif in an intron. The expression of Rev stimulates the expression of CAT by allowing the export of the non-spliced messenger to the cytoplasm.
- peripheral blood mononuclear cell peripheral blood mononuclear cell
- PBMCs are cultured in a medium supplemented with 2 ⁇ M of SHPR-190. At different times, an aliquot of the supernatant is removed and the cells are collected. After several washes, the cells are lysed in RIPA buffer and the supernatant as well as what is extracted are analyzed by immunoblot using an antibody directed against the FLAG epitope, an epitope present at the N-terminal end of the SHPs produced in bacteria. Both for the resting lymphocytes (FIG. 11A) and those activated (FIG. 11B), it is observed that SHPR-190 is stable in the culture medium and that a fraction of the protein is present inside the cell ( Figure 11).
- a lymphocyte is a sphere of 12 ⁇ in diameter
- the quantification experiments which have been carried out with antibodies labeled with a fluorophore have shown that an external concentration of 2 ⁇ M leads to an intracellular concentration of 15 ⁇ M. This indicates that SHPs are likely to be concentrated inside the cell.
- immunofluorescence analyzes were also carried out.
- Jurkat cells were incubated with 1 ⁇ M SHP for 4 hours and after two washes, the cells were cultured for 24 hours.
- the immunofluorescence analysis using an antibody against FLAG shows a clear fluorescence present diffusely throughout the cell interior for the 4 SHPs tested (FIG. 11C), whereas this is not the case for the control cells.
- lymphocytes can be cultured with purified SHPs and that these latter molecules can actually enter cells.
- HIV-1 replication is reduced by SHPR-142 to 2 ⁇ M (73 ⁇ 6%, see table 2a), and by SHPR-190 to 1 and 2 ⁇ M (80 ⁇ 7% and 100% respectively, see table 2a), La comparison of the effective doses at 50% confirm that SHPR-190 is more active than SHPR-142 (see Table 2b).
- Table 2a anti-HIV effects of AZT, indinavir IDV and of SHPR-15, SHPT-8, SHPR-142 and SHPR-190 in PBMC infected with HIV-1 LAI. Percentage inhibition.
- Table 2b anti-HIV effects of AZT, indinavir IDV and SHPR-142 and SHPR-190 in PBMC infected with HIV-1 LAI: 50, 70 and 90% of the effective doses. The results are expressed in nM.
- the reference strain HIV-1 / Ba-L replicates effectively in MDM (Monocytes derived macrophages).
- the reverse transcription activity in the culture supernatant is detected from the 7 th day post-infection (pi) and is maximum between 14 and 21 days pi.
- the replication of HIV-1 / Ba-L is reduced in a dose-dependent manner by AZT and indinavir (FIG. 12B and Table 3a).
- SHPR-15 shows very low activity.
- SHPT-142 also has a weak inhibition of HIV replication (44 ⁇ 10% for 2 ⁇ M on day 14, and no effect at 1 ⁇ M, table 3a).
- Table 3a anti-HIV effects of AZT, indinavir IDV and of SHPT-8 and SHPR-190 in MDM infected with HIV-1 / Ba-L. Percentage inhibition.
- SHPT SHPT-8 P e Thr Met Arg Gly Val Asp SHPT-9 # Thr Arg Arg Island Glu Met Pro Gly Arg Asp Ile Pro Gly Val Asp Gly Ser Ile Leu Arg Gly Cys Trp Asp SHPT-10- Gly Ala Val Asp Lys Ser His SHPT-24 Ser Arg Val Asp Arg Lys Asp # This clone results from the insertion of several heptapeptide sequences.
- SHPR SHPR-15 Met Cys Val Asp Leu Leu Leu SHPR-31 Arg Gin Val Gly Met Leu Tyr SHPR-115 Leu Ala Pro Arg Asn Leu Leu SHPR-142 * Phe Trp Phe Cys Gly Leu Lys SHPR-190 * Asn Trp Leu Cys Cys Leu Asn *: these two heptapeptides are those having an inhibitory power on the function of the Rev protein.
- Example 4 Mutations in SHPR-142 and SHPR-190
- Mutational analyzes were carried out to better determine the mechanism of action of SHPs directed against Rev and the importance of the residues at each position in SHPR-142 and -190.
- Rev protein causes the export to the cytoplasm of mRNA HIV-1 by binding to a particular RNA sequence: the RRE.
- the inventors have therefore clarified the question of whether the binding of Rev inhibitory SHPRs interferes with this Rev / RRE association.
- delay gel experiments were carried out with a RNA molecule corresponding to the RRE element as a probe.
- the Rev protein produced in bacteria binds to this RNA and induces a migration delay in non-denaturing polyacrylamide gel.
- the addition of the proteins SHPR190 and 142 does not inhibit this association, but induces a greater delay indicating that the SHPR-Rev complex is still capable of binding to the RRE.
- the addition of a control protein like SHPT8 has no particular effect.
- Table 4 The expression vectors in mammalian cells of SHPR142 (column 2) and SHPR190 (column 3) were mutated at each of the positions of the heptapeptide (changed to alanine) and by deletion of the amino acids coding for GAL4. These vectors were transfected with the reporter plasmid pDM128 and the expression vector Rev as described in the preceding sections (and in Roisin et al. JBC (2004) 279: 9208.) The amount of CAT protein is expressed in% of that corresponding to the transfection of the parental SHPR. A value greater than 100 therefore indicates a negative effect on the inhibitory power of SHPR and a lower value an increase in this inhibitory property. Table 5
- Table 5 The SHPR expression vector was modified by deletion of the amino acids coding for GAL4 and at positions 1 or 4 of the heptapeptide. These expression vectors were tested as described in the legend in Table 4. These results show that the sequence coding for the amino acids of GAL4 plays a negative role. For sequence 142, the modification of the first five residues has a negative effect, that of amino acids 6 and 7 increases the activity, especially for position 7 (Table 4). For heptapeptide 190 it appears that the substitution of amino acid 1 fairly significantly increases the activity, likewise to a lesser degree than that of positions 3, 4 and 7 (Table 4). In addition, the mutation of position 1 or position 4 further increases the effect of eliminating the GAL4 sequences (Table 5).
- the basic tat domain used for SHPR 142 and 190 has either been truncated in order to delete most of it, or else replaced by a polyarginine motif. In both cases, it has been shown that the intracellular capacity of the polypeptide to interact with its Rev target is conserved.
- a polypeptide according to the invention is identified for its ability to interact with a given target, it is then possible to vary the transduction domain to optimize its properties (transduction efficiency, safety, non-immunogenicity,. ..) without modifying the heptapeptide, while being assured that the polypeptide thus obtained is always capable of interacting with the given target.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Virology (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- AIDS & HIV (AREA)
- Tropical Medicine & Parasitology (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Analytical Chemistry (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Physics & Mathematics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Microbiology (AREA)
- Communicable Diseases (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
Abstract
Description
Claims
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR0311463A FR2860237B1 (fr) | 2003-09-30 | 2003-09-30 | Polypeptide d'interaction comprenant un motif heptapeptidique et un domaine de penetration cellulaire |
| PCT/FR2004/002479 WO2005033147A1 (fr) | 2003-09-30 | 2004-09-30 | Polypeptide d’interaction comprenant un motif heptapeptidique et un domaine de penetration cellulaire |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1668037A1 true EP1668037A1 (fr) | 2006-06-14 |
Family
ID=34307296
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP04787492A Withdrawn EP1668037A1 (fr) | 2003-09-30 | 2004-09-30 | Polypeptide d'interaction comprenant un motif heptapeptidique et un domaine de penetration cellulaire |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US7709606B2 (fr) |
| EP (1) | EP1668037A1 (fr) |
| JP (1) | JP4927546B2 (fr) |
| CA (1) | CA2540520A1 (fr) |
| FR (1) | FR2860237B1 (fr) |
| WO (1) | WO2005033147A1 (fr) |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8168181B2 (en) | 2006-02-13 | 2012-05-01 | Alethia Biotherapeutics, Inc. | Methods of impairing osteoclast differentiation using antibodies that bind siglec-15 |
| CA2822302A1 (fr) | 2006-02-13 | 2007-08-23 | Alethia Biotherapeutics Inc. | Procedes pour alterer la differenciation osteoclaste |
| AU2011230619C1 (en) | 2010-03-25 | 2016-06-23 | Oregon Health & Science University | CMV glycoproteins and recombinant vectors |
| HUE037408T2 (hu) | 2011-06-10 | 2018-08-28 | Univ Oregon Health & Science | CMV glikoproteinek és rekombináns vektorok |
| HK1210192A1 (en) | 2012-07-19 | 2016-04-15 | Alethia Biotherapeutics Inc. | Anti-siglec-15 antibodies |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1996023899A1 (fr) * | 1995-02-01 | 1996-08-08 | University Of Massachusetts Medical Center | Procedes de selection d'un peptide aleatoire se liant a une proteine cible |
| WO1996028189A1 (fr) * | 1995-03-06 | 1996-09-19 | Baylor College Of Medicine | Gene de fusion transdominant double et proteine |
| US6420518B1 (en) * | 1997-04-04 | 2002-07-16 | Genetech, Inc. | Insulin-like growth factor agonist molecules |
| US6747135B1 (en) * | 1998-10-16 | 2004-06-08 | The Board Of Trustees For The Leland Stanford Junior University | Fluorescent dye binding peptides |
| CA2296792A1 (fr) * | 1999-02-26 | 2000-08-26 | Genset S.A. | Sequences marqueurs exprimees et proteines humaines codees |
| WO2001048014A1 (fr) * | 1999-12-27 | 2001-07-05 | Shionogi & Co., Ltd | Polypeptides bh4-fusionnes |
| WO2002034291A2 (fr) * | 2000-10-26 | 2002-05-02 | The Brigham And Women's Hospital, Inc. | Compositions et procedes servant a traiter des malignites hematologiques et la resistance a des medicaments multiples |
| WO2003035697A1 (fr) * | 2001-09-27 | 2003-05-01 | Lg Household & Health Care Ltd. | Peptide de fusion comportant un peptide derive de la parathormone humaine et un peptide tat, sa preparation, et composition amincissante le comprenant |
| US20050108791A1 (en) * | 2001-12-04 | 2005-05-19 | Edgerton Michael D. | Transgenic plants with improved phenotypes |
-
2003
- 2003-09-30 FR FR0311463A patent/FR2860237B1/fr not_active Expired - Fee Related
-
2004
- 2004-09-30 WO PCT/FR2004/002479 patent/WO2005033147A1/fr not_active Ceased
- 2004-09-30 JP JP2006530409A patent/JP4927546B2/ja not_active Expired - Fee Related
- 2004-09-30 CA CA002540520A patent/CA2540520A1/fr not_active Abandoned
- 2004-09-30 EP EP04787492A patent/EP1668037A1/fr not_active Withdrawn
-
2006
- 2006-03-30 US US11/396,196 patent/US7709606B2/en not_active Expired - Fee Related
Non-Patent Citations (4)
| Title |
|---|
| CRAWFORD MARGARET ET AL: "Peptide aptamers: tools for biology and drug discovery.", BRIEFINGS IN FUNCTIONAL GENOMICS & PROTEOMICS APR 2003 LNKD- PUBMED:15243998, vol. 2, no. 1, April 2003 (2003-04-01), pages 72 - 79, XP007920560, ISSN: 1473-9550 * |
| HOPPE-SEYLER F ET AL: "Peptide aptamers: Powerful new tools for molecular medicine", JOURNAL OF MOLECULAR MEDICINE, SPRINGER VERLAG, DE, vol. 78, no. 8, 1 January 2000 (2000-01-01), pages 426 - 430, XP002413234, ISSN: 0946-2716, DOI: 10.1007/S001090000140 * |
| See also references of WO2005033147A1 * |
| YUAN K ET AL: "Suppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, ACADEMIC PRESS INC. ORLANDO, FL, US, vol. 319, no. 3, 2 July 2004 (2004-07-02), pages 746 - 752, XP004512502, ISSN: 0006-291X, DOI: 10.1016/J.BBRC.2004.05.046 * |
Also Published As
| Publication number | Publication date |
|---|---|
| FR2860237B1 (fr) | 2006-03-10 |
| US7709606B2 (en) | 2010-05-04 |
| JP4927546B2 (ja) | 2012-05-09 |
| WO2005033147A1 (fr) | 2005-04-14 |
| CA2540520A1 (fr) | 2005-04-14 |
| FR2860237A1 (fr) | 2005-04-01 |
| JP2008500267A (ja) | 2008-01-10 |
| US20060240516A1 (en) | 2006-10-26 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Luban et al. | Human immunodeficiency virus type 1 Gag protein binds to cyclophilins A and B | |
| EP0797589B1 (fr) | Peptides utilisables comme vecteurs pour l'adressage intracellulaire de molecules actives | |
| Ghanam et al. | Role of the HIV-1 matrix protein in Gag intracellular trafficking and targeting to the plasma membrane for virus assembly | |
| US8197821B2 (en) | Human immunodeficiency virus integrase—Transportin—SR protein—protein interactions | |
| EP1497467A2 (fr) | Oligonucleotide issus des sequences codant pour la composante de surface des proteines d enveloppe des ptlv et leurs utilisat ions | |
| EP2563399B1 (fr) | Utilisation de peptides comme transporteurs destines a l'internalisation de molecules d'interet dans des cellules cibles | |
| FR2780069A1 (fr) | Famille de sequences nucleiques et de sequences proteiques deduites presentant des motifs retroviraux endogenes humains et leurs applications | |
| EP1668037A1 (fr) | Polypeptide d'interaction comprenant un motif heptapeptidique et un domaine de penetration cellulaire | |
| FR2774378A1 (fr) | PROTEINE HUMAINE BETA-TrCP DE CIBLAGE DES PROTEINES VERS LES VOIES DE DEGRADATION PAR LE PROTEASOME | |
| WO2004011595A2 (fr) | Vecteurs destines au transfert de molecules d'interet dans des cellules cibles | |
| FR2819809A1 (fr) | Peptides presentant un affinite pour la proteine virale gp120, et utilisation de ces peptides | |
| WO2006082303A1 (fr) | Motif de la proteine beclin interagissant avec les membres anti-apoptotiques de la famille de proteines bcl-2 et utilisations | |
| JPH09501143A (ja) | 治療用化合物 | |
| KR20220161041A (ko) | 세포투과성 펩티드 및 이의 용도 | |
| WO2012076822A1 (fr) | Peptides et medicament antiviral | |
| Shamsabadi | HIV-1 Nef-mediated evasion of host immunity: from structural studies to inhibitor screening: a dissertation in Biomedical Engineering and Biotechnology | |
| WO2007066018A2 (fr) | Peptides qui peuvent se lier a la proteine nef et leurs applications pharmaceutiques | |
| Wang | Structures and interactions of primate lentiviral accessory proteins Vpr, Vpx and p6 in the presence of DPC micelles | |
| Amado | Optimization of the preparation of the HIV-1 Vpu, CD4, β-TrCP and Skp1 complex for structural studies: a thesis in Chemistry | |
| Saint-Amand | Elucidating the mechanism of HIV-1 Vpu-mediated polyubiquitination and proteasomal degradation of newly synthesized CD4: a thesis in Chemistry | |
| Kwon | Use structural biology to elucidate the mechanisms of HIV-1 nef functions in downregulations of host proteins and modulation of autophagy: a dissertation in Chemistry | |
| Tien et al. | Understanding regulation of HIV-1 protease precursor autoprocessing | |
| Milev et al. | Research Live cell visualization of the interactions between HIV-1 Gag and the cellular RNA-binding protein Staufen1 | |
| Lluesma | hMad1 in the spindle assembly checkpoint: characterization of interacting partners | |
| WO2010092185A2 (fr) | Inhibiteurs de l'intération scramblase/cd4 pour le traitement d'infections à lentivirus |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20060324 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PL PT RO SE SI SK TR |
|
| 17Q | First examination report despatched |
Effective date: 20060724 |
|
| DAX | Request for extension of the european patent (deleted) | ||
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: ROISIN, ARMELLE Inventor name: JALINOT, PIERRE Inventor name: ROBIN, JEAN-PHILIPPE |
|
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: ECOLE NORMALE SUPERIEURE DE LYON Owner name: CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE (CNRS |
|
| GRAP | Despatch of communication of intention to grant a patent |
Free format text: ORIGINAL CODE: EPIDOSNIGR1 |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: G01N 33/569 20060101AFI20140326BHEP |
|
| INTG | Intention to grant announced |
Effective date: 20140425 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20140906 |