EP1476554A1 - Nouveau compose pour l'inhibition de serine-proteinases et pour l'inhibition d'infections virales ou de propagation virale : rld 8564 - Google Patents
Nouveau compose pour l'inhibition de serine-proteinases et pour l'inhibition d'infections virales ou de propagation virale : rld 8564Info
- Publication number
- EP1476554A1 EP1476554A1 EP03742557A EP03742557A EP1476554A1 EP 1476554 A1 EP1476554 A1 EP 1476554A1 EP 03742557 A EP03742557 A EP 03742557A EP 03742557 A EP03742557 A EP 03742557A EP 1476554 A1 EP1476554 A1 EP 1476554A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- peptide
- rld
- fragments
- analogs
- derivatives
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/81—Protease inhibitors
- C07K14/8107—Endopeptidase (E.C. 3.4.21-99) inhibitors
- C07K14/811—Serine protease (E.C. 3.4.21) inhibitors
- C07K14/8135—Kazal type inhibitors, e.g. pancreatic secretory inhibitor, ovomucoid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates to a polypeptide (protein) with serine proteinase-inhibitory, in particular plasmin and elastase-inhibitory properties and inhibitory properties against viruses: RLD 8564 (recombinant 15th LEKTI domain).
- the invention further comprises fragments and / or derivatives derived from the RLD 8564 and the combination of these peptide active ingredients.
- a drug containing the natural, recombinant and synthetic peptides for use in medical indications and for use as a diagnostic agent.
- RLD 8564 the 15th domain of the serine proteinase inhibitor LEKTI, was heterologously expressed and purified in E. coli using conventional RT-PCR and standard cloning methods.
- the recombinant peptide obtained has the following amino acid sequence in the one-letter code:
- RLD 8564 consists of 78 amino acids and has a molecular mass of 8564 Da.
- the six cysteines are preferably bridged according to the Kazal type (1-5, 2-4, 3-6) known for inhibitors.
- Serine proteinase inhibitors have been extensively described in their structure at the protein and DNA sequence level and in their biological function (for a review see: Roberts, RM et al. (1995), Crit. Rev. Eukaryot. Gene Expr., 5 ( 3-4): 385-436). Fragments, analogs and / or derivatives of RLD 8564 are substances with biological properties comparable to those of RLD 8564, which can be structurally derived from the sequence of RLD 8564. Derived structures are, in particular, those that
- N-terminal are shortened by 1, 2 or 3 amino acids
- C-terminal are shortened by 1, 2 or 3 amino acids
- Derived peptides can also exhibit several of these changes.
- Comparable properties mean at least 50% of the inhibition properties on plasmin and elastase according to the test methods described here, ie at most twice the IC 50 value.
- the IC 50 (inhibitory concentration 50%) was 9xl0 "7 M.
- the data generated in this way show (FIGS. 1 and 2) that the peptide RLD 8564, which corresponds to the 15th LEKTI domain, is not only capable of the serine proteinase trypsin (Magert, HJ. Et al, (2002) Int. J. Biochem. Cell Biol, 34 (6), 573-576), but surprisingly also inhibit human plasmin and human leukocyte elastase. RLD 8564 can therefore protect against the proteolytic activity of these enzymes.
- Plasmin is a serine proteinase that plays an important role in inflammatory processes, but especially in fibrinolysis.
- regulation of the proteolytic activity of plasmin by inhibitors is of great physiological importance. This regulation has clinical relevance, for example, in the case of transplants, burns, disorders of the blood coagulation system (fibrinolysis) or liver diseases.
- Elastase has a crucial role in the controlled breakdown of functionally damaged connective tissue (JANOFF, 1985) and thus has important biological functions. Their proteolytic activity must be carefully controlled, as otherwise the enzyme may have pathological attacks on structural proteins in its own organism. An example of a pathological effect that develops due to a disturbance in the balance between proteinase (leukocyte elastase) and its specific inhibitor is pulmonary emphysema. Proteinases can also be released from invaded microorganisms. All these enzymes are able to proteolytically decompose tissues and proteins of the organism and thus also represent an objective danger for the individual concerned. For this reason, a targeted control of the proteinases is necessary.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
L'invention concerne le peptide RLD 8564 ayant la séquence aminoacide suivante : GPDSEMCKDYRVLPRIGYLCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRSTGKCEESSTPGTTAASMPPSDE.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP03742557A EP1476554A1 (fr) | 2002-02-22 | 2003-02-20 | Nouveau compose pour l'inhibition de serine-proteinases et pour l'inhibition d'infections virales ou de propagation virale : rld 8564 |
Applications Claiming Priority (12)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE10207602 | 2002-02-22 | ||
DE10207602 | 2002-02-22 | ||
DE10208302 | 2002-02-26 | ||
DE10208302 | 2002-02-26 | ||
DE10209307 | 2002-03-02 | ||
DE10209307 | 2002-03-02 | ||
DE10220802 | 2002-05-10 | ||
DE10220802 | 2002-05-10 | ||
EP02015418 | 2002-07-11 | ||
EP02015418 | 2002-07-11 | ||
PCT/EP2003/001704 WO2003070953A1 (fr) | 2002-02-22 | 2003-02-20 | Nouveau compose pour l'inhibition de serine-proteinases et pour l'inhibition d'infections virales ou de propagation virale : rld 8564 |
EP03742557A EP1476554A1 (fr) | 2002-02-22 | 2003-02-20 | Nouveau compose pour l'inhibition de serine-proteinases et pour l'inhibition d'infections virales ou de propagation virale : rld 8564 |
Publications (1)
Publication Number | Publication Date |
---|---|
EP1476554A1 true EP1476554A1 (fr) | 2004-11-17 |
Family
ID=27761588
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP03742557A Withdrawn EP1476554A1 (fr) | 2002-02-22 | 2003-02-20 | Nouveau compose pour l'inhibition de serine-proteinases et pour l'inhibition d'infections virales ou de propagation virale : rld 8564 |
Country Status (3)
Country | Link |
---|---|
EP (1) | EP1476554A1 (fr) |
AU (1) | AU2003210317A1 (fr) |
WO (1) | WO2003070953A1 (fr) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE102009010942A1 (de) | 2009-02-27 | 2010-09-02 | Universitätsklinikum Schleswig-Holstein | Serinprotease-Inhibitoren zur spezifischen Inhibition von Gewebs-Kallikreinen |
CA3179244A1 (fr) | 2020-03-31 | 2021-10-07 | Pharis Biotec Gmbh | Polypeptide pour la prophylaxie et le traitement d'infections virales |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6939851B1 (en) * | 1999-06-22 | 2005-09-06 | Pharis Biotec Gmbh | Serine proteinase inhibitors |
EP1294768A1 (fr) * | 2000-03-02 | 2003-03-26 | Isis Innovation Limited | Mutations dans spink5 responsables du syndrome de netherton et de maladies atopiques |
WO2002066513A2 (fr) * | 2001-02-19 | 2002-08-29 | Ipf Pharmaceuticals Gmbh | Fragments humains de lekti circulants hf7072, hf7638 et hf14448 ainsi que leur utilisation |
-
2003
- 2003-02-20 EP EP03742557A patent/EP1476554A1/fr not_active Withdrawn
- 2003-02-20 AU AU2003210317A patent/AU2003210317A1/en not_active Abandoned
- 2003-02-20 WO PCT/EP2003/001704 patent/WO2003070953A1/fr not_active Application Discontinuation
Non-Patent Citations (1)
Title |
---|
See references of WO03070953A1 * |
Also Published As
Publication number | Publication date |
---|---|
WO2003070953A1 (fr) | 2003-08-28 |
AU2003210317A1 (en) | 2003-09-09 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
DE3785615T2 (de) | Hemmungsstoffe der serin-protease. | |
EP0209061B1 (fr) | Peptides à activité anticoagulante, leur procédé de préparation, d'obtention, leur application et les agents les contenant | |
CN101297033B (zh) | 由菠萝蛋白酶获得的清创组合物及其制备方法 | |
EP0134479B1 (fr) | Inhibiteurs de la protéinase modifiés, procédés pour leur préparation et compositions pharmaceutiques les contenant | |
US5612194A (en) | Methods of producing effective recombinant serine protease inhibitors and uses of these inhibitors | |
DE69633623T2 (de) | Cystein-Protease-Inhibitoren für die Behandlung von allergischen Krankheiten verursacht duch IgE | |
US6057297A (en) | Inhibitor compounds of zinc-dependent metalloproteinases associated with pathological conditions, and therapeutic use thereof | |
CA2053242C (fr) | Inhibiteur de la protease | |
US5846755A (en) | Method for determining the therapeutic activity of metalloproteinase inhibitor compounds | |
WO1992020362A1 (fr) | Peptides favorisant le developpement de cellules nerveuses et leurs utilisations | |
WO1995030432A1 (fr) | Utilisation de proteoglycannes de sulfate de chondroitine pour la protection des neurones | |
EP1476554A1 (fr) | Nouveau compose pour l'inhibition de serine-proteinases et pour l'inhibition d'infections virales ou de propagation virale : rld 8564 | |
EP0677107B1 (fr) | Inhibiteur de thrombine provenant de salive de protostomiens | |
EP1040190B1 (fr) | Inhibiteurs de serine-proteinase | |
DE19737105A1 (de) | Neue gewebsspezifische Calpaine, ihre Herstellung und Verwendung | |
WO2000078963A1 (fr) | Inhibiteurs de la serine protease | |
EP0373335B1 (fr) | Protéines inhibitrices des protéases du type sérine, médicaments les contenant, séquence d'ADN codant pour ces protéines et les procédés de production de ces protéines, médicament et séquences | |
US7258856B2 (en) | Proteases from Carica having mitogenic activity and their methods of use | |
US7129334B2 (en) | Synthetic peptide and uses for same | |
DE19800363A1 (de) | Serin-Proteinase-Inhibitoren | |
JPH06321989A (ja) | 新規ポリペプチド、新規dnaおよび医薬組成物 | |
DE19718248A1 (de) | Neue Calpaine, ihre Herstellung und Verwendung | |
Ehrlich et al. | Protein C: Physiologie, Biochemie und Molekularbiologie | |
EP0983301A2 (fr) | Peptides inhibant la thrombine | |
DE4304731A1 (de) | Thrombininhibitor aus Speichel von Protostomiern |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
17P | Request for examination filed |
Effective date: 20040817 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PT SE SI SK TR |
|
AX | Request for extension of the european patent |
Extension state: AL LT LV MK RO |
|
17Q | First examination report despatched |
Effective date: 20050215 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
18D | Application deemed to be withdrawn |
Effective date: 20050628 |