EP1200611A1 - Herbizid-resistente protoporphyrinogen oxidase - Google Patents
Herbizid-resistente protoporphyrinogen oxidaseInfo
- Publication number
- EP1200611A1 EP1200611A1 EP00940419A EP00940419A EP1200611A1 EP 1200611 A1 EP1200611 A1 EP 1200611A1 EP 00940419 A EP00940419 A EP 00940419A EP 00940419 A EP00940419 A EP 00940419A EP 1200611 A1 EP1200611 A1 EP 1200611A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- amino acid
- protox
- plant
- seq
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/001—Oxidoreductases (1.) acting on the CH-CH group of donors (1.3)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8201—Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation
- C12N15/8214—Plastid transformation
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8274—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for herbicide resistance
Definitions
- the present invention relates to DNA molecules encoding herbicide-tolerant forms of the enzyme protoporphyrinogen oxidase ("protox").
- protox protoporphyrinogen oxidase
- the invention further relates to herbicide-tolerant plants as well as methods for tissue culture selection and herbicide application based on these herbicide-tolerant forms of protox.
- the present invention provides modified forms of plant protoporphyrinogen oxidase (protox) enzymes that are resistant to compounds that inhibit unmodified naturally occurring plant protox enzymes, and DNA molecules coding for such inhibitor-resistant plant protox enzymes.
- protox protoporphyrinogen oxidase
- Associated With / Operatively Linked refers to two DNA sequences that are related physically or functionally.
- a promoter or regulatory DNA sequence is said to be "associated with" a DNA sequence that codes for an RNA or a protein if the two sequences are operatively linked, or situated such that the regulator DNA sequence will affect the expression level of the coding or structural DNA sequence.
- Chimeric Gene a recombinant DNA sequence in which a promoter or regulatory DNA sequence is operatively linked to, or associated with, a DNA sequence that codes for an mRNA or which is expressed as a protein, such that the regulator DNA sequence is able to regulate transcription or expression of the associated DNA sequence.
- the regulator DNA sequence of the chimeric gene is not normally operatively linked to the associated DNA sequence as found in nature.
- Coding DNA Sequence a DNA sequence that is translated in an organism to produce a protein.
- corresponding to means that when the amino acid sequences of various protox enzymes are aligned with each other, such as in Table 1 A, the amino acids that "correspond to" certain enumerated positions in Table 1 A are those that align with these positions in Table 1 A, but that are not necessarily in these exact numerical positions relative to the particular protox enzyme's amino acid sequence.
- amino acids in the soybean protox sequence that "correspond to" certain enumerated positions of SEQ ID NO:2 are those that align with these positions of SEQ ID NO:2, but are not necessarily in these exact numerical positions of the soybean protox enzyme's amino acid sequence.
- Herbicide a chemical substance used to kill or suppress the growth of plants, plant cells, plant seeds, or plant tissues.
- Heterologous DNA Sequence a DNA sequence not naturally associated with a host cell into which it is introduced, including non-naturally occurring multiple copies of a naturally occurring DNA sequence.
- Homologous DNA Sequence a DNA sequence naturally associated with a host cell into which it is introduced.
- Homoplasmic refers to a plant, plant tissue or plant cell, wherein all of the plastids are genetically identical. In different tissues or stages of development, the plastids may take different forms, e.g., chloroplasts, proplastids, etioplasts, amyloplasts, chromoplasts, and so forth.
- Inhibitor a chemical substance that inactivates the enzymatic activity of a protein such as a biosynthetic enzyme, receptor, signal transduction protein, structural gene product, or transport protein that is essential to the growth or survival of the plant.
- an inhibitor is a chemical substance that inactivates the enzymatic activity of protox.
- the term "herbicide” is used herein to define an inhibitor when applied to plants, plant cells, plant seeds, or plant tissues.
- an isolated nucleic acid molecule or an isolated enzyme is a nucleic acid molecule or enzyme that, by the hand of man, exists apart from its native environment and is therefore not a product of nature.
- An isolated nucleic acid molecule or enzyme may exist in a purified form or may exist in a non-native environment such as, for example, a transgenic host cell.
- promoter elements particularly a TATA element, that are inactive or that have greatly reduced promoter activity in the absence of upstream activation.
- the minimal promoter functions to permit transcription.
- Modified Enzyme Activity enzyme activity different from that which naturally occurs in a plant (i.e. enzyme activity that occurs naturally in the absence of direct or indirect manipulation of such activity by man), which is tolerant to inhibitors that inhibit the naturally occurring enzyme activity.
- Nucleic Acid Molecule a linear segment of single- or double-stranded DNA or RNA that can be isolated from any source.
- the nucleic acid molecule is preferably a segment of DNA.
- Plant refers to any plant or part of a plant at any stage of development. Therein are also included cuttings, cell or tissue cultures and seeds.
- plant tissue includes, but is not limited to, whole plants, plant cells, plant organs, plant seeds, protoplasts, callus, cell cultures, and any groups of plant cells organized into structural and/or functional units.
- Plastome the genome of a plastid.
- Protox-1 chloroplast protox.
- Protox-2 mitochondrial protox.
- an increase in enzymatic activity that is larger than the margin of error inherent in the measurement technique preferably an increase by about 2-fold or greater of the activity of the wild-type enzyme in the presence of the inhibitor, more preferably an increase by about 5-fold or greater, and most preferably an increase by about 10-fold or greater.
- a nucleic acid molecule that has at least 60 percent sequence identity with a reference nucleic acid molecule.
- a substantially similar DNA sequence is at least 80% identical to a reference DNA sequence; in a more preferred embodiment, a substantially similar DNA sequence is at least 90% identical to a reference DNA sequence; and in a most preferred embodiment, a substantially similar DNA sequence is at least 95% identical to a reference DNA sequence.
- a substantially similar nucleotide sequence typically hybridizes to a reference nucleic acid molecule, or fragments thereof, under the following conditions: hybridization at 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO 4 pH 7.0, 1 mM EDTA at 50°C; wash with 2X SSC, 1% SDS, at 50°C.
- SDS sodium dodecyl sulfate
- a substantially similar amino acid sequence is an amino acid sequence that is at least 90% identical to the amino acid sequence of a reference protein or peptide and has substantially the same activity as the reference protein or peptide.
- Tolerance / Resistance the ability to continue normal growth or function when exposed to an inhibitor or herbicide. Transformation: a process for introducing heterologous DNA into a cell, tissue, or plant. Transformed cells, tissues, or plants are understood to encompass not only the end product of a transformation process, but also transgenic progeny thereof.
- Transit Peptide a signal polypeptide that is translated in conjunction with a protein encoded by a DNA molecule, forming a polypeptide precursor.
- the transit peptide can be cleaved from the remainder of the polypeptide precursor to provide an active or mature protein.
- Transformed refers to an organism such as a plant into which a heterologous DNA molecule has been introduced.
- the DNA molecule can be stably integrated into the genome of the plant, wherein the genome of the plant encompasses the nuclear genome, the plastid genome and the mitochondrial genome.
- the DNA molecule can also be present as an extrachromosomal molecule. Such an extrachromosomal molecule can be auto-replicating.
- a "non-transformed" plant refers to a wild-type organism, i.e., a plant, which does not contain the heterologous DNA molecule.
- Transplastome a transformed plastid genome. Nucleotides are indicated by their bases by the following standard abbreviations: adenine (A), cytosine (C), thymine (T), and guanine (G). Amino acids are likewise indicated by the following standard abbreviations: alanine (ala; A), arginine (Arg; R), asparagine (Asn; N) , aspartic acid (Asp; D), cysteine (Cys; C), glutamine (Gin; Q), glutamic acid (Glu; E), glycine (Gly; G), histidine (His; H), isoleucine (He; I), leucine (Leu; L), lysine (lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Tip; W), t
- the present invention discloses modified forms of plant protoporphyrinogen oxidase (protox) enzymes that are resistant to compounds that inhibit unmodified naturally occurring plant protox enzymes, and DNA molecules coding for such inhibitor-resistant plant protox enzymes.
- protox protoporphyrinogen oxidase
- the present invention discloses a DNA molecule encoding a plant protox enzyme that is capable of being incorporated into a DNA construct used to transform a plant containing wild-type, herbicide-sensitive protox, wherein the DNA molecule has at least one point mutation relative to a wild-type DNA molecule encoding plant protox such that upon transformation with the DNA construct the plant contains the DNA molecule, which renders the plant resistant to the application of a herbicide that inhibits naturally occurring plant protox.
- the present invention relates to a nucleic acid molecule comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, wherein said modified enzyme comprises at least one of the following amino acid sub-sequences:
- the invention relates to a nucleic acid molecule comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, wherein said modified enzyme comprises at least one amino acid sub-sequence selected from the group consisting of:
- nucleotide sequence that encodes said modified enzyme hybridizes to any one of the nucleotide sequences set forth in SEQ ID NO:1 , SEQ ID NO:5, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21 , SEQ ID NO:23 or SEQ ID NO:36 under the following conditions: (i) hybridization in 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50° C; and (ii) wash in 2X SSC, 1 % SDS at 50° C.
- SDS sodium dodecyl sulfate
- nucleic acid molecule comprising a nucleotide sequence that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein said modified enzyme is resistant to an inhibitor of the naturally occurring form of said enzyme, wherein said modified enzyme comprises at least one of the following amino acid sub-sequences:
- nucleic acid molecule wherein ⁇ 8 is threonine or valine.
- nucleic acid molecule wherein said modified enzyme comprises the amino acid sub-sequence Q ⁇ 9 H, wherein ⁇ 9 is an amino acid other than leucine.
- nucleic acid molecule wherein ⁇ 1 9 is serine.
- nucleic acid molecule wherein said modified enzyme comprises the amino acid sub-sequence AP ⁇ iF, wherein ⁇ 1 is leucine or cysteine.
- nucleic acid molecule wherein said modified enzyme comprises the amino acid sub-sequence ⁇ 7 IG, wherein ⁇ 7 is histidine or alanine, but especially histidine. Also preferred is a nucleic acid molecule, wherein said modified enzyme comprises the amino acid sub-sequence T ⁇ 16 G, wherein ⁇ 16 is serine, and the amino acid sub-sequence YV ⁇ 17 G, wherein ⁇ 7 is threonine.
- the invention further provides a nucleic acid molecule, wherein modified enzyme according to the invention further comprises at least one additional amino acid subsequence selected from the group consisting of:
- Preferred is a nucleic acid molecule, wherein said additional sub-sequence is Q ⁇ nS, wherein ⁇ n is an amino acid other than proline.
- nucleic acid molecule wherein ⁇ n is leucine.
- nucleic acid molecule wherein said additional sub-sequence is IGG ⁇ 12 , wherein ⁇ 12 is an amino acid other than threonine.
- nucleic acid molecule wherein ⁇ 12 is isoleucine or alanine.
- nucleic acid molecule wherein said additional sub-sequence is SWXL ⁇ 13 , wherein ⁇ 13 is an amino acid other than serine.
- nucleic acid molecule wherein ⁇ 13 is leucine.
- nucleic acid molecule wherein said additional sub-sequence is L ⁇ 1 Y, wherein ⁇ 14 is an amino acid other than asparagine.
- nucleic acid molecule wherein ⁇ M is serine.
- nucleic acid molecule wherein said additional sub-sequence is G ⁇ 15 XGL, wherein ⁇ 15 is an amino acid other than tyrosine.
- nucleic acid molecule wherein ⁇ 15 is cysteine.
- nucleic acid molecule encoding a plant protox enzyme that is capable of being incorporated into a DNA construct used to transform a plant containing wild-type, herbicide-sensitive protox, wherein the nucleic acid molecule has at least one point mutation relative to a wild-type DNA molecule encoding plant protox as mentioned hereinbefore such that upon transformation with the DNA construct the plant contains the DNA molecule, which renders the plant resistant to the application of a herbicide that inhibits naturally occurring plant protox, wherein said nucleic acid molecule can be obtained from a plant selected from the group consisting of Arabidopsis, maize, wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, and sugar cane.
- Sequences of such DNA molecules are set forth in SEQ ID NOs: 9 (wheat), 11 (soybean), 15 (cotton), 17 (sugar beet), 19 (oilseed rape), 21 (rice), 23 (sorghum), and 36 (sugar cane).
- Preferred is a nucleic acid molecule which can be obtained from maize or cotton.
- a modified enzyme having protoporphyrinogen oxidase (protox) activity wherein said modified enzyme is encoded by any of the nucleotide sequences according to the invention mentioned hereinbefore.
- the present invention further includes chimeric genes and modified forms of naturally occurring protox genes that can express the inhibitor-resistant plant protox enzymes in plants.
- the present invention relates to a chimeric gene comprising a promoter that is active in a plant operatively linked to a nucleic acid molecule according to the invention.
- the invention further includes recombinant vector molecules comprising a chimeric gene according to the invention.
- Genes encoding inhibitor-resistant plant protox enzymes can be used to confer resistance to protox-inhibitory herbicides in whole plants and as a selectable marker in plant cell transformation methods. Accordingly, the present invention also includes plants, including the descendants thereof, plant tissues and plant seeds containing plant expressible genes encoding these modified protox enzymes. These plants, plant tissues and plant seeds are resistant to protox-inhibitors at levels that normally are inhibitory to the naturally occurring protox activity in the plant.
- the invention relates to a plant cell comprising the nucleic acid molecule according to the invention.
- the invention further relates to a plant, plant tissue, plant cell, or plant seed, including the progeny thereof, comprising the nucleic acid molecule according to the invention, wherein said nucleic acid molecule is expressed in said plant, plant tissue, plant cell, or plant seed and confers tolerance thereupon to an inhibitor of naturally occurring protox activity.
- Plants encompassed by the invention especially include those that would be potential targets for protox inhibiting herbicides, particularly agronomically important crops such as maize and other cereal crops such as barley, wheat, sorghum, rye, oats, turf and forage grasses, millet and rice. Also comprised are other crop plants such as sugar cane, soybean, cotton, sugar beet, oilseed rape and tobacco.
- the present invention also relates to plastid transformation and to the expression of a nucleic acid molecule according to the invention in a plant plastid.
- a modified plant protox enzyme as described hereinbefore is expressed in plant plastids to obtain herbicide resistant plants.
- the invention relates to a chimeric gene comprising a promoter functional in a plant plastid, preferably a clpP gene promoter, operatively linked to the nucleic acid molecule according to the invention,.
- the present invention is directed to a chimeric gene comprising: (a) a DNA molecule isolated from a plant, which in its native state encodes a polypeptide that comprises a plastid transit peptide, and a mature enzyme that is natively targeted to a plastid of the plant by the plastid transit peptide, wherein the DNA molecule is modified such that it does not encode a functional plastid transit peptide; and (b) a promoter capable of expressing the DNA molecule in a plastid, wherein the promoter is operatively linked to the DNA molecule according to the invention.
- the DNA molecule may be modified in that at least a portion of the native plastid transit peptide coding sequence is absent from the DNA molecule.
- the DNA molecule may be modified in that one or more nucleotides of the native plastid transit peptide coding sequence are mutated, thereby rendering an encoded plastid transit peptide nonfunctional.
- the present invention also relates to plants homoplasmic for chloroplast genomes containing such chimeric genes.
- the DNA molecule encodes an enzyme that is naturally inhibited by a herbicidal compound. In this case, such plants are resistant to a herbicide that naturally inhibits the enzyme encoded by a DNA molecule according to the present invention.
- a further embodiment of the invention relates to a plastid transformation vector comprising some or all of the elements mentioned hereinbefore including a nucleic acid molecule according to the invention.
- a plant plastid comprising a plastid transformation vector according to the invention.
- the present invention is also directed to plants made resistant to a herbicide by transforming their plastid genome with a DNA molecule according to the present invention and to methods for obtaining such plants.
- the invention thus further relates to a plant, plant tissue, plant cell, or plant seed, including the progeny thereof, comprising a plant plastid according to the invention, wherein said modified plant protox enzyme is expressed in said plant, plant tissue, plant cell, or plant seed and confers upon said plant, plant tissue, plant cell, or plant seed tolerance to an inhibitor of naturally occurring protox activity.
- the present invention is directed further to methods for the production of plants, including plant material, such as for example plant tissues, protoplasts, cells, calli, organs, plant seeds, embryos, pollen, egg cells, zygotes, together with any other propagating material and plant parts, such as for example flowers, stems, fruits, leaves, roots originating in transgenic plants or their progeny previously transformed by means of the process of the invention, which produce an inhibitor-resistant form of the plant protox enzyme provided herein.
- plant material such as for example plant tissues, protoplasts, cells, calli, organs, plant seeds, embryos, pollen, egg cells, zygotes, together with any other propagating material and plant parts, such as for example flowers, stems, fruits, leaves, roots originating in transgenic plants or their progeny previously transformed by means of the process of the invention, which produce an inhibitor-resistant form of the plant protox enzyme provided herein.
- Such plants may be stably transformed with a structural gene encoding the resistant protox, or prepared by direct selection techniques whereby herb
- the present invention further provides a method for selecting plant cells transformed with a DNA molecule of the invention that encodes a herbicide-tolerant form of plant protox.
- the method comprises introducing the DNA molecule into plant cells whose growth is sensitive to inhibition by herbicides to which the protox encoded by the DNA molecule is resistant, thus forming a transformed plant cell.
- the transformed plant cell whose growth is resistant to the selected herbicide is identified by selection at a herbicide concentration that inhibits the growth of untransformed plant cells.
- the present invention also provides a novel method for selecting a transplastomic plant cell, comprising the steps of introducing the above-described chimeric gene into the plastome of a plant cell; expressing the encoded enzyme in the plastids of the plant cell; and selecting a cell that is resistant to a herbicidal compound that naturally inhibits the activity of the enzyme, whereby the resistant cell comprises transformed plastids.
- the enzyme is naturally inhibited by a herbicidal compound and the transgenic plant is able to grow on an amount of the herbicidal compound that naturally inhibits the activity of the enzyme.
- the present invention is directed to a method for controlling unwanted vegetation growing at a locus where a herbicide-tolerant, agronomically useful plant, which is transformed with a DNA molecule according to the present invention that encodes a herbicide-tolerant form of plant protox, has been cultivated.
- the method comprises applying to the locus to be protected an effective amount of herbicide that inhibits naturally occurring protox activity.
- the present invention is directed to a method for controlling the growth of undesired vegetation, which comprises applying to a population of the above-described plants an effective amount of an inhibitor of the enzyme.
- the invention relates to a method for controlling the growth of undesired vegetation, wherein said protox-inhibiting herbicide is selected from the group consisting of an aryluracil, a diphenylether, an oxidiazole, an imide, preferably an imide having formula V, VI, VII, Vila, VIII, IX, IXa, or Ixb, a phenyl pyrazole, preferably a phenyl pyrazole having formula XXIV, a pyridyl pyrazole, preferably a pyridyl pyrazole having formula XXIIIa or XXIIIb, a pyridine derivative, a 3-substituted-2-aryl-4,5,6,7- tetrahydroindazole, a phenopylate and O-phenylpyrrolidino- and piperidinocarbamate analogs of said phenopylate.
- said protox-inhibiting herbicide is selected from
- the invention further relates to a method for selectively suppressing the growth of weeds in a field containing a crop of planted crop seeds or plants, comprising the steps of:
- the present invention is directed to an isolated DNA molecule that encodes protoporphyrinogen oxidase (referred to herein as "protox) from sugar cane.
- protox protoporphyrinogen oxidase
- the partial DNA coding sequence and corresponding amino acid sequence for a sugar cane protox enzyme are provided as SEQ ID NOs:36 and 37, respectively.
- protopo ⁇ hyrinogen oxidase (protox) enzyme protein from a sugar cane plant, wherein the protein comprises the amino acid sequence given in SEQ ID NO: 37.
- the present invention is directed to an isolated DNA molecule that encodes a sugar cane protox enzyme and that comprises a nucleotide sequence that hybridizes to the coding sequence shown in SEQ ID NO:36 under the following hybridization and wash conditions:
- the present invention is further directed to probes and methods for detecting the presence of genes encoding inhibitor-resistant forms of the plant protox enzyme and quantitating levels of inhibitor-resistant protox transcripts in plant tissue. These methods may be used to identify or screen for plants or plant tissue containing and/or expressing a gene encoding an inhibitor-resistant form of the plant protox enzyme as disclosed herein.
- the entire protox sequences according to the invention or portions thereof may be used as probes capable of specifically hybridizing to protox coding sequences and messenger RNA's.
- probes include sequences that are unique among protox coding sequences and are preferably at least 10 nucleotides in length, and most preferably at least 20 nucleotides in length.
- Such probes may be used to amplify and analyze protox coding sequences from a chosen organism via the well known process of polymerase chain reaction (PCR). This technique may be useful to isolate additional protox coding sequences from a desired organism or as a diagnostic assay to determine the presence of protox coding sequences in an organism.
- PCR polymerase chain reaction
- T m melting temperature
- the preferred hybridization temperature is in the range of about 25°C below the calculated melting temperature T m and preferably in the range of about 12-15°C below the calculated melting temperature T m and in the case of oligonucleotides in the range of about 5-10°C below the melting temperature T m .
- DNA molecules that hybridize to a DNA molecule according to the invention as defined hereinbefore, but preferably to an oligonucleotide probe obtainable from the DNA molecule comprising a contiguous portion of the sequence of the protopo ⁇ hyrinogen oxidase (protox) enzyme at least 10 nucleotides in length, under moderately stringent conditions.
- protox protopo ⁇ hyrinogen oxidase
- the invention further embodies the use of a nucleotide probe capable of specifically hybridizing to a plant protox gene or mRNA of at least 10 nucleotides length in a polymerase chain reaction (PCR).
- PCR polymerase chain reaction
- the present invention provides probes capable of specifically hybridizing to a eukaryotic DNA sequence encoding a protopo ⁇ hyrinogen oxidase activity or to the respective mRNA and methods for detecting the DNA sequences in eukaryotic organisms using the probes according to the invention.
- Protox specific hybridization probes may also be used to map the location of the native eukaryotic protox gene(s) in the genome of a chosen organism using standard techniques based on the selective hybridization of the probe to genomic protox sequences. These techniques include, but are not limited to, identification of DNA polymo ⁇ hisms identified or contained within the protox probe sequence, and use of such polymo ⁇ hisms to follow segregation of the protox gene relative to other markers of known map position in a mapping population derived from self fertilization of a hybrid of two polymo ⁇ hic parental lines (see e.g. Helentjaris etal., Plant Mol. Biol. 5: 109 (1985). Sommer et al.
- these markers can then be used to monitor the extent of protox-linked flanking chromosomal DNA still present in the recurrent parent after each round of back-crossing.
- Protox specific hybridization probes according to the invention may also be used to quantitate levels of protox mRNA in an organism using standard techniques such as Northern blot analysis. This technique may be useful as a diagnostic assay to detect altered levels of protox expression that may be associated with particular adverse conditions such as autosomal dominant disorder in humans characterized by both neuropsychiatric symptoms and skin lesions, which are associated with decreased levels of protox activity (Brenner and Bloomer, New Engl. J. Med. 302: 765 (1980)).
- a further embodiment of the invention is a method of producing a D ⁇ A molecule comprising a D ⁇ A portion encoding a protein having protopo ⁇ hyrinogen oxidase (protox) enzyme activity comprising:
- nucleotide probe capable of specifically hybridizing to a plant protox gene or mR ⁇ A, wherein the probe comprises a contiguous portion of the coding sequence for a protox protein according to the present invention of at least 10 nucleotides length;
- step (b) probing for other protox coding sequences in populations of cloned genomic D ⁇ A fragments or cD ⁇ A fragments from a chosen organism using the nucleotide probe prepared according to step (a);
- a further embodiment of the invention is a method of isolating a D ⁇ A molecule from any plant comprising a D ⁇ A portion encoding a protein having protopo ⁇ hyrinogen oxidase (protox) enzyme activity.
- protox protopo ⁇ hyrinogen oxidase
- step (b) probing for other protox coding sequences in populations of cloned genomic DNA fragments or cDNA fragments from a chosen organism using the nucleotide probe prepared according to step (a);
- the invention further comprises a method of producing an essentially pure DNA sequence coding for a protein exhibiting protopo ⁇ hyrinogen oxidase (protox) enzyme activity, which method comprises:
- the invention further comprises a method of producing an essentially pure DNA sequence coding for a protein exhibiting protopo ⁇ hyrinogen oxidase (protox) enzyme activity, which method comprises:
- step (b) using the DNA of step (a) as a template for PCR reaction with primers representing low degeneracy portions of the amino acid sequence of protopo ⁇ hyrinogen oxidase (protox) according to the present invention.
- a further object of the invention is an assay to identify inhibitors of protopo ⁇ hyrinogen oxidase (protox) enzyme activity that comprises:
- protopo ⁇ hyrinogen oxidase (protox) according to the present invention and its substrate;
- step (b) measuring an uninhibited reactivity of the protopo ⁇ hyrinogen oxidase (protox) from step (a); (c) incubating a first sample of protoporphyrinogen oxidase (protox) and its substrate in the presence of a second sample comprising an inhibitor compound;
- step (d) measuring an inhibited reactivity of the protopo ⁇ hyrinogen oxidase (protox) enzyme from step (c);
- a further object of the invention is an assay to identify inhibitor-resistant protopo ⁇ hyrinogen oxidase (protox) mutants that comprises:
- protopo ⁇ hyrinogen oxidase (protox) enzyme incubating a first sample of protopo ⁇ hyrinogen oxidase (protox) enzyme and its substrate in the presence of a second sample comprising a protoporphyrinogen oxidase (protox) enzyme inhibitor;
- step (b) measuring an unmutated reactivity of the protopo ⁇ hyrinogen oxidase (protox) enzyme from step (a);
- step (d) measuring a mutated reactivity of the mutated protoporphyrinogen oxidase (protox) enzyme from step (c);
- a further object of the invention is a protox enzyme inhibitor obtained by a method according to the invention.
- the protox coding sequence according to the present invention may be inserted into an expression cassette designed for the chosen host and introduced into the host where it is recombinantly produced.
- the choice of specific regulatory sequences such as promoter, signal sequence, 5' and 3' untranslated sequences, and enhancer, is within the level of skill of the routineer in the art.
- the resultant molecule containing the individual elements linked in proper reading frame, may be inserted into a vector capable of being transformed into the host cell.
- Suitable expression vectors and methods for recombinant production of proteins are well known for host organisms such as E. coli (see, e.g. Studier and Moffatt, J. Mol. Biol.
- plasmids such as pBluescript (Stratagene, La Jolla, CA), pFLAG (International Biotechnologies, Inc., New Haven, CT), pTrcHis (Invitrogen, La Jolla, CA), and baculovims expression vectors, e.g., those derived from the genome of Autographica califomica nuclear polyhedrosis virus (AcMNPV).
- a preferred baculovirus/insect system is pVI11392/Sf21 cells (Invitrogen, La Jolla, CA).
- Recombinantly produced eukaryotic protox enzyme is useful for a variety of pu ⁇ oses. For example, it may be used to supply protox enzymatic activity in vitro. It may also be used in an in vitro assay to screen known herbicidal chemicals whose target has not been identified to determine if they inhibit protox. Such an in vitro assay may also be used as a more general screen to identify chemicals that inhibit protox activity and that are therefore herbicide candidates. Recombinantly produced eukaryotic protox enzyme may also be used in an assay to identify inhibitor-resistant protox mutants (see International application no. PCT/IB95/00452 filed June 8, 1995, published Dec.
- recombinantly produced protox enzyme may be used to further characterize its association with known inhibitors in order to rationally design new inhibitory herbicides as well as herbicide tolerant forms of the enzyme.
- the present invention teaches modifications that can be made to the amino acid sequence of any eukaryotic protopo ⁇ hyrinogen oxidase (referred to herein as "protox") enzyme to yield an inhibitor-resistant form of this enzyme.
- the eukaryotic protox enzyme is a plant protox enzyme.
- the present invention is directed to inhibitor-resistant protox enzymes having the modifications taught herein, to DNA molecules encoding these modified enzymes, and to chimeric genes capable of expressing these modified enzymes in plants.
- the present invention discloses an isolated DNA molecule encoding a modified eukaryotic protopo ⁇ hyrinogen oxidase (protox) having at least one amino acid modification, wherein the amino acid modification has the property of conferring resistance to a protox inhibitor, that is wherein the modified protox is tolerant to an inhibitor in amounts that inhibit the naturally occurring eukaryotic protox.
- protox modified eukaryotic protopo ⁇ hyrinogen oxidase
- inhibitor refers to a reduction in enzymatic activity observed in the presence of a subject compound compared to the level of activity observed in the absence of the subject compound, wherein the percent level of reduction is preferably at least 10%, more preferably at least 50%, and most preferably at least 90%.
- a DNA molecule is disclosed encoding a modified eukaryotic protopo ⁇ hyrinogen oxidase (protox) that is a plant protox, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity, particularly a protox selected from the group consisting of an Arabidopsis protox enzyme, a maize protox enzyme, a wheat protox enzyme, a soybean protox enzyme, a cotton protox enzyme, a sugar beet protox enzyme, an oilseed rape protox enzyme, a rice protox enzyme, a sorghum protox enzyme, and a sugar cane protox enzyme having at least one amino acid modification, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity.
- protox a modified eukaryotic protopo ⁇ hyrinogen oxidase
- substantially conserved amino acid sequences refers to regions of amino acid homology between polypeptides comprising protox enzymes from different sources.
- seventeen substantially conserved amino acid sub-sequences designated 1-19 respectively, are shown in Table 1B.
- One skilled in the art could align the amino acid sequences of protox enzymes from different sources, as has been done in Table 1 A, to identify the sub-sequences therein that make up the substantially conserved amino acid sequences defined herein. Stated another way, a given subsequence from one source "corresponds to" a homologous subsequence from a different source. The skilled person could then determine whether the identified sub-sequences have the characteristics disclosed and claimed in the present application.
- the present invention discloses a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes an enzyme having protopo ⁇ hyrinogen oxidase (protox) activity, wherein the nucleic acid molecule is capable of being inco ⁇ orated into a nucleic acid construct used to transform a plant containing wild- type, herbicide-sensitive protox, wherein the nucleotide sequence has at least one point mutation relative to a wild-type nucleotide sequence encoding plant protox, such that upon transformation with the nucleic acid construct the plant is rendered herbicide-tolerant.
- protox protopo ⁇ hyrinogen oxidase
- a preferred embodiment of the present invention is directed to a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protopo ⁇ hyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises at least one of the following amino acid sub-sequences:
- nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protoporphyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence AP ⁇ iF, wherein ⁇ is leucine or cysteine.
- protox protoporphyrinogen oxidase
- nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protopo ⁇ hyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence F ⁇ 2 S, wherein ⁇ 2 is leucine.
- protox protopo ⁇ hyrinogen oxidase
- nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protopo ⁇ hyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence Y ⁇ 3 G, wherein ⁇ 3 is an isoleucine.
- protox protopo ⁇ hyrinogen oxidase
- nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protopo ⁇ hyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence ⁇ 7 IG, wherein ⁇ 7 is histidine or alanine, bur especially histidine.
- protox protopo ⁇ hyrinogen oxidase
- nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protopo ⁇ hyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence KA ⁇ 8 F, wherein ⁇ 18 is an amino acid other than alanine. Most preferably, ⁇ 8 is threonine or valine.
- nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protopo ⁇ hyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises the amino acid sub-sequence Q ⁇ 19 H, wherein ⁇ 9 is an amino acid other than leucine. Most preferably, ⁇ 9 is serine.
- nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protopo ⁇ hyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises at least one of the following amino acid sub-sequences:
- modified enzyme further comprises at least one additional amino acid sub-sequence selected from the group consisting of:
- nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protopo ⁇ hyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the modified enzyme comprises: the amino acid sub-sequence ⁇ 7 IG, wherein ⁇ 7 is an amino acid other than tyrosine; the amino acid sub-sequences IGG ⁇ 12, wherein ⁇ 12 is an amino acid other than threonine; and the amino acid sub-sequence SWXL ⁇ 13 , wherein ⁇ 13 is an amino acid other than serine.
- protox protopo ⁇ hyrinogen oxidase
- ⁇ 7 is isoleucine
- ⁇ 12 is isoleucine
- ⁇ 13 is leucine.
- Yet another preferred embodiment of the present invention is directed to a nucleic acid molecule comprising a nucleotide sequence isolated from a plant that encodes a modified enzyme having protopo ⁇ hyrinogen oxidase (protox) activity, wherein the modified enzyme is resistant to an inhibitor of a naturally occurring protox enzyme, wherein the nucleotide sequence is further characterized in that at least one of the following conditions is met:
- the nucleic acid sequence has a sequence that encodes amino acid subsequence AP ⁇ iF, wherein ⁇ i is leucine;
- the nucleic acid sequence has a sequence that encodes amino acid subsequence F ⁇ 2 S, wherein ⁇ 2 is leucine;
- the nucleic acid sequence has a sequence that encodes amino acid subsequence Y ⁇ sG, wherein ⁇ 3 is isoleucine;
- the nucleic acid sequence has a sequence that encodes amino acid subsequence ⁇ 7IG, wherein ⁇ 7 is alanine or histidine;
- the nucleic acid sequence has a sequence that encodes amino acid subsequence Y ⁇ sG, wherein ⁇ is an amino acid other than alanine, but preferably cysteine or isoleucine, more preferably isoleucine, and the nucleic acid sequence also has a sequence that encodes one of the group consisting of:
- the nucleic acid sequence has a sequence that encodes amino acid subsequence ⁇ 7 IG, wherein ⁇ 7 is an amino acid other than tyrosine, but preferably threonine, alanine or histidine, more preferably alanine or histidine and most preferably histidine, and the nucleic acid sequence also has a sequence that encodes one of the group consisting of:
- the nucleic has a sequence that encodes amino acid sub-sequence T ⁇ 16 G, wherein ⁇ 6 is an amino acid other than leucine, and the nucleic acid sequence also has a sequence that encodes amino acid sub-sequence YV ⁇ 17 G, wherein ⁇ 17 is an amino acid other than alanine.
- said nucleic acid sequence has a sequence that encodes amino acid sub-sequence T ⁇ 16 G, wherein ⁇ 16 is an amino acid other than leucine, and said nucleic acid sequence also has a sequence that encodes amino acid sub-sequence YV ⁇ 17 G, wherein ⁇ 17 is an amino acid other than alanine.
- the nucleic acid sequence has a sequence that encodes amino acid sub-sequence T ⁇ 6 G, wherein ⁇ 16 is serine, and said nucleic acid sequence also has a sequence that encodes amino acid sub-sequence YV ⁇ 7 G, wherein ⁇ 17 is threonine.
- a DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox wherein the arginine occurring at the position corresponding to amino acid 88 of SEQ ID NO:6 is replaced with another amino acid, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity.
- protox a modified protopo ⁇ hyrinogen oxidase
- the DNA molecule wherein the arginine is replaced with a leucine or cysteine.
- a DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox wherein the cysteine occurring at the position corresponding to amino acid 159 of SEQ ID NO:6 is replaced with a leucine.
- protox modified protopo ⁇ hyrinogen oxidase
- a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the alanine occurring at the position corresponding to amino acid 175 of SEQ ID NO:6 is replaced with another amino acid, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity.
- protox a modified protoporphyrinogen oxidase
- a DNA molecule wherein the alanine is replaced with a valine or threonine.
- a DNA molecule encoding a modified protoporphyrinogen oxidase (protox) comprising a plant protox wherein the leucine occurring at the position corresponding to amino acid 337 of SEQ ID NO:6 is replaced with another amino acid, wherein the modified protox is tolerant to a herbicide in amounts that inhibit the naturally occurring protox activity.
- protox a modified protoporphyrinogen oxidase
- a DNA molecule wherein the leucine is replaced with a serine.
- a DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox wherein the tyrosine occurring at the position corresponding to amino acid 428 of SEQ ID NO:16 is replaced with a histidine or alanine, preferably a histidine.
- protox modified protopo ⁇ hyrinogen oxidase
- a DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox wherein the alanine occurring at the position corresponding to amino acid 220 of SEQ ID NO:2 is replaced with a isoleucine or a tyrosine, preferably a isoleucine.
- protox modified protopo ⁇ hyrinogen oxidase
- a DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox wherein the tyrosine occurring at the position corresponding to amino acid 426 of SEQ ID NO:2 is replaced with a alanine.
- protox modified protopo ⁇ hyrinogen oxidase
- a DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox wherein the leucine occurring at the position corresponding to amino acid 347 of SEQ ID NO:6 is replaced with a serine and the alanine occurring at the position corresponding to amino acid 453 of SEQ ID NO:6 is replaced with a threonine.
- protox modified protopo ⁇ hyrinogen oxidase
- the present invention further discloses a DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution but especially a DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox, wherein the plant is selected from the group consisting of maize, wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, sugar cane, and Arabidopsis.
- Preferred is a DNA molecule wherein the first amino acid substitution occurs at a position selected from the group consisting of:
- a DNA molecule wherein the arginine occurring at the position corresponding to residue 88 of SEQ ID NO:6 is replaced with a cysteine or a leucine.
- More preferred is a DNA molecule wherein the cysteine occurring at the position corresponding to residue 159 of SEQ ID NO:6 is replaced with an leucine.
- a DNA molecule wherein the alanine occurring at the position corresponding to residue 175 of SEQ ID NO:6 is replaced with an amino acid selected from the group consisting of threonine and valine.
- Particularly preferred is a DNA molecule wherein the leucine occurring at the position corresponding to residue 337 of SEQ ID NO:6 is replaced with a serine.
- More preferred is a DNA molecule wherein the tyrosine occurring at the position corresponding to residue 428 of SEQ ID NO:16 is replaced with histidine or alanine.
- the present invention is still further directed to a DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox having a double amino acid substitution, wherein both amino acid substitutions are required for there to be resistance to a protox inhibitor.
- a DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox, wherein the plant is maize.
- protox modified protopo ⁇ hyrinogen oxidase
- Preferred is a DNA molecule having a double amino acid substitution, wherein one amino acid substitution occurs at the position corresponding to the leucine at amino acid 347 of SEQ ID NO:6, and wherein the second amino acid substitution occurs at the position corresponding to the alanine at amino acid 453 of SEQ ID NO:6.
- a DNA molecule having a double amino acid substitution wherein a leucine occurring at the position corresponding to amino acid 347 of SEQ ID NO:6 is replaced with a serine, and wherein an alanine occurring at the position corresponding to amino acid 453 of SEQ ID NO:6 is replaced with a threonine.
- the present invention is further directed to a DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox wherein the plant protox comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 37.
- protox modified protopo ⁇ hyrinogen oxidase
- the present invention is further directed to expression cassettes and recombinant vectors comprising the expression cassettes comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to a DNA molecule encoding the protopo ⁇ hyrinogen oxidase (protox) enzyme from a eukaryotic organism according to the invention.
- the expression cassette according to the invention may in addition further comprise a signal sequence operatively linked to the DNA molecule, wherein the signal sequence is capable of targeting the protein encoded by the DNA molecule into the chloroplast or the mitochondria.
- the invention relates to a chimeric gene, which comprises an expression cassette comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to a heterologous DNA molecule encoding a protopo ⁇ hyrinogen oxidase (protox) enzyme from a eukaryotic organism according to the invention.
- a chimeric gene wherein the DNA molecule encodes an protoporphyrinogen oxidase (protox) enzyme from sugar cane
- a chimeric gene comprising a promoter active in a plant operatively linked to a heterologous DNA molecule encoding a protoporphyrinogen oxidase (protox) from sugar cane comprising the sequence set forth in SEQ ID NO:37.
- protox protoporphyrinogen oxidase
- a chimeric gene wherein the DNA molecule encodes a
- a chimeric gene wherein the DNA molecule encodes a protein from sugar cane having protox-1 activity, preferably wherein the protein comprises the amino acid sequence set forth in SEQ ID NO:37.
- the invention also embodies a chimeric gene, which comprises an expression cassette comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to the DNA molecule encoding an protopo ⁇ hyrinogen oxidase (protox) enzyme from a eukaryotic organism according to the invention, which is resistant to herbicides at levels that inhibit the corresponding unmodified version of the enzyme.
- a chimeric gene which comprises an expression cassette comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to the DNA molecule encoding an protopo ⁇ hyrinogen oxidase (protox) enzyme from a eukaryotic organism according to the invention, which is resistant to herbicides at levels that inhibit the corresponding unmodified version of the enzyme.
- protox protopo ⁇ hyrinogen oxidase
- protox protopo ⁇ hyrinogen oxidase
- a chimeric gene wherein the DNA molecule encodes an protopo ⁇ hyrinogen oxidase (protox) enzyme from a plant selected from the group consisting of soybean, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, turf grass, and rice.
- protopo ⁇ hyrinogen oxidase protox
- the DNA molecule encodes an protoporphyrinogen oxidase (protox) enzyme from a plant selected from the group consisting of Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, and rice.
- a chimeric gene comprising a promoter that is active in a plant operatively linked to the DNA molecule according to the invention encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a eukaryotic protox having at least one amino acid modification, wherein the amino acid modification has the property of conferring resistance to a protox inhibitor.
- protox modified protopo ⁇ hyrinogen oxidase
- a chimeric gene comprising a promoter that is active in a plant operatively linked to the DNA molecule according to the invention encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution.
- protox modified protopo ⁇ hyrinogen oxidase
- the chimeric gene additionally comprising a signal sequence operatively linked to the DNA molecule, wherein the signal sequence is capable of targeting the protein encoded by the DNA molecule into the chloroplast or in the mitochondria.
- the chimeric gene according to the invention may in addition further comprise a signal sequence operatively linked to the DNA molecule of the invention, wherein the signal sequence is capable of targeting the protein encoded by the DNA molecule into the chloroplast.
- the chimeric gene according to the invention may in addition further comprise a signal sequence operatively linked to the DNA molecule, wherein the signal sequence is capable of targeting the protein encoded by the DNA molecule into the mitochondria.
- Also encompassed by the present invention is any of the DNA sequences mentioned herein before, which is stably integrated into a host genome.
- the invention further relates to a recombinant DNA molecule comprising a plant protopo ⁇ hyrinogen oxidase (protox) according to the invention or a functionally equivalent derivative thereof.
- protox plant protopo ⁇ hyrinogen oxidase
- the invention further relates to a recombinant DNA vector comprising the recombinant DNA molecule of the invention.
- a further object of the invention is a recombinant vector comprising the chimeric gene according to the invention, wherein the vector is capable of being stably transformed into a host cell.
- a further object of the invention is a recombinant vector comprising the chimeric gene according to the invention, wherein the vector is capable of being stably transformed into a plant, plant seeds, plant tissue or plant cell.
- Preferred is a recombinant vector comprising the chimeric gene according to the invention, wherein the vector is capable of being stably transformed into a plant.
- the plant, plant seeds, plant tissue or plant cell stably transformed with the vector is capable of expressing the DNA molecule encoding a protopo ⁇ hyrinogen oxidase (protox).
- protox protopo ⁇ hyrinogen oxidase
- a recombinant vector comprising the chimeric gene of the invention comprising a promoter active in a plant operatively linked to a heterologous DNA molecule encoding a protoporphyrinogen oxidase (protox) from sugar cane comprising the sequence set forth in SEQ ID NO:37, wherein the vector is capable of being stably transformed into a host cell.
- protoporphyrinogen oxidase protox
- recombinant vector comprising the chimeric gene of the invention comprising a promoter that is active in a plant operatively linked to the DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution, wherein the vector is capable of being stably transformed into a plant cell.
- protox modified protopo ⁇ hyrinogen oxidase
- a host cell stably transformed with the vector according to the invention, wherein the host cell is capable of expressing the DNA molecule.
- a host cell selected from the group consisting of a plant cell, a bacterial cell, a yeast cell, and an insect cell.
- the present invention is further directed to plants and the progeny thereof, plant tissue and plant seeds tolerant to herbicides that inhibit the naturally occurring protox activity in these plants, wherein the tolerance is conferred by a gene expressing a modified inhibitor-resistant protox enzyme as taught herein.
- Representative plants include any plants to which these herbicides may be applied for their normally intended purpose.
- Preferred are agronomically important crops, i.e., angiosperms and gymnosperms such as Arabidopsis, sugar cane, soybean, barley, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, tomato, potato, turf and forage grasses, millet, forage, and rice and the like.
- agronomically important crops i.e., angiosperms and gymnosperms
- angiosperms and gymnosperms such as Arabidopsis, cotton, soybean, oilseed rape, sugar beet, maize, rice, wheat, barley, oats, rye, sorghum, millet, turf, forage, turf grasses.
- agronomically important crops i.e., angiosperms and gymnosperms
- angiosperms and gymnosperms such as Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, and rice.
- Preferred is a plant comprising the DNA molecule encoding a modified protopo ⁇ hyrinogen oxidase (protox) comprising a plant protox having a first amino acid substitution and a second amino acid substitution; the first amino acid substitution having the property of conferring resistance to a protox inhibitor; and the second amino acid substitution having the property of enhancing the resistance conferred by the first amino acid substitution, wherein the DNA molecule is expressed in the plant and confers upon the plant tolerance to a herbicide in amounts that inhibit naturally occurring protox activity.
- Comprised by the present invention is a plant and the progeny thereof comprising the chimeric gene according to the invention, wherein the chimeric gene confers upon the plant tolerance to a herbicide in amounts that inhibit naturally occurring protox activity.
- transgenic plant tissue including plants and the progeny thereof, seeds, and cultured tissue, stably transformed with at least one chimeric gene according to the invention.
- transgenic plant tissue including plants, seeds, and cultured tissue, stably transformed with at least one chimeric gene that comprises an expression cassette comprising essentially a promoter, but especially a promoter that is active in a plant, operatively linked to the DNA molecule encoding an protopo ⁇ hyrinogen oxidase (protox) enzyme that is resistant to herbicides at levels that inhibit the corresponding unmodified version of the enzyme in the plant tissue.
- protox protopo ⁇ hyrinogen oxidase
- the present invention is further directed to plants, plant tissue, plant seeds, and plant cells tolerant to herbicides that inhibit the naturally occurring protox activity in these plants, wherein the tolerance is conferred by increasing expression of wild-type herbicide-sensitive protox.
- the level of expressed enzyme generally is at least two times, preferably at least five times, and more preferably at least ten times the natively expressed amount.
- Increased expression may be due to multiple copies of a wild-type protox gene; multiple occurrences of the coding sequence within the gene (i.e. gene amplification) or a mutation in the non-coding, regulatory sequence of the endogenous gene in the plant cell.
- Plants having such altered gene activity can be obtained by direct selection in plants by methods known in the art (see, e.g. U.S. Patent No. 5,162,602, and U.S. Patent No. 4,761 ,373, and references cited therein). These plants also may be obtained by genetic engineering techniques known in the art. Increased expression of a herbicide-sensitive protox gene can also be accomplished by stably transforming a plant cell with a recombinant or chimeric DNA molecule comprising a promoter capable of driving expression of an associated structural gene in a plant cell operatively linked to a homologous or heterologous structural gene encoding the protox enzyme.
- the recombinant DNA molecules of the invention can be introduced into the plant cell in a number of art-recognized ways. Those skilled in the art will appreciate that the choice of method might depend on the type of plant, i.e. monocot or dicot, targeted for transformation. Suitable methods of transforming plant cells include microinjection (Crossway et al., BioTechniques 4/320-334 (1986)), electroporation (Riggs et al, Proc. Natl. Acad. Sci. USA 53:5602-5606 (1986), Agrobacterium mediated transformation (Hinchee et al., Biotechnology 6:915-921 (1988)), direct gene transfer (Paszkowski et al., EMBO d.
- transgenic plants in particular transgenic fertile plants transformed by means of the aforedescribed processes and their asexual and/or sexual progeny, which still are resistant or at least tolerant to inhibition by a herbicide at levels that normally are inhibitory to the naturally occurring protox activity in the plant.
- Progeny plants also include plants with a different genetic background than the parent plant, which plants result from a backcrossing program and still comprise in their genome the herbicide resistance trait according to the invention.
- Very especially preferred are hybrid plants that are resistant or at least tolerant to inhibition by a herbicide at levels that normally are inhibitory to the naturally occurring protox activity in the plant.
- the transgenic plant according to the invention may be a dicotyledonous or a monocotyledonous plant.
- Preferred are monocotyledonous plants of the Graminaceae family involving Lolium, Zea, Triticum, Triticale, Sorghum, Saccharum, Bromus, Oryzae, Avena, Hordeum, Secale and Setaria plants.
- More preferred are transgenic maize, wheat, barley, sorghum, rye, oats, sugar cane, turf and forage grasses, millet and rice.
- Especially preferred are maize, wheat, sorghum, rye, oats, turf grasses and rice.
- soybean, cotton, sugar beet, oilseed rape, tobacco, tomato, potato, and sunflower are more preferred herein.
- soybean, cotton, tobacco, sugar beet, tomato, potato, and oilseed rape are more preferred herein.
- soybean, cotton, tobacco, sugar beet, tomato, potato, and oilseed rape are more preferred herein.
- progeny' is understood to embrace both, “asexually” and “sexually” generated progeny of transgenic plants. This definition is also meant to include all mutants and variants obtainable by means of known processes, such as for example cell fusion or mutant selection and that still exhibit the characteristic properties of the initial transformed plant, together with all crossing and fusion products of the transformed plant material. This also includes progeny plants that result from a backcrossing program, as long as the progeny plants still contain the herbicide resistant trait according to the invention.
- the proliferation material of transgenic plants is defined relative to the invention as any plant material that may be propagated sexually or asexually in vivo or in vitro. Particularly preferred within the scope of the present invention are protoplasts, cells, calli, tissues, organs, seeds, embryos, pollen, egg cells, zygotes, together with any other propagating material obtained from transgenic plants.
- a further object of the invention is a method of producing plants, protoplasts, cells, calli, tissues, organs, seeds, embryos, pollen, egg cells, zygotes, together with any other propagating material, parts of plants, such as for example flowers, stems, fruits, leaves, roots originating in transgenic plants or their progeny previously transformed by means of the process of the invention, which therefore produce an inhibitor resistant form of a plant protox enzyme by transforming the plant, plant parts with the DNA according to the invention.
- Preferred is a method of producing transgenic progeny of a transgenic parent plant comprising an isolated DNA molecule encoding a protein from a eukaryote having protopo ⁇ hyrinogen oxidase (protox) activity comprising transforming the parent plant with a recombinant vector molecule according to the invention and transferring the herbicide tolerant trait to the progeny of the transgenic parent plant involving known plant breeding techniques.
- the genetic properties engineered into the transgenic seeds and plants described above are passed on by sexual reproduction or vegetative growth and can thus be maintained and propagated in progeny plants.
- the maintenance and propagation make use of known agricultural methods developed to fit specific pu ⁇ oses such as tilling, sowing or harvesting.
- Specialized processes such as hydroponics or greenhouse technologies can also be applied.
- measures are undertaken to control weeds, plant diseases, insects, nematodes, and other adverse conditions to improve yield.
- Use of the advantageous genetic properties of the transgenic plants and seeds according to the invention can further be made in plant breeding that aims at the development of plants with improved properties such as tolerance of pests, herbicide tolerance, or stress tolerance, improved nutritional value, increased yield, or improved structure causing less loss from lodging or shattering.
- the various breeding steps are characterized by well-defined human intervention such as selecting the lines to be crossed, directing pollination of the parental lines, or selecting appropriate progeny plants. Depending on the desired properties different breeding measures are taken.
- the relevant techniques are well known in the art and include but are not limited to hybridization, inbreeding, backcross breeding, multiline breeding, variety blend, interspecific hybridization, aneuploid techniques, etc.
- Hybridization techniques also include the sterilization of plants to yield male or female sterile plants by mechanical, chemical or biochemical means. Cross pollination of a male sterile plant with pollen of a different line assures that the genome of the male sterile but female fertile plant will uniformly obtain properties of both parental lines.
- the transgenic seeds and plants according to the invention can be used for the breeding of improved plant lines that for example increase the effectiveness of conventional methods such as herbicide or pesticide treatment or allow to dispense with the methods due to their modified genetic properties.
- new crops with improved stress tolerance can be obtained that, due to their optimized genetic "equipment" , yield harvested product of better quality than products that were not able to tolerate comparable adverse developmental conditions.
- Customarily used protectant coatings comprise compounds such as captan, carboxin, thiram (TMTD ® ), methalaxyl (Apron ® ), and pirimiphos-methyl (Actellic ® ). If desired these compounds are formulated together with further carriers, surfactants or application- promoting adjuvants customarily employed in the art of formulation to provide protection against damage caused by bacterial, fungal or animal pests.
- the protectant coatings may be applied by impregnating propagation material with a liquid formulation or by coating with a combined wet or dry formulation. Other methods of application are also possible such as treatment directed at the buds or the fruit.
- a transgenic plant or the progeny thereof is used comprising a chimeric gene according to the invention in an amount sufficient to express herbicide resistant forms of herbicide target proteins in a plant to confer tolerance to the herbicide.
- a method such as that which follows may be used: maize plants produced as described in the examples set forth below are grown in pots in a greenhouse or in soil, as is known in the art, and permitted to flower. Pollen is obtained from the mature tassel and used to pollinate the ears of the same plant, sibling plants, or any desirable maize plant. Similarly, the ear developing on the transformed plant may be pollinated by pollen obtained from the same plant, sibling plants, or any desirable maize plant. Transformed progeny obtained by this method may be distinguished from non-transformed progeny by the presence of the introduced gene(s) and/or accompanying DNA (genotype), or the phenotype conferred.
- the transformed progeny may similarly be selfed or crossed to other plants, as is normally done with any plant carrying a desirable trait.
- tobacco or other transformed plants produced by this method may be selfed or crossed as is known in the art in order to produce progeny with desired characteristics.
- other transgenic organisms produced by a combination of the methods known in the art and this invention may be bred as is known in the art in order to produce progeny with desired characteristics.
- the modified inhibitor-resistant protox enzymes of the invention have at least one amino acid substitution, addition or deletion relative to their naturally occurring counte ⁇ art (i.e. inhibitor-sensitive forms that occur naturally in a plant without being manipulated, either directly via recombinant DNA methodology or indirectly via selective breeding, etc., by man).
- Amino acid positions that may be modified to yield an inhibitor-resistant form of the protox enzyme, or enhance inhibitor resistance are indicated in bold type in Table 1 A in the context of plant protox-1 sequences from Arabidopsis, maize, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, wheat, and sugar cane.
- DNA molecules encoding the herbicide resistant protox coding sequences taught herein may be genetically engineered for optimal expression in a crop plant. This may include altering the coding sequence of the resistance allele for optimal expression in the crop species of interest. Methods for modifying coding sequences to achieve optimal expression in a particular crop species are well known (see, e.g. Perlak et al., Proc. Natl. Acad. Sci. USA 88: 3324 (1991); Koziel et al, Bio/technol. 11: 194 (1993)).
- Genetically engineering a protox coding sequence for optimal expression may also include operatively linking the appropriate regulatory sequences (i.e. promoter, signal sequence, transcriptional terminators).
- appropriate regulatory sequences i.e. promoter, signal sequence, transcriptional terminators.
- promoters capable of functioning in plants or plant cells include the cauliflower mosaic virus (CaMV) 19S or 35S promoters and CaMV double promoters; nopaline synthase promoters; pathogenesis-related (PR) protein promoters; small subunit of ribulose bisphosphate carboxylase (ssuRUBISCO) promoters, heat shock protein promoter from Brassica with reference to EPA 0 559 603 (hsp ⁇ O promoter), Arabidopsis actin promoter and the SuperMas promoter with reference to WO 95/14098 and the like.
- CaMV cauliflower mosaic virus
- PR pathogenesis-related
- ssuRUBISCO small subunit of ribulose bisphosphate carboxylase
- Preferred promoters will be those that confer high level constitutive expression or, more preferably, those that confer specific high level expression in the tissues susceptible to damage by the herbicide.
- Preferred promoters are the rice actin promoter (McElroy et al, Mol. Gen. Genet. 231: 150 (1991 )), maize ubiquitin promoter (EP 0 342 926; Taylor et al, Plant Cell Rep. 12: 491 (1993)), and the PR-1 promoter from tobacco, Arabidopsis, or maize (see U.S. Patent No. 5,614,395 to Ryals et al, incorporated by reference herein in its entirety).
- the promoters themselves may be modified to manipulate promoter strength to increase protox expression, in accordance with art-recognized procedures.
- Another preferred promoter for use with the inhibitor-resistant protox coding sequences is the promoter associated with the native protox gene (i.e. the protox promoter; see copending, co-owned U.S. Patent Application No. 08/808,323, entitled “Promoters from Protopo ⁇ hyrinogen Oxidase Genes", incorporated by reference herein in its entirety.)
- the promoter sequence from an Arabidopsis protox-1 gene is set forth in SEQ ID NO:13
- the promoter sequence from a maize protox-1 gene is set forth in SEQ ID NO:14
- the promoter sequence from a sugar beet protox-1 gene is set forth in SEQ ID NO:26.
- the modifications taught herein may be made directly on the native protox gene present in the plant cell genome without the need to construct a chimeric gene with heterologous regulatory sequences. Such modifications can be made via directed mutagenesis techniques such as homologous recombination and selected for based on the resulting herbicide-resistance phenotype (see, e.g. Example 10, Pazkowski etal, EMBO . 7: 4021-4026 (1988), and U.S. Patent No. 5,487,992, particularly columns 18-19 and Example 8).
- An added advantage of this approach is that besides containing the native protox promoter, the resulting modified gene will also include any other regulatory elements, such as signal or transit peptide coding sequences, which are part of the native gene.
- signal or transit peptides may be fused to the protox coding sequence in chimeric DNA constructs of the invention to direct transport of the expressed protox enzyme to the desired site of action.
- signal peptides include those natively linked to the plant pathogenesis-related proteins, e.g. PR-1 , PR-2, and the like. See, e.g., Payne etal, Plant Mol. Biol. 77:89-94 (1988).
- Examples of transit peptides include the chloroplast transit peptides such as those described in Von Heijne etal, Plant Mol. Biol. Rep. 9:104-126 (1991); Mazur etal, Plant Physiol.
- Chloroplast and mitochondrial transit peptides are contemplated to be particularly useful with the present invention as protox enzymatic activity typically occurs within the mitochondria and chloroplast. Most preferred for use are chloroplast transit peptides, as inhibition of the protox enzymatic activity in the chloroplasts is contemplated to be the primary basis for the action of protox-inhibiting herbicides (Witkowski and Hailing, Plant Physiol. 87: 632 (1988); Lehnen et al, Pestic. Biochem. Physiol.
- Chimeric genes of the invention may contain multiple copies of a promoter or multiple copies of the protox structural genes.
- the construct(s) may include coding sequences for markers and coding sequences for other peptides such as signal or transit peptides, each in proper reading frame with the other functional elements in the DNA molecule. The preparation of such constructs are within the ordinary level of skill in the art.
- Useful markers include peptides providing herbicide, antibiotic or drug resistance, such as, for example, resistance to hygromycin, kanamycin, G418, gentamycin, lincomycin, methotrexate, glyphosate, phosphinothricin, or the like. These markers can be used to select cells transformed with the chimeric DNA constructs of the invention from untransformed cells.
- Other useful markers are peptidic enzymes that can be easily detected by a visible reaction, for example a color reaction, for example luciferase, ⁇ -glucuronidase, or ⁇ -galactosidase.
- a herbicide resistant protox allele is obtained via directed mutation of the native gene in a crop plant or plant cell culture from which a crop plant can be regenerated, it may be moved into commercial varieties using traditional breeding techniques to develop a herbicide tolerant crop without the need for genetically engineering the modified coding sequence and transforming it into the plant.
- the herbicide resistant gene may be isolated, genetically engineered for optimal expression and then transformed into the desired variety.
- Genes encoding altered protox resistant to a protox inhibitor can also be used as selectable markers in plant cell transformation methods. For example, plants, plant tissue or plant cells transformed with a transgene can also be transformed with a gene encoding an altered protox capable of being expressed by the plant.
- Protox inhibitors contemplated to be particularly useful as selective agents are the diphenylethers ⁇ e.g. acifluorfen, 5-[2-chloro-4-(trifluoromethyl)phenoxy]-2-nitrobezoic acid; its methyl ester; or oxyf luorfen, 2-chloro-1 -(3-ethoxy-4-nitrophenoxy)-4-(trif luorobenzene) ⁇ , oxidiazoles, (e.g.
- oxidiazon 3-[2,4-dichloro-5-(1-methylethoxy)phenyl]-5-(1 ,1-dimethylethyl)- 1 ,3,4-oxadiazol-2-(3H)-one
- cyclic imides e.g. S-23142, N-(4-chloro-2-fluoro-5- propargyloxyphenyl)-3,4,5,6-tetrahydrophthalimide; chlorophthalim, ⁇ /-(4-chlorophenyl)- 3,4,5,6-tetrahydrophthalimide
- phenyl pyrazoles e.g.
- the method is applicable to any plant cell capable of being transformed with an altered protox-encoding gene, and can be used with any transgene of interest.
- Expression of the transgene and the protox gene can be driven by the same promoter functional on plant cells, or by separate promoters.
- Modified inhibitor-resistant protox enzymes of the present invention are resistant to herbicides that inhibit the naturally occurring protox activity.
- the herbicides that inhibit protox include many different structural classes of molecules (Duke et al, Weed Sci. 39: 465 (1991 ); Nandihalli et al, Pesticide Biochem. Physiol. 43: 193 (1992); Matringe et al, FEBS Lett. 245: 35 (1989); Yanase and Andoh, Pesticide Biochem. Physiol. 35: 70 (1989)), including the diphenylethers ⁇ e.g.
- acifluorifen 5-[2-chloro-4-(trifluoromethyl)phenoxy]-2- nitrobezoic acid; its methyl ester; or oxyf luorfen, 2-chloro-1-(3-ethoxy-4-nitrophenoxy)-4- (trifluorobenzene) ⁇ , oxidiazoles (e.g. oxidiazon, 3-[2,4-dichloro-5-(1-methylethoxy)phenyl]-5- (1,1-dimethylethyl)-1 ,3,4-oxadiazol-2-(3H)-one), cyclic imides (e.g.
- An additional diphenylether of interest is one having the formula:
- a further diphenylether of interest is one having the formula:
- R1 equals H, Cl or F
- R 2 equals Cl
- R 3 is an optimally substituted ether, thioether, ester, amino or alkyl group.
- R 2 and R 3 together may form a 5 or 6 membered heterocyclic ring. Examples of imide herbicides of particular interest are
- imide herbicides are those classified as aryluracils and having the general formula
- herbicides having the general formula:
- R 2 is hydrogen, or a C ⁇ -C 4 -alkoxy, each of which is optionally substituted by one or more halogen atoms, or
- Ri and R 2 together from the group -(CH 2 ) n -X-, where X is bound at R 2 ;
- R 3 is hydrogen or halogen
- R 4 is hydrogen or C ⁇ -C 4 -alkyl
- R 5 is hydrogen, nitro, cyano or the group -COOR 6 or -CONR 7 R 8 , and
- R 6 is hydrogen, C ⁇ -C 6 -alkyl, C 2 -C 6 -alkenyl or C 2 -C 6 -alkynyl;
- N-phenylpyrazoles such as:
- pyridyl pyrazoles such as the following:
- Levels of herbicide that normally are inhibitory to the activity of protox include application rates known in the art, and that depend partly on external factors such as environment, time and method of application.
- the application rates range from 0.0001 to 10 kg/ha, preferably from 0.005 to 2 kg/ha.
- This dosage rate or concentration of herbicide may be different, depending on the desired action and particular compound used, and can be determined by methods known in the art.
- a further object of the invention is a method for controlling the growth of undesired vegetation that comprises applying to a population of the plant selected from a group consisting of Arabidopsis, sugar cane, soybean, barley, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, turf and forage grasses , millet, forage and rice and the like an effective amount of a protox-inhibiting herbicide.
- Preferred is a method for controlling the growth of undesired vegetation which comprises applying to a population of the selected from the group consisting of selected from the group consisting of soybean, cotton, tobacco, sugar beet, oilseed rape, maize, wheat, sorghum, rye, oats, turf grasses and rice an effective amount of a protox-inhibiting herbicide.
- a method for controlling the growth of undesired vegetation which comprises applying to a population of the selected from the group consisting of Arabidopsis, soybean, cotton, sugar beet, oilseed rape, maize, wheat, sorghum, and rice.
- the present invention further encompasses a chimeric gene comprising a promoter capable of expression in a plant plastid operatively linked to a DNA molecule of the present invention.
- a preferred promoter capable of expression in a plant plastid is a promoter isolated from the 5' flanking region upstream of the coding region of a plastid gene, which may come from the same or a different species, and the native product of which is typically found in a majority of plastid types including those present in non-green tissues.
- promoters of clpP genes such as the tobacco clpP gene promoter QNO 97/06250, inco ⁇ orated herein by reference) and the Arabidopsis clpP gene promoter (U.S. Application No. 09/038,878, inco ⁇ orated herein by reference).
- Other promoters that are capable of expressing a DNA molecule in plant plastids are promoters recognized by viral RNA polymerases.
- Preferred promoters of this type are promoters recognized by a single sub-unit RNA polymerase, such as the T7 gene 10 promoter, which is recognized by the bacteriophage T7 DNA-dependent RNA polymerase.
- Yet another promoter that is capable of expressing a DNA molecule in plant plastids comes from the regulatory region of the plastid 16S ribosomal RNA operon (Harris et al, Microbiol. Rev. 58:700-754 (1994), Shinozaki et al, EMBO J. 5:2043-2049 (1986), both of which are inco ⁇ orated herein by reference).
- the gene encoding the T7 polymerase is preferably transformed into the nuclear genome and the T7 polymerase is targeted to the plastids using a plastid transit peptide. Expression of the DNA molecules in the plastids can be constitutive or can be inducible.
- the chimeric gene preferably further comprises a 5' untranslated sequence (5' UTR) functional in plant plastids and a plastid gene 3' untranslated sequence (3' UTR) operatively linked to a DNA molecule of the present invention.
- the 3' UTR is a plastid rps ⁇ 6 gene 3' untranslated sequence.
- the chimeric gene comprises a poly-G tract instead of a 3' untranslated sequence.
- the present invention also encompasses a plastid transformation vector comprising the chimeric gene described above and flanking regions for integration into the plastid genome by homologous recombination.
- the plastid transformation vector may optionally comprise at least one chloroplast origin of replication.
- the present invention also encompasses a plant plastid transformed with such a plastid transformation vector, wherein the DNA molecule is expressible in the plant plastid.
- the invention also encompasses a plant or plant cell, including the progeny thereof, comprising this plant plastid.
- the plant is homoplasmic for transgenic plastids.
- the plants transformed in the present invention may be monocots or dicots. A preferred monocot is maize and a preferred dicot is tobacco. Other preferred dicots are tomato and potato.
- Plastid transformation in which genes are inserted by homologous recombination into some or all of the several thousand copies of the circular plastid genome present in each plant cell, takes advantage of the enormous copy number advantage over nuclear- expressed genes to permit expression levels that may exceed 10% of the total soluble plant protein.
- plastid transformation is desirable because in most plants plastid- encoded traits are not pollen transmissible; hence, potential risks of inadvertent transgene escape to wild relatives of transgenic plants is obviated. Plastid transformation technology is extensively described in U.S. Patent Nos. 5,451 ,513, 5,545,817, 5,545,818, and 5,576,198; in PCT Application Nos.
- the basic technique for tobacco chloroplast transformation involves the particle bombardment of leaf tissue or PEG-mediated uptake of plasmid DNA in protoplasts with regions of cloned plastid DNA flanking a selectable antibiotic resistance marker.
- the 1 to 1.5 kb flanking regions termed 'targeting sequences," facilitate homologous recombination with the plastid genome and thus allow the replacement or modification of specific regions of the 156 kb tobacco plastid genome.
- point mutations in the chloroplast 16S rDNA and /ps72 genes conferring resistance to spectinomycin and/or streptomycin were utilized as selectable markers for transformation (Svab, Z., Hajdukiewicz, P., and Maliga, P.
- the present invention encompasses a chimeric gene comprising a promoter capable of expression in a plant plastid operatively linked to a DNA molecule isolated from a prokaryote or a eukaryote that encodes a native or modified protox enzyme, such as a DNA molecule that encodes a native or modified wheat, soybean, cotton, sugar beet, oilseed rape, rice, sorghum, or sugar cane protox enzyme.
- a DNA molecule is comprised in a plastid transformation vector as described above and plants homoplasmic for transgenic plastid genomes are produced.
- Expression in plant plastids of a DNA molecule that encodes a modified protox enzyme preferably confers upon the plant tolerance to a herbicide in amounts that inhibit naturally occurring protox activity.
- the present invention encompasses a chimeric gene comprising (a) a DNA molecule isolated from a plant, which in its native state encodes a polypeptide that comprises a plastid transit peptide, and a mature enzyme that is natively targeted to a plastid of the plant by the plastid transit peptide, wherein the DNA molecule is modified such that it does not encode a functional plastid transit peptide; and (b) a promoter capable of expressing the DNA molecule in a plastid, wherein the promoter is operatively linked to the DNA molecule.
- the transit peptide is mutated and thus does not allow the proper transport of the enzyme encoded by the DNA molecule to the desired cell compartment, such as the plastid.
- a portion of the transit peptide coding sequence or the entire transit peptide coding sequence is removed from the DNA molecule, preventing the enzyme from being properly targeted to the desired cell compartment.
- chimeric genes described above are inserted in plastid transformation vectors, and the present invention is therefore also directed to plants having their plastid genome transformed with such vectors, whereby the DNA molecule is expressible in plant plastids.
- Such plants are preferably homoplasmic for transgenic plastids.
- a DNA molecule described immediately above encodes an enzyme that in its wild-type form is inhibited by a herbicide.
- the DNA molecule encodes an enzyme that in its wild-type form is inhibited by a herbicide, but that comprises at least one amino acid change compared to the wild-type enzyme. Such an amino acid change makes the enzyme resistant to compounds that naturally inhibit the wild-type enzyme.
- the DNA molecule encodes an enzyme having protopo ⁇ hyrinogen oxidase (protox) activity.
- the transit peptide is removed from the DNA molecule as further illustrated in Examples 37-42. Plants homoplasmic for transgenic plastids of the invention are resistant to high amounts of herbicides such as Formula XVII that inhibit the naturally occurring protox activity (as further illustrated in Example 44).
- the transit peptide of a DNA molecule encoding a 5- enolpyruvyl-3-phosphoshikimate synthase is mutated or removed.
- the resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genomes are obtained. These plants are resistant to herbicidal compounds that naturally inhibit EPSP synthase, in particular glyphosate.
- the transit peptide of a DNA molecule encoding a acetolactate synthase (ALS) is mutated or removed.
- the resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constmcts in their plastid genome are obtained. These plants are resistant to herbicidal compounds that naturally inhibit ALS, in particular sulfonylureas.
- the transit peptide of a DNA molecule encoding a acetoxyhydroxyacid synthase (AHAS) is mutated or removed.
- the resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genome are obtained.
- AHAS herbicidal compounds that naturally inhibit AHAS, in particular, imidazolinone and sulfonamide herbicides.
- the transit peptide of a DNA molecule encoding an acetylcoenzyme A carboxylase (ACCase) is mutated or removed.
- the resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constructs in their plastid genome are obtained.
- ACCase cyclohexanedione and arylphenoxypropanoic acid herbicides.
- the transit peptide of a DNA molecule encoding a glutamine synthase is mutated or removed.
- the resulting DNA molecule is fused to a promoter capable of expression in plant plastids and homoplasmic plants harboring such constmcts in their plastid genome are obtained. These plants are resistant to herbicidal compounds that naturally inhibit GS, in particular phosphinothricin and methionine sulfoximine.
- the present invention is also further directed to a method of obtaining herbicide- resistant plants by transforming their plastid genome with a chimeric gene comprising (a) a DNA molecule isolated from a plant, which in its native state encodes a polypeptide that comprises a plastid transit peptide, and a mature enzyme that is natively targeted to a plastid of the plant by the plastid transit peptide, wherein the DNA molecule is modified such that it does not encode a functional plastid transit peptide; and (b) a promoter capable of expressing the DNA molecule in a plastid, wherein the promoter is operatively linked to the DNA molecule.
- a DNA molecule isolated from a plant which in its native state encodes a polypeptide that comprises a plastid transit peptide, and a mature enzyme that is natively targeted to a plastid of the plant by the plastid transit peptide, wherein the DNA molecule is modified such that it does not
- the present invention is still further directed to a novel method for selecting a transplastomic plant cell, comprising the steps of: introducing the above-described chimeric gene into the plastome of a plant cell; expressing the encoded enzyme in the plastids of the plant cell; and selecting a cell that is resistant to a herbicidal compound that naturally inhibits the activity of the enzyme, whereby the resistant cell comprises transformed plastids.
- the enzyme is naturally inhibited by a herbicidal compound and the transgenic plant is able to grow on an amount of the herbicidal compound that naturally inhibits the activity of the enzyme.
- the enzyme has protopo ⁇ hyrinogen oxidase (protox) activity and is modified so that it that confers resistance to protox inhibitors.
- a further aspect of the present invention is a novel method for plastid transformation of recalcitrant plants.
- the methods pioneered for plastid transformation of tobacco and lower plant species rely on non-lethal selection for resistance to antibiotics that preferentially affect the plastid translational apparatus and hence allow photo-heterotrophic transformants to outgrow heterotrophic, non-transformed tissue.
- kanamycin the only other antibiotic proven to be useful for chloroplast transformation
- kanamycin phosphotransferase a member of the genome of a plant.
- a preferred selectable marker for generalized plastid transformation (1) is active only in the plastid to eliminate nuclear-transformed "escapes"; (2) has a mode of action that does not depend on photosynthetic competence or the presence of fully differentiated chloroplasts; and (3) has a level of resistance that is co-dependent on an adjustable external parameter (e.g. light), rather than being determined solely by the bulk concentration of a selective agent, so that selection pressure can vary during selection to facilitate segregation of the many-thousand plastid genome copies.
- an adjustable external parameter e.g. light
- such a selectable marker gene involves the use of a chimeric gene comprising an isolated DNA molecule encoding a plastid-targeted enzyme having in its natural state a plastid transit peptide, wherein the DNA molecule is modified such that the transit peptide either is absent or does not function to target the enzyme to the plastid, wherein the DNA molecule is operatively linked to a promoter capable of expression in plant plastids.
- a DNA molecule of the present invention encodes an enzyme that is naturally inhibited by a herbicide.
- the DNA molecule encodes a protoporphyrinogen IX oxidase ("protox").
- the protoporphyrinogen IX oxidase gene is from Arabidopsis thaliana and in a more preferred embodiment, the protopo ⁇ hyrinogen IX oxidase gene is from Arabidopsis thaliana and comprises at least one amino acid substitution.
- an amino acid substitution results in tolerance of the enzyme against inhibition by an herbicide which naturally inhibits the activity of the enzyme. Low concentrations of herbicide are thought to kill wildtype plants due to light-sensitive intermediates which build up when the plastid-localized protox enzyme is inhibited. Production of these photosensitizing compounds does not require differentiated chloroplasts or active photosynthesis, which is a key factor for successful plastid transformation of plants whose regenerable cultured tissues are of non-photosynthetic nature.
- the invention encompasses the use of promoters that are capable of expression of operatively linked DNA molecules in plastids of both green and non-green tissue.
- one such promoter comes from the regulatory region of the plastid 16S ribosomal RNA operon.
- Another candidate is the promoter and 5' UTR from the plastid clpP gene.
- the clpP gene product is expressed constitutively in plastids from all plant tissues, including those that do not contain chloroplasts (Shanklin (1995) Plant Cell 7: 1713-22).
- a plastid transformation vector of the present invention contains a chimeric gene allowing for selection of transformants as described above and at least one other gene fused to a promoter capable of expression in plant plastids.
- the other such gene may, for example, confer resistance to insect pests, or to fungal or bacterial pathogens, or may encode one or more value-added traits.
- SEQ ID NO:1 DNA coding sequence for an Arabidopsis thaliana protox-1 protein.
- SEQ ID NO:2 Arabidopsis protox-1 amino acid sequence encoded by SEQ ID NO:1.
- SEQ ID NO:3 DNA coding sequence for an Arabidopsis thaliana protox-2 protein.
- SEQ ID NO:4 Arabidopsis protox-2 amino acid sequence encoded by SEQ ID NO:3.
- SEQ ID NO:5 DNA coding sequence for a maize protox-1 protein.
- SEQ ID NO:6 Maize protox-1 amino acid sequence encoded by SEQ ID NO:5.
- SEQ ID NO:7 DNA coding sequence for a maize protox-2 protein.
- SEQ ID NO:8 Maize protox-2 amino acid sequence encoded by SEQ ID NO:7.
- SEQ ID NO:9 Partial DNA coding sequence for a wheat protox-1 protein.
- SEQ ID NO:10 Partial wheat protox-1 amino acid sequence encoded by SEQ ID NO:9.
- SEQ ID NO:11 DNA coding sequence for a soybean protox-1 protein.
- SEQ ID NO:12 Soybean protox-1 protein encoded by SEQ ID NO:11.
- SEQ ID NO:13 Promoter sequence from Arabidopsis thaliana protox-1 gene.
- SEQ ID NO:14 Promoter sequence from maize protox-1 gene.
- SEQ ID NO:15 DNA coding sequence for a cotton protox-1 protein.
- SEQ ID NO:16 Cotton protox-1 amino acid sequence encoded by SEQ ID NO:15.
- SEQ ID NO:17 DNA coding sequence for a sugar beet protox-1 protein.
- SEQ ID NO:18 Sugar beet protox-1 amino acid sequence encoded by SEQ ID NO:17.
- SEQ ID NO:19 DNA coding sequence for an oilseed rape protox-1 protein.
- SEQ ID NO:20 Oilseed rape protox-1 amino acid sequence encoded by SEQ ID NO:19.
- SEQ ID NO:21 Partial DNA coding sequence for a rice protox-1 protein.
- SEQ ID NO:22 Partial rice protox-1 amino acid sequence encoded by SEQ ID NO:21.
- SEQ ID NO:23 Partial DNA coding sequence for a sorghum protox-1 protein.
- SEQ ID NO:24 Partial sorghum protox-1 amino acid sequence encoded by SEQ ID NO:23.
- SEQ ID NO:25 Maize protox-1 intron sequence.
- SEQ ID NO:26 Promoter sequence from sugar beet protox-1 gene.
- SEQ ID NO:27 Pclp_P1a - plastid clpP gene promoter top strand PCR primer.
- SEQ ID NO:28 Pclp_P1b - plastid clpP gene promoter bottom strand PCR primer.
- SEQ ID NO:29 Pclp_P2b - plastid clpP gene promoter bottom strand PCR primer.
- SEQ ID NO:30 T ⁇ s16_P1a - plastid ⁇ s76 gene top strand PCR primer.
- SEQ ID NO:31 T ⁇ s16_p1b - plastid ⁇ s76gene bottom strand PCR primer.
- SEQ ID NO:32 minpsb_U - plastid psbA gene top strand primer.
- SEQ ID NO:33 minpsb_L - plastid psbA gene bottom strand primer.
- SEQ ID NO:34 APRTXPIa - top strand PCR primer.
- SEQ ID NO:35 APRTXPIb - bottom strand PCR primer.
- SEQ ID NO:36 Partial DNA coding sequence for a sugar cane protox-1 protein.
- SEQ ID NO:37 Partial sugar cane protox-1 amino acid sequence encoded by SEQ ID NO:36.
- Soybean protox-1 in the pBluescript SK vector, was deposited December 15, 1995 as pWDC-12 (NRRL #B-21516).
- Cotton protox-1 in the pBluescript SK vector, was deposited July 1 , 1996 as pWDC- 15 (NRRL #B-21594).
- Oilseed rape protox-1 in the pBluescript SK vector, was deposited August 23, 1996, as pWDC-17 (NRRL #B-21615).
- Sorghum protox-1 in the pBluescript SK vector, was deposited December 6, 1996, as pWDC-19 (NRRL #B-21649).
- AraPTI Pro containing the Arabidopsis protox-1 promoter was deposited December 15, 1995, as pWDC-11 (NRRL #B-21515)
- a plasmid containing the maize protox-1 promoter fused to the remainder of the maize protox-1 coding sequence was deposited March 19, 1996 as pWDC-14 (NRRL #B-21546).
- Example 1 Isolation of a Wheat Protox-1 cDNA Based on Sequence Homology to a Maize
- RNA prepared from Triticum aestivum was submitted to Clontech for custom cDNA library construction in the Lambda Uni-Zap vector.
- Approximately 50,000 pf u of the cDNA library were plated at a density of approximately 5,000 pf u per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell).
- the plaque lifts were probed with the maize protox-1 cDNA (SEQ ID NO:5; see Example 2 of International application no. PCT/IB95/00452, filed June 8, 1995, published Dec. 21, 1995 as WO 95/34659) labeled with 32P-dCTP by the random priming method (Life Technologies).
- Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50°C. Wash conditions were 2X SSC, 1 % SDS at 50°C. (Church and Gilbert, Proc. Natl. Acad. Sci. USA 87: 1991-1995 (1984), hereby inco ⁇ orated by reference in its entirety.) Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
- wheat protox-1 The longest wheat protox-1 cDNA obtained from initial screening efforts, designated "wheat protox-1", was 1489-bp in length. Wheat protox-1 lacks coding sequence for the transit peptide plus approximately 126 amino acids of the mature coding sequence based on comparison with the other known plant protox peptide sequences.
- a second screen was performed to obtain a longer wheat protox cDNA.
- a Triticum aestivum (cv Kanzler) cDNA library was prepared internally using the lambda Uni-Zap vector. Approximately 200,000 pfu of the cDNA library was screened as indicated above, except that the wheat protox-1 cDNA was used as a probe and hybridization and wash conditions were at 65 C instead of 50 C. The longest wheat cDNA obtained from this screening effort, designated "wheat protox-1 a", was 1811-bp in length.
- the nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs:9 and 10, respectively.
- this cDNA is either full-length or missing only a few transit peptide codons (Table 1 A).
- This wheat protein sequence is 91 % identical (95% similar) to the maize protox-1 protein sequence set forth in SEQ ID NO:6.
- Example 2 Isolation of a Soybean Protox-1 cDNA Based on Sequence Homology to an
- Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50° C. Wash conditions were 2X SSC, 1% SDS at 50° C. (Church and Gilbert (1984)). Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequence of the cDNA inserts was determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.). The longest soybean cDNA obtained, designated "soybean protox-1", is full-length based on comparison with the other known plant protox peptide sequences (Table 1A).
- Soybean protox-1 is 1847-bp in length and encodes a protein of 58.8 kDa.
- the nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs:11 and 12, respectively.
- the soybean protein is 78% identical (87% similar) to the Arabidopsis protox- 1 protein.
- Soybean protox-1 in the pBluescript SK vector, was deposited December 15, 1995 as pWDC-12 (NRRL #B-21516).
- Example 3 Isolation of a Cotton Protox-1 cDNA Based on Sequence Homology to a Maize
- a Lambda Uni-Zap cDNA library prepared from Gossypium hirsutum L (72 hr. dark grown cotyledons) was obtained from Dr. Dick Trelease, Dept. of Botany, Arizona State University (Ni W. and Trelease R.N., Arch. Biochem. Biophys. 289: 237-243 (1991)). Approximately 50,000 pfu of the library was plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto Colony/Plaque Screen membranes (NEN Dupont).
- the plaque lifts were probed with the maize protox-1 cDNA (SEQ ID NO:5) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50° C. Wash conditions were 2X SSC, 1% SDS at 50° C. (Church and Gilbert (1984)). Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequence of the cDNA inserts was determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
- Cotton protox-1 The longest cotton cDNA obtained, designated "cotton protox-1 ", appears to be full-length based on comparison with the other known plant protox peptide sequences (Table 1A).
- Cotton protox-1 is 1826-bp in length and encodes a protein of 58.2 kDa.
- the nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs:13 and 14, respectively.
- the cotton protein is 77% identical (86% similar) to the maize protox-1 protein.
- Cotton protox-1 in the pBluescript SK vector, was deposited July 1 , 1996 as pWDC- 15 (NRRL #B-21594).
- Example 4 Isolation of a Sugar Beet Protox-1 cDNA Based on Sequence Homology to an
- a Lambda-Zap cDNA library prepared from Beta vulgaris was obtained from Dr. Philip Rea, Dept. of Botany, Plant Science Institute, Philadelphia, PA (Yongcheol Kim, Eugene J. Kim, and Philip A. Rea, Plant Physiol. 106: 375-382 (1994)). Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell). The plaque lifts were probed with the Arabidopsis protox-1 cDNA (SEQ ID NO:1) labeled with 32P-dCTP by the random priming method (Life Technologies).
- Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50° C. Wash conditions were 2X SSC, 1% SDS at 50° C. (Church and Gilbert (1984)). Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.). The longest sugar beet protox-1 cDNA obtained, designated "sugar beet protox-1 ", is full-length based on comparison with the other known plant protox peptide sequences (Table 1A).
- Sugar beet protox-1 is 1910-bp in length and encodes a protein of 60 kDa.
- the nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs:15 and 16, respectively.
- the sugar beet protein is 73% identical (82% similar) to the Arabidopsis protox-1 protein.
- Example 5 Isolation of an Oilseed Rape Protox-1 cDNA Based on Sequence Homology to an Arabidopsis Protox-1 Coding Sequence
- a Lambda Uni-Zap II cDNA library prepared from Brassica napus (3-4 wk. mature green leaves) was obtained from Dr. Guenther Ochs, Institut Fuer Canale Botanik, Johannes Gutenberg-Universitaet Mainz, Germany (G ⁇ nther Ochs, Gerald Schock, and Aloysius Wild, Plant Physiol. 103: 303-304 (1993)).
- Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell).
- the plaque lifts were probed with the Arabidopsis protox-1 cDNA (SEQ ID NO:1) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50° C. Wash conditions were 2X SSC, 1 % SDS at 50° C. (Church and Gilbert (1984)). Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
- Rape protox-1 The longest oilseed rape protox-1 cDNA obtained, designated "rape protox-1", is full-length based on comparison with the other known plant protox peptide sequences (Table 1 A). Rape protox- 1 is 1784-bp in length and encodes a protein of 57.3kD. The nucleotide sequence of this cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs: 17 and 18, respectively. The oilseed rape protein is 87% identical (92% similar) to the Arabidopsis protox-1 protein.
- Rape protox-1 in the pBluescript SK vector, was deposited August 23, 1996, as pWDC-17 (NRRL #B-21615).
- Example 6 Isolation of a Rice Protox-1 cDNA Based on Sequence Homology to a Maize
- a Lambda gt11 cDNA library prepared from Oryza sativa (5 day etiolated shoots) was purchased from Clontech. Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell). The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID NO:5) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50° C.
- SDS sodium dodecyl sulfate
- Rice protox-1 lacks coding sequence for the transit peptide plus approximately 172 amino acids of the mature coding sequence based on comparison with the other known plant protox peptide sequences (Table 1 A).
- the nucleotide sequence of this partial cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs:19 and 20, respectively.
- Example 7 Isolation of a Sorghum Protox-1 cDNA Based on Sequence Homology to a
- a Lambda-Zap II cDNA library prepared from Sorghum bicolor (3-6 day green seedlings) was obtained from Dr. Klaus Pfizenmaier, Institute of Cell Biology and Immunology, University of Stuttgart, Germany (Harald Wajant, Karl-Wolfgang Mundry, and Klaus Pfizenmaier, Plant Mol Biol. 26: 735-746 (1994)).
- Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell).
- the plaque lifts were probed with the maize protox-1 cDNA (SEQ ID NO:5) labeled with 32P- dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50° C. Wash conditions were 2X SSC, 1% SDS at 50° C. (Church and Gilbert (1984)). Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. The sequences of the cDNA inserts were determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.).
- Sorghum protox-1 The longest sorghum protox-1 cDNA obtained, designated "sorghum protox-1", was 1590-bp in length. Sorghum protox-1 lacks coding sequence for the transit peptide plus approximately 44 amino acids of the mature coding sequence based on comparison with the other known plant protox peptide sequences (Table 1 A). The nucleotide sequence of this partial cDNA and the amino acid sequence it encodes are set forth in SEQ ID NOs:21 and 22, respectively.
- a Lambda-Zap II cDNA library prepared from sugar cane was obtained from Henrik Albert of USDA/ARS at the Hawaii Agricultural Research Center. Approximately 50,000 pfu of the cDNA library were plated at a density of approximately 5,000 pfu per 10 cm Petri dish and duplicate filter lifts were made onto nitrocellulose membranes (Schleicher and Schuell). The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID NO:5) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization conditions were 7% sodium dodecyl sulfate (SDS), 0.5 M NaPO4 pH 7.0, 1 mM EDTA at 50° C.
- SDS sodium dodecyl sulfate
- Example 9 Demonstration of Plant Protox Clone Sensitivity to Protox Inhibitory Herbicides in a Bacterial System
- Liquid cultures of protox-1 /SASX38, protox-2/SASX38 and pBluescript/XL1-Blue were grown in L amp 100 .
- One hundred microliter aliquots of each culture were plated on L amp 100 media containing various concentrations (1.0nM-10mM) of a protox inhibitory aryluracil herbicide of formula XVII.
- Duplicate sets of plates were incubated for 18 hours at 37° C.
- the protox+ E. coli strain XL1-Blue showed no sensitivity to the herbicide at any concentration, consistent with reported resistance of the native bacterial enzyme to similar herbicides.
- the protox-1 /SASX38 was clearly sensitive, with the lawn of bacteria almost entirely eliminated by inhibitor concentrations as low as 10nM.
- the protox-2/SASX38 was also sensitive, but only at a higher concentration (10 ⁇ M) of the herbicide. The herbicide was effective even on plates maintained almost entirely in the dark. The toxicity of the herbicide was entirely eliminated by the addition of 20 ⁇ g/ml hematin to the plates.
- Section B Identification and Characterization of Plant Protox Genes Resistant to Protox-lnhibitory Herbicides
- Example 10 Selecting for Plant Protox Genes Resistant to Protox-lnhibitory Herbicides in the E. coli Expression System
- the electroporated cells were plated on L agar containing 100ug/ml ampicillin at a density of approximately 500,000 transformants/10cm plate. The cells were then incubated at 37 C for 40 hours in low light and selected for the ability to grow without the addition of exogenous heme. Heme prototrophs were recovered at a frequency of 400/10 from the pFL61 library. Sequence analysis of twenty-two complementing clones showed that nine are of the type designated "protox-1 ,” the protox gene expected to express a chloroplastic protox enzyme.
- the pFL61 library is a yeast expression library, with the Arabidopsis cDNAs inserted bidirectionally. These cDNAs can also be expressed in bacteria.
- the protox cDNAs apparently initiate at an in-frame ATG in the yeast PGK 3' sequence approximately 10 amino acids 5' to the Notl cloning site in the vector and are expressed either from the lacZ promoter 300bp further upstream or from an undefined cryptic bacterial promoter. Because protox-1 cDNAs that included significant portions of a chloroplast transit sequence inhibited the growth of the E. coli SASX38 strain, the clone with the least amount of chloroplast transit sequence attached was chosen for mutagenesis/herbicide selection experiments. This clone, pSLV19, contains only 17 amino acids of the putative chloroplast transit peptide, with the DNA sequence beginning at bp-151 of the Arabidopsis protox-1 cDNA (SEQ ID NO:1).
- the plasmid pSLV19 was transformed into the random mutagenesis strain XL1 -Red (Stratagene, La Jolla, CA). The transformation was plated on L media containing 50ug/ml ampicillin and incubated for 48 hours at 37 C. Lawns of transformed cells were scraped from the plates and plasmid DNA prepared using the Wizard Megaprep kit (Promega, Madison, WI). Plasmid DNA isolated from this mutator strain is predicted to contain approximately one random base change per 2000 nucleotides (see Greener et al, Strategies 7(2):32-34 (1994).
- the mutated plasmid DNA was transformed into the hemG mutant SASX38 (Sasarman etal, d. Gen. Microbiol. 113:297 (1979) and plated on L media containing various concentrations of protox-inhibiting herbicide (formula XVII). The plates were incubated for 2 days at 37 C. Plasmid DNA was isolated from all colonies that grew in the presence of herbicide concentrations that effectively killed the wild type strain. The isolated DNA was then transformed into SASX38 and plated again on herbicide to ensure that the resistance observed was plasmid-borne.
- the protox coding sequence from plasmids passing this screen was excised by Notl digestion, recloned into an unmutagenized vector, and tested again for the ability to confer herbicide tolerance.
- the DNA sequence of protox cDNAs that conferred herbicide resistance was then determined and mutations identified by comparison with the wild type Arabidopsis protox-1 sequence (SEQ ID NO:1).
- a single coding sequence mutant was recovered from the first mutagenesis experiment.
- This mutant leads to enhanced herbicide "resistance" only by increasing growth rate. It contains a C to A mutation at nucleotide 197 in SEQ ID NO:1 in the truncated chloroplast transit sequence of pSLV19, converting an ACG codon for threonine to an AAG codon for lysine at amino acid 56 of SEQ ID NO:2, and resulting in better complementation of the bacterial mutant.
- This plasmid also contains a silent coding sequence mutation at nucleotide 1059, with AGT (Ser) changing to AGC (Ser). This plasmid was designated pMut-1.
- the pMut-1 plasmid was then transformed into the mutator XL1-Red strain as described above and the mutated DNA was isolated and plated on an herbicide concentration that is lethal to the unmutagenized pMut-1 protox gene.
- Herbicide tolerant colonies were isolated after two days at 37 C and analyzed as described above. Multiple plasmids were shown to contain herbicide resistant protox coding sequences. Sequence analysis indicated that the resistant genes fell into two classes. One resistance mutation identified was a C to T change at nucleotide 689 in the Arabidopsis protox-1 sequence set forth in SEQ ID NO:1.
- This change converts a GCT codon for alanine at amino acid 220 of SEQ ID NO:2 to a GTT codon for valine, and was designated pAraC-1 Val (see, Table 1 B; sub-sequence 3).
- a second class of herbicide resistant mutant contains an A to G change at nucleotide 1307 in the Arabidopsis protox-1 sequence. This change converts a TAC codon for tyrosine at amino acid 426 to a TGC codon for cysteine, and was designated pAraC-2Cys (see, Table 1 B; sub-sequence 7).
- a third resistant mutant has a G to A change at nucleotide 691 in the Arabidopsis protox-1 sequence.
- This mutation converts a GGT codon for glycine at amino acid 221 to an AGT codon for serine at the codon position adjacent to the mutation in pAraC-1.
- This plasmid was designated pAraC-3Ser (see, Table 1 B; sub-sequence 4).
- Example 11 Additional Herbicide-Resistant Codon Substitutions at Positions Identified in the Random Screen
- the amino acids identified as herbicide resistance sites in the random screen are replaced by other amino acids and tested for function and for herbicide tolerance in the bacterial system.
- Oligonucleotide-directed mutagenesis of the Arabidopsis protox-1 sequence is performed using the Transformer Site-Directed Mutagenesis Kit (Clontech, Palo Alto, CA). After amino acid changes are confirmed by sequence analysis, the mutated plasmids are transformed into SASX38 and plated on L-amp 100 media to test for function and on various concentrations of protox-inhibiting herbicide to test for tolerance.
- tyrosine codon at nucleotides 1306-1308 can be changed to a codon for cysteine (pAraC-2Cys), isoleucine (pAraC-2lle), leucine (pAraC-2Leu), threonine (pAraC- 2Thr), methionine (pAraC-2Met), valine (pAraC-2Val), or alanine (pAraC-2Ala) to yield an herbicide-resistant protox enzyme that retains function (see, Table 1 B; sub-sequence 7).
- Example 12 Isolation of Additional Mutations that Increase Enzyme Function and/or Herbicide Tolerance of Previously Identified Resistant Mutants
- Plasmids containing herbicide resistant protox genes are transformed into the mutator strain XL1 -Red and mutated DNA is isolated as described above.
- the mutated plasmids are transformed into SASX38 and the transformants are screened on herbicide concentrations (formula XVII) sufficient to inhibit growth of the original "resistant" mutant.
- Tolerant colonies are isolated and the higher tolerance phenotype is verified as being coding sequence dependent as described above. The sequence of these mutants is determined and mutations identified by comparison to the progenitor sequence.
- Example 13 Combining Identified Resistance Mutations with Identified Second Site Mutations to Create Highly Functional/Highly Tolerant Protox Enzymes
- the AraC305Leu mutation described above was found to enhance the function/herbicide resistance of both the AraC-1Val and the AraC-2Cys mutant plasmids. In an effort to test the general usefulness of this second site mutation, it was combined with the AraC-2Leu, AraC-2Val, and AraC-2lle mutations and tested for herbicide tolerance. In each case, the AraC305Leu change significantly increased the growth rate of the resistant protox mutant on protox-inhibiting herbicide. Combinations of the AraC-2lle resistant mutant with either the second site mutant AraC249lle or AraC118Leu also produced more highly tolerant mutant protox enzymes.
- the AraC249lle mutation demonstrates that a second site mutation identified as enhancing an AraC-1 (sub-sequence 3) mutant may also increase the resistance of an AraC-2 (sub-sequence 7) mutant.
- a three mutation plasmid containing AraC-2lle, AraC305Leu, and AraC249lle (Table 1B; sub-sequences 7, 13, and 12) has also been shown to produce a highly functional, highly herbicide tolerant protox-1 enzyme.
- the pMut-1 Arabidopsis protox -1 plasmid described above is very effective when used in mutagenesis/screening experiments in that it gives a high frequency of genuine coding sequence mutants, as opposed to the frequent up-promoter mutants that are isolated when other plasmids are used.
- the maize cDNA was engineered into the pMut-1 vector in approximately the same sequence context as the Arabidopsis cDNA.
- the 5' end of the pMut-1 Arabidopsis clone (including 17 amino acids of chloroplast transit peptide with one mis-sense mutation as described above) was fused to the maize protox-1 cDNA sequence starting at amino acid number 14 of the maize sequence (SEQ ID NO:6).
- the 3' end of the maize cDNA was unchanged. Notl restriction sites were placed on both ends of this fusion, and the chimeric gene was cloned into the pFL61 plasmid backbone from pMut-1.
- the pMut-3 plasmid was transformed into the mutator XL1 -Red strain as described above and the mutated DNA was isolated and plated on a herbicide concentration (formula XVII) that was lethal to the unmutagenized pMut-3 maize protox gene.
- Herbicide tolerant colonies were isolated after two days at 37 C and analyzed as described above. This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences. Sequence analysis showed 5 single base changes that individually result in an herbicide tolerant maize protox-1 enzyme. Three of these mutations correspond to amino acid changes previously shown to confer tolerance at the homologous position in the Arabidopsis protox-1 gene.
- Two of the three are pMzC-1 Val and pMzC-1Thr, converting the alanine (GCT) at amino acid 164 (SEQ ID NO:6) to either valine (GAT) or to threonine (ACT). This position corresponds to the pAraC-1 mutations described above (see, Table 1 B; sub-sequence 3).
- the third analogous change, pMzC-3Ser converts the glycine (GGT) at amino acid 165 to Serine (AGT), corresponding to the AraC-3Ser mutation described above (see, Table 1 B; sub-sequence 4).
- Two of the mutations isolated from the maize protox-1 screen result in amino acid changes at residues not previously identified as herbicide resistance sites.
- One change (Mz159Phe) converts cysteine (TGC) to phenylalanine (TTC) at amino acid 159 of the maize protox-1 sequence (SEQ ID NO:6) (see, Table 1 B; sub-sequence 2).
- the second (Mz419Thr) converts isoleucine (ATA) to threonine (ACA) at amino acid 419 (see, Table 1 B; sub-sequence 9).
- tyrosine 370 in the maize enzyme (SEQ ID NO:6), to either isoleucine (pMzC-2lle) or methionine (pMzC-2Met) did produce herbicide tolerant enzymes (see, Table 1B; sub-sequence 7).
- Mz347Ser453Thr is a "double mutant" that requires that both mutations be present for herbicide tolerance.
- Additional mutant screens performed as described earlier in this example identified two additional amino acid changes that confer tolerant protox enzymes.
- the wheat cDNA was engineered into the pMut-1 vector as described above for the maize cDNA.
- This chimeric Arab-wheat protox-1 plasmid is designated pMut-4.
- the pMut-4 DNA was mutated and screened for herbicide tolerance as described above.
- This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences. Sequence analysis showed 7 single base changes that individually result in an herbicide tolerant wheat protox-1 enzyme. Four of these mutations correspond to amino acid changes previously shown to confer tolerance at the homologous position in the Arabidopsis and/or in the maize protox-1 gene.
- pWhtC-1 Val and pWhtC-1Thr convert the alanine (GCT) at amino acid 211 (SEQ ID NO:10) to valine (GAT) and to threonine (ACT), respectively. This position corresponds to the pAraC-1 mutations described above (see, Table 1 B; subsequence 3).
- the third analogous change, pWhtC-3Ser converts the glycine (GGT) at amino acid 212 to serine (AGT), corresponding to the AraC-3Ser mutation described above (see, Table 1 B; sub-sequence 4).
- Wht466Thr converts isoleucine (ATA) to threonine (ACA) at amino acid 466, corresponding to the Mz419Thr mutant from maize (see, Table 1 B; sub-sequence 9).
- soybean cDNA was engineered into the pMut-1 vector as described above for the maize cDNA.
- This chimeric Arab-soybean protox-1 plasmid is designated pMut-5.
- the pMut-5 DNA was mutated and screened for herbicide tolerance as described above.
- This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences. Sequence analysis showed 4 single base changes that individually result in an herbicide tolerant soybean protox-1 enzyme. Two of these mutations correspond to amino acid changes previously shown to confer tolerance at the homologous position in the Arabidopsis and/or in the wheat protox-1 gene.
- GCA alanine
- GCT valine
- the sugar beet cDNA was engineered into the pMut-1 vector as described above for the maize cDNA.
- This chimeric Arab-sugar beet protox-1 plasmid is designated pMut-6.
- the pMut-6 DNA was mutated and screened for herbicide tolerance as described above.
- This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences. Sequence analysis showed a single base change that results in an herbicide tolerant sugar beet protox-1 enzyme.
- the cotton cDNA was engineered into the pMut-1 vector as described above for the maize cDNA.
- This chimeric Arab-cotton protox-1 plasmid is designated pMut-7.
- the pMut-7 DNA was mutated and screened for herbicide tolerance as described above. This analysis revealed multiple plasmids containing herbicide resistant protox coding sequences. Sequence analysis showed 3 single base changes that individually result in an herbicide tolerant cotton protox-1 enzyme.
- pCotC-2Cys change tyrosine (TAC) at amino acid 428 (SEQ ID NO:16) to cysteine (TGC), histidine (CAC) and to arginine (CGC), respectively (see, Table 1 B; sub-sequence 7).
- Arginine is a novel substitution giving tolerance at this previously identified AraC-2 (sub-sequence 7) site.
- the third mutation converts proline (CCT) to serine (TCT) at amino acid 365. This change corresponds to the soybean mutant Soy369Ser (see, Table 1 B; sub-sequence 5).
- Resistant mutant plasmids originally identified based on resistance against a single protox inhibitory herbicide, were tested against a spectrum of other protox inhibiting compounds.
- the SASX38 strain containing the wild-type plasmid is plated on a range of concentrations of each compound to determine the lethal concentration for each one.
- Resistant mutant plasmids in SASX38 are plated and scored for the ability to survive on a concentration of each compound at least 10 fold higher than the concentration that is lethal to the SASX38 strain containing the wild-type plasmid.
- Results from bacterial cross-tolerance testing illustrated in Tables 3A and 3B, show that each of the mutations identified confers tolerance to a variety of protox inhibiting compounds.
- Example 20 Engineering of Plants Tolerant to Protox-inhibiting Herbicides by Homologous
- a fragment of protox DNA containing the desired mutations, but lacking its own expression signals can be introduced by any of several art-recognized methods (for instance, Agrobacterium transformation, direct gene transfer to protoplasts, microprojectile bombardment), and herbicide-tolerant transformants selected.
- the introduced DNA fragment also contains a diagnostic restriction enzyme site or other sequence polymo ⁇ hism that is introduced by site-directed mutagenesis in vitro without changing the encoded amino acid sequence (i.e.
- transformation vectors are available for plant transformation, and the genes of this invention can be used in conjunction with any such vectors.
- the selection of vector for use will depend upon the preferred transformation technique and the target species for transformation. For certain target species, different antibiotic or herbicide selection markers may be preferred. Selection markers used routinely in transformation include the nptll gene, which confers resistance to kanamycin and related antibiotics (Messing & Vierra, Gene 79: 259-268 (1982); Bevan etal, Nature 304:184-187 (1983)), the bar gene, which confers resistance to the herbicide phosphinothricin (White etal, Nucl Acids Res 18: 1062 (1990), Spencer etal.
- vectors are available for transformation using Agrobacterium tumefaciens. These typically carry at least one T-DNA border sequence and include vectors such as pBIN19 (Bevan, Nucl. Acids Res. (1984)) and pXYZ. Below the constmction of two typical vectors is described.
- Constmction of pCIB200 and pCIB2001 The binary vectors pCIB200 and pCIB2001 are used for the constmction of recombinant vectors for use with Agrobacterium and was const cted in the following manner.
- pTJS75kan was created by Narl digestion of pTJS75 (Schmidhauser & Helinski, d Bacteriol.
- Xhol linkers were ligated to the EcoRV fragment of pCIB7, which contains the left and right T-DNA borders, a plant selectable nos/nptll chimeric gene and the pUC polylinker (Rothstein etal, Gene 53: 153-161 (1987)), and the 7o/-digested fragment was cloned into Sa//-digested pTJS75kan to create pCIB200 (see also EP 0332 104, example 19).
- pCIB200 contains the following unique polylinker restriction sites: EcoRI, Sstl, Kpnl, Bglll, Xbal, and Sail pCIB2001 is a derivative of pCIB200, which is created by the insertion into the polylinker of additional restriction sites.
- Unique restriction sites in the polylinker of pCIB2001 are EcoRI, Sstl, Kpnl, Bglll, Xbal, Sail, Mlul, Bell, Avrll, Apal, Hpal, and Stul.
- pCIB2001 in addition to containing these unique restriction sites also has plant and bacterial kanamycin selection, left and right T-DNA borders for transformation, the RK2-derived trfA function for mobilization between E. coli and other hosts, and the O/YTand OriV functions also from RK2.
- the pCIB2001 polylinker is suitable for the cloning of plant expression cassettes containing their own regulatory signals.
- the binary vector pCIBIO contains a gene encoding kanamycin resistance for selection in plants, T- DNA right and left border sequences and inco ⁇ orates sequences from the wide host-range plasmid pRK252 allowing it to replicate in both E. coli and Agrobacterium. Its construction is described by Rothstein etal, Gene 53: 153-161 (1987).
- Various derivatives of pCIBIO have been constmcted that inco ⁇ orate the gene for hygromycin B phosphotransferase described by Gritz et al, Gene 25: 179-188 (1983)). These derivatives enable selection of transgenic plant cells on hygromycin only (pCIB743), or hygromycin and kanamycin (pCIB715, pCIB717).
- Transformation without the use of Agrobacterium tumefaciens circumvents the requirement for T-DNA sequences in the chosen transformation vector and consequently vectors lacking these sequences can be utilized in addition to vectors such as the ones described above that contain T-DNA sequences. Transformation techniques that do not rely on Agrobacterium include transformation via particle bombardment, protoplast uptake (e.g. PEG and electroporation) and microinjection. The choice of vector depends largely on the preferred selection for the species being transformed. Below, the construction of some typical vectors is described.
- pCIB3064 is a pUC-derived vector suitable for direct gene transfer techniques in combination with selection by the herbicide basta (or phosphinothricin).
- the plasmid pCIB246 comprises the CaMV 35S promoter in operational fusion to the E. coli GUS gene and the CaMV 35S transcriptional terminator and is described in the PCT published application WO 93/07278.
- the 35S promoter of this vector contains two ATG sequences 5' of the start site. These sites were mutated using standard PCR techniques in such a way as to remove the ATG's and generate the restriction sites Sspl and Pvull.
- the new restriction sites were 96 and 37-bp away from the unique Sail site and 101 and 42-bp away from the actual start site.
- the resultant derivative of pCIB246 was designated pCIB3025.
- the GUS gene was then excised from pCIB3025 by digestion with Sail and Sacl, the termini rendered blunt and religated to generate plasmid pCIB3060.
- the plasmid pJIT82 was obtained from the John Innes Centre, Norwich and the a 400-bp Smal fragment containing the bar gene from Streptomyces viridochromogenes was excised and inserted into the Hpal site of pCIB3060 (Thompson et al. EMBO J 6: 2519-2523 (1987)).
- This generated pCIB3064 which comprises the bar gene under the control of the CaMV 35S promoter and terminator for herbicide selection, a gene for ampicillin resistance (for selection in E. coli) and a polylinker with the unique sites Sphl, Pstl, Hindlll, and BamHI.
- This vector is suitable for the cloning of plant expression cassettes containing their own regulatory signals.
- pSOG35 is a transformation vector that utilizes the E. coli gene dihydrofolate reductase (DHFR) as a selectable marker conferring resistance to methotrexate.
- DHFR E. coli gene dihydrofolate reductase
- PCR was used to amplify the 35S promoter ( ⁇ 800-bp), intron 6 from the maize Adh1 gene ( ⁇ 550-bp) and 18-bp of the GUS untranslated leader sequence from pSOGIO. A 250-bp fragment encoding the E.
- coli dihydrofolate reductase type II gene was also amplified by PCR and these two PCR fragments were assembled with a Sacl-Pstl fragment from pBI221 (Clontech), which comprised the pUC19 vector backbone and the nopaline synthase terminator. Assembly of these fragments generated pSOG19, which contains the 35S promoter in fusion with the intron 6 sequence, the GUS leader, the DHFR gene and the nopaline synthase terminator. Replacement of the GUS leader in pSOG19 with the leader sequence from Maize Chlorotic Mottle Vims (MCMV) generated the vector pSOG35.
- MCMV Maize Chlorotic Mottle Vims
- pSOG19 and pSOG35 carry the pUC gene for ampicillin resistance and have Hindlll, Sphl, Pstl and EcoRI sites available for the cloning of foreign sequences. 4.
- Example 22 Construction of Plant Expression Cassettes
- Gene sequences intended for expression in transgenic plants are firstly assembled in expression cassettes behind a suitable promoter and upstream of a suitable transcription terminator. These expression cassettes can then be easily transferred to the plant transformation vectors described above in Example 21.
- the selection of a promoter used in expression cassettes will determine the spatial and temporal expression pattern of the transgene in the transgenic plant. Selected promoters will express transgenes in specific cell types (such as leaf epidermal ceils, mesophyll cells, root cortex cells) or in specific tissues or organs (roots, leaves or flowers, for example) and this selection will reflect the desired location of expression of the transgene. Alternatively, the selected promoter may drive expression of the gene under a light-induced or other temporally regulated promoter. A further alternative is that the selected promoter be chemically regulated. This would provide the possibility of inducing expression of the transgene only when desired and caused by treatment with a chemical inducer.
- transcriptional terminators are available for use in expression cassettes. These are responsible for the termination of transcription beyond the transgene and its correct polyadenylation.
- Appropriate transcriptional terminators are those that are known to function in plants and include the CaMV 35S terminator, the tml terminator, the nopaline synthase terminator, the pea rbcS E9 terminator, as well as terminators naturally associated with the plant protox gene (i.e. "protox terminators"). These can be used in both monocotyledons and dicotyledons.
- intron sequences have been found to enhance gene expression from within the transcriptional unit and these sequences can be used in conjunction with the genes of this invention to increase their expression in transgenic plants.
- Various intron sequences have been shown to enhance expression, particularly in monocotyledonous cells.
- the introns of the maize Adhl gene have been found to significantly enhance the expression of the wild-type gene under its cognate promoter when introduced into maize cells.
- Intron 1 was found to be particularly effective and enhanced expression in fusion constructs with the chloramphenicol acetyltransf erase gene (Callis etal, Genes Develop. 1: 1183-1200 (1987)).
- the intron from the maize bronze gene had a similar effect in enhancing expression (Callis etal, supra).
- Intron sequences have been routinely incorporated into plant transformation vectors, typically within the non-translated leader.
- leader sequences derived from viruses are also known to enhance expression, and these are particularly effective in dicotyledonous cells.
- TMV Tobacco Mosaic Virus
- MCMV Maize Chlorotic Mottle Virus
- AMV Alfalfa Mosaic Vims
- Various mechanisms for targeting gene products are known to exist in plants and the sequences controlling the functioning of these mechanisms have been characterized in some detail.
- the targeting of gene products to the chloroplast is controlled by a signal sequence that is found at the amino terminal end of various proteins and that is cleaved during chloroplast import yielding the mature protein (e.g. Comai ef al. J. Biol Chem. 263: 15104-15109 (1988)).
- These signal sequences can be fused to heterologous gene products to effect the import of heterologous products into the chloroplast (van den Broeck et al. Nature 313: 358-363 (1985)).
- DNA encoding for appropriate signal sequences can be isolated from the 5' end of the cDNAs encoding the RUBISCO protein, the CAB protein, the EPSP synthase enzyme, the GS2 protein and many other proteins that are known to be chloroplast localized.
- cDNAs encoding these products can also be manipulated to effect the targeting of heterologous gene products to these organelles. Examples of such sequences are the nuclear-encoded ATPases and specific aspartate amino transferase isoforms for mitochondria. Targeting to cellular protein bodies has been described by Rogers et al, Proc. Natl. Acad. Sci. USA 82. 6512-6516 (1985)).
- sequences have been characterized that cause the targeting of gene products to other cell compartments.
- Amino terminal sequences are responsible for targeting to the ER, the apoplast, and extracellular secretion from aleurone cells (Koehler & Ho, P/atif Cell 2: 769-783 (1990)). Additionally, amino terminal sequences in conjunction with carboxy terminal sequences are responsible for vacuolar targeting of gene products (Shinshi etal, Plant Molec. Biol. 14: 357-368 (1990)).
- the transgene product By the fusion of the appropriate targeting sequences described above to transgene sequences of interest it is possible to direct the transgene product to any organelle or cell compartment.
- chloroplast targeting for example, the chloroplast signal sequence from the RUBISCO gene, the CAB gene, the EPSP synthase gene, or the GS2 gene is fused in frame to the amino terminal ATG of the transgene.
- the signal sequence selected should include the known cleavage site and the fusion constructed should take into account any amino acids after the cleavage site that are required for cleavage. In some cases this requirement may be fulfilled by the addition of a small number of amino acids between the cleavage site and the transgene ATG or alternatively replacement of some amino acids within the transgene sequence.
- Fusions constructed for chloroplast import can be tested for efficacy of chloroplast uptake by in vitro translation of in vitro transcribed constructions followed by in vitro chloroplast uptake using techniques described by (Bartlett etal In: Edelmann etal. (Eds.) Methods in Chloroplast Molecular Biology, Elsevier, pp. 1081-1091 (1982); Wasmann etal. Mol. Gen. Genet. 205: 446-453 (1986)). These construction techniques are well known in the art and are equally applicable to mitochondria and peroxisomes.
- the choice of targeting that may be required for expression of the transgenes will depend on the cellular localization of the precursor required as the starting point for a given pathway. This will usually be cytosolic or chloroplastic, although it may is some cases be mitochondrial or peroxisomal. The products of transgene expression will not normally require targeting to the ER, the apoplast or the vacuole.
- Transformation techniques for dicotyledons are well known in the art and include Agrobacterium-based techniques and techniques that do not require Agrobacterium.
- Non- Agrobacterium techniques involve the uptake of exogenous genetic material directly by protoplasts or cells. This can be accomplished by PEG or electroporation mediated uptake, particle bombardment-mediated delivery, or microinjection. Examples of these techniques are described by Paszkowski et al, EMBO J 3: 2717-2722 (1984), Potrykus et al, Mol. Gen. Genet. 199: 169-177 (1985), Reich et al, Biotechnology 4: 1001-1004 (1986), and Klein et al, Nature 327: 70-73 (1987). In each case the transformed cells are regenerated to whole plants using standard techniques known in the art.
- Agrobacte ⁇ ' itm-mediated transformation is a preferred technique for transformation of dicotyledons because of its high efficiency of transformation and its broad utility with many different species.
- the many crop species that are routinely transformable by Agrobacterium include tobacco, tomato, sunflower, cotton, oilseed rape, potato, soybean, alfalfa and poplar (EP 0 317 511 (cotton), EP 0 249 432 (tomato, to Calgene), WO 87/07299 (Brassica, to Calgene), US 4,795,855 (poplar)).
- Transformation of the target plant species by recombinant Agrobacterium usually involves co-cultivation of the Agrobacterium with explants from the plant and follows protocols well known in the art. Transformed tissue is regenerated on selectable medium carrying the antibiotic or herbicide resistance marker present between the binary plasmid T- DNA borders.
- Transformation of most monocotyledon species has now also become routine.
- Preferred techniques include direct gene transfer into protoplasts using PEG or electroporation techniques, and particle bombardment into callus tissue. Transformations can be undertaken with a single DNA species or multiple DNA species (i.e. co- transformation) and both these techniques are suitable for use with this invention.
- Co- transformation may have the advantage of avoiding complex vector constmction and of generating transgenic plants with unlinked loci for the gene of interest and the selectable marker, enabling the removal of the selectable marker in subsequent generations, should this be regarded desirable.
- a disadvantage of the use of co-transformation is the less than 100% frequency with which separate DNA species are integrated into the genome (Schocher etal. Biotechnology 4: 1093-1096 (1986)).
- Patent Applications EP 0292435 (to Ciba-Geigy), EP 0392225 (to Ciba-Geigy) and WO 93/07278 (to Ciba-Geigy) describe techniques for the preparation of callus and protoplasts from an elite inbred line of maize, transformation of protoplasts using PEG or electroporation, and the regeneration of maize plants from transformed protoplasts.
- Gordon-Kamm etal, Plant Cell 2: 603-618 (1990)) and Fromm etal, Biotechnology 8: 833- 839 (1990)) have published techniques for transformation of A188-derived maize line using particle bombardment.
- Transformation of rice can also be undertaken by direct gene transfer techniques utilizing protoplasts or particle bombardment.
- Protoplast-mediated transformation has been described for Japon/ca-types and Indica-types (Zhang etal, Plant Cell Rep 7: 379-384 (1988); Shimamoto etal. Nature 338: 274-277 (1989); Datta etal. Biotechnology 8: 736-740 (1990)). Both types are also routinely transformable using particle bombardment (Christou et al. Biotechnology 9: 957-962 (1991 )).
- Patent Application EP 0332581 (to Ciba-Geigy) describes techniques for the generation, transformation and regeneration of Pooideae protoplasts. These techniques allow the transformation of Dactylis and wheat. Furthermore, wheat transformation was been described by Vasil etal, Biotechnology 10: 667-674 (1992)) using particle bombardment into cells of type C long-term regenerable callus, and also by Vasil et al, Biotechnology 11: 1553-1558 (1993)) and Weeks etal, Plant Physiol. 102. 1077-1084 (1993) using particle bombardment of immature embryos and immature embryo-derived callus.
- a preferred technique for wheat transformation involves the transformation of wheat by particle bombardment of immature embryos and includes either a high sucrose or a high maltose step prior to gene delivery.
- any number of embryos (0.75-1 mm in length) are plated onto MS medium with 3% sucrose (Murashige & Skoog, Physiologia Plantarum 15: 473-497 (1962)) and 3 mg/l 2,4-D for induction of somatic embryos, which is allowed to proceed in the dark.
- MS medium with 3% sucrose
- 3 mg/l 2,4-D for induction of somatic embryos, which is allowed to proceed in the dark.
- embryos are removed from the induction medium and placed onto the osmoticum (i.e. induction medium with sucrose or maltose added at the desired concentration, typically 15%).
- the embryos are allowed to plasmolyze for 2-3 h and are then bombarded. Twenty embryos per target plate is typical, although not critical.
- An appropriate gene-carrying plasmid (such as pCIB3064 or pSG35) is precipitated onto micrometer size gold particles using standard procedures.
- Each plate of embryos is shot with the DuPont Biolistics> helium device using a burst pressure of -1000 psi using a standard 80 mesh screen. After bombardment, the embryos are placed back into the dark to recover for about 24 h (still on osmoticum). After 24 hrs, the embryos are removed from the osmoticum and placed back onto induction medium where they stay for about a month before regeneration.
- Example 25 Isolation of the Arabidopsis thaliana Protox-1 Promoter Sequence
- a Lambda Zap II genomic DNA library prepared from Arabidopsis thaliana (Columbia, whole plant) was purchased from Stratagene. Approximately 125,000 phage were plated at a density of 25,000 pfu per 15 cm Petri dish and duplicate lifts were made onto Colony/Plaque Screen membranes (NEN Dupont). The plaque lifts were probed with the Arabidopsis protox-1 cDNA (SEQ ID NO:1 labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization and wash conditions were at 65°C as described in Church and Gilbert, Proc. Natl. Acad. Sci. USA 81: 1991-1995 (1984).
- Positively hybridizing plaques were purified and in vivo excised into pBluescript plasmids. Sequence from the genomic DNA inserts was determined by the chain termination method using dideoxy terminators labeled with fluorescent dyes (Applied Biosystems, Inc.). One clone, AraPTI Pro, was determined to contain 580-bp of Arabidopsis sequence upstream from the initiating methionine (ATG) of the protox-1 protein coding sequence. This clone also contains coding sequence and introns that extend to-bp 1241 of the protox-1 cDNA sequence. The 580-bp 5' noncoding fragment is the putative Arabidopsis protox-1 promoter, and the sequence is set forth in SEQ ID NO:13.
- AraPTI Pro was deposited December 15, 1995, as pWDC-11 (NRRL #B-21515)
- a full-length cDNA of the appropriate altered Arabidopsis protox-1 cDNA was isolated as an EcoRI-Xhol partial digest fragment and cloned into the plant expression vector pCGN1761 ENX (see Example 9 of International application no. PCT/IB95/00452 filed June 8, 1995, published Dec. 21 , 1995 as WO 95/34659).
- This plasmid was digested with Ncol and BamHI to produce a fragment comprised of the complete protox-1 cDNA plus a transcription terminator from the 3' untranslated sequence of the tml gene of Agrobacterium tumefaciens.
- the AraPTI Pro plasmid described above was digested with Ncol and BamHI to produce a fragment comprised of pBluescript and the 580-bp putative Arabidopsis protox-1 promoter. Ligation of these two fragments produced a fusion of the altered protox cDNA to the native protox promoter.
- the expression cassette containing the protox-1 promoter/protox-1 cDNA/fm/ terminator fusion was excised by digestion with Kpnl and cloned into the binary vector pCIB200.
- the binary plasmid was transformed by electroporation into Agrobacterium and then into Arabidopsis using the vacuum infiltration method (Bechtold etal, C.R. Acad. Sci. Paris 316: 1194-1199 (1993). Transformants expressing altered protox genes were selected on kanamycin or on various concentrations of protox inhibiting herbicide.
- an Arabidopsis protox-1 cDNA containing a TAC to ATG (Tyrosine to Methionine) change at nucleotides 1306-1308 in the protox-1 sequence (SEQ ID NO:1) was fused to the native protox-1 promoter fragment and transformed into Arabidopsis thaliana.
- This altered protox-1 enzyme (AraC-2Met) has been shown to be >10-fold more tolerant to various protox-inhibiting herbicides than the naturally occurring enzyme when tested in the previously described bacterial expression system. Seed from the vacuum infiltrated plants was collected and plated on a range (10.0nM- 1.OuM) of a protox inhibitory aryluracil herbicide of formula XVII.
- EXAMPLE 28 Demonstration of resistant mutations' cross-tolerance to various protox- inhibiting compounds in an Arabidopsis germination assay.
- an Arabidopsis protox-1 cDNA containing both a TAC to ATC (tyrosine to isoleucine) change at nucleotides 1306-1308 and a TCA to TTA (serine to leucine) change at nucleotides 945-947 in the protox-1 sequence (SEQ ID NO:1) was fused to the native protox-1 promoter fragment and transformed into Arabidopsis thaliana.
- This altered protox-1 enzyme (AraC-2lle + AraC305Leu) has been shown to be >10-fold more tolerant to a protox inhibitory aryluracil herbicide of formula XVII than the naturally occurring enzyme when tested in a bacterial system (see Examples 9-13).
- Homozygous Arabidopsis lines containing this fusion were generated from transformants that showed high tolerance to a protox inhibiting herbicide in a seedling germination assay as described above.
- the seed from one line was tested for cross-tolerance to various protox-inhibitory compounds by repeating the germination assay on concentrations of the compounds that had been shown to inhibit germination of wild-type Arabidopsis.
- the results from these experiments are shown in Table 4. 7.
- Example 29 Isolation of a Maize Protox-1 Promoter Sequence
- a Zea Mays (Missouri 17 inbred, etiolated seedlings) genomic DNA library in the Lambda FIX II vector was purchased from Stratagene. Approximately 250,000 pfu of the library was plated at a density of 50,000 phage per 15 cm plate and duplicate lifts were made onto Colony/Plaque screen membranes (NEN Dupont). The plaque lifts were probed with the maize protox-1 cDNA (SEQ ID NO:5) labeled with 32P-dCTP by the random priming method (Life Technologies). Hybridization and wash conditions were at 65°C as described in Church and Gilbert, Proc. Natl. Acad. Sci. USA 87: 1991-1995 (1984).
- Lambda phage DNA was isolated from three positively hybridizing phage using the Wizard Lambda Preps DNA Purification System (Promega). Analysis by restriction digest, hybridization patterns, and DNA sequence analysis identified a lambda clone containing approximately 3.5 kb of maize genomic DNA located 5' to the maize protox-1 coding sequence previously isolated as a cDNA clone. This fragment includes the maize protox-1 promoter. The sequence of this fragment is set forth in SEQ ID NO:14. From nucleotide 1 to 3532, this sequence is comprised of 5' noncoding sequence. From nucleotide 3533 to 3848, this sequence encodes the 5' end of the maize protox-1 protein.
- a plasmid containing the sequence of SEQ ID NO:14 fused to the remainder of the maize protox-1 coding sequence was deposited March 19, 1996 as pWDC-14 (NRRL #B- 21546).
- the 3848-bp maize genomic fragment (SEQ ID NO:14) was excised from the isolated lambda phage clone as a Sa//-Kpnl partial digest product and ligated to a Kpnl-Notl fragment derived from an altered maize protox-1 cDNA that contained an alanine to leucine change at amino acid 164 (SEQ ID NO:6). This created a fusion of the native maize protox- 1 promoter to a full length cDNA that had been shown to confer herbicide tolerance in a bacterial system (Examples 9-14).
- This fusion was cloned into a pUC18 derived vector containing the CaMV 35S terminator sequence to create a protox promoter/altered protox cDNA/terminator cassette.
- the plasmid containing this cassette was designated pWCo-1.
- a second constmct for maize transformation was created by engineering the first intron found in the coding sequence from the maize genomic clone back into the maize cDNA. The insertion was made using standard overlapping PCR fusion techniques.
- the intron (SEQ ID NO:25) was 93-bp long and was inserted between nucleotides 203 and 204 of SEQ ID NO:6, exactly as it appeared in natural context in the lambda clone described in Example 29. This intron-containing version of the expression cassette was designated pWCo-2.
- RNA's from the transgenic maize plants were also subjected to standard northern blot analysis using the radiolabeled maize protox cDNA fragment from SEQ ID NO:6 as a probe.
- Protox-1 mRNA levels significantly above those of untransformed controls were detected in some of the transgenic maize plants. This elevated mRNA level is presumed to be due to expression of altered protox-1 mRNA from the cloned maize protox promoter.
- a genomic sugar beet library was prepared by Stratagene in the Lambda Fix II vector. Approximately 300,000 pfu of the library was plated and probed with the sugar beet protox- 1 cDNA sequence (SEQ ID NO:17) as described for maize in Example 29. Analysis by restriction digest, hybridization patterns and DNA sequence analysis identified a lambda clone containing approximately 7 kb of sugar beet genomic DNA located 5' to the sugar beet coding sequence previously isolated as a cDNA clone. A Pstl-Sall fragment of 2606- bp was subcloned from the lambda clone into a pBluescript vector.
- This fragment contains 2068-bp of 5' noncoding sequence and includes the sugar beet protox-1 promoter sequence. It also includes the first 453-bp of the protox-1 coding sequence and the 85-bp first intron contained in the coding sequence.
- the sequence of this fragment is set forth in SEQ ID NO:26.
- a plasmid containing the sequence of SEQ ID NO:26 was deposited December 6, 1996 as pWDC-20 (NRRL #B-21650).
- Example 33 Construction of Plant Transformation Vectors Expressing Altered Sugar Beet Protox-1 Genes Behind the Native Sugar Beet Protox-1 Promoter
- the sugar beet genomic fragment (SEQ ID NO:26) was excised from the genomic subclone described in Example 32 as a Sacl-BsrGI fragment that includes 2068-bp of 5' noncoding sequence and the first 300-bp of the sugar beet protox-1 coding sequence. This fragment was ligated to a BsrGI-Notl fragment derived from an altered sugar beet protox-1 cDNA that contained a tyrosine to methionine change at amino acid 449 (SEQ ID NO:18). This created a fusion of the native sugar beet protox-1 promoter to a full length cDNA that had been shown to confer herbicide tolerance in a bacterial system (Examples 9-14).
- This fusion was cloned into a pUC18 derived vector containing the CaMV 35S terminator sequence to create a protox promoter/altered protox cDNA terminator cassette.
- the plasmid containing this cassette was designated pWCo-3.
- Example 34 Production of Herbicide Tolerant Plants by Expression of a Native Sugar Beet Protox-1 Promoter/Altered Sugar Beet Protox-1 Fusion
- the expression cassette from pWCo-3 is transformed into sugar beet using any of the transformation methods applicable to dicot plants, including Agrobacterium, protoplast, and biolistic transformation techniques.
- Transgenic sugar beets expressing the altered protox-1 enzyme are identified by RNA-PCR and tested for tolerance to protox-inhibiting herbicides at concentrations that are lethal to untransformed sugar beets.
- This PCR reaction was undertaken with Pfu thermostable DNA polymerase (Stratagene, La Jolla CA) in a Perkin Elmer Thermal Cycler 480 according to the manufacturer's recommendations (Perkin Elmer/Roche, Branchburg, NJ) as follows: 7 min 95°C, followed by 4 cycles of 1 min 95°C / 2 min 43°C / 1 min 72°C, then 25 cycles of 1 min 95°C / 2 min 55°C / 1 min 72°C.
- the 213-bp amplification product comprising the promoter and 5' untranslated region of the clpP gene containing an EcoRI site at its left end and an Ncol site at its right end and corresponding to nucleotides 74700 to 74505 of the N.
- tabacum plastid DNA sequence (Shinozaki etal, EMBO d. 5: 2043-2049 (1986)) was gel purified using standard procedures and digested with EcoRI and Ncol (all restriction enzymes were purchased from New England Biolabs, Beverly, MA).
- GCGICJAGATCAACCGAAATTCAATTAAGG-3' (SEQ ID ⁇ O:30); Xbal restriction site underlined) and a right-to-left "bottom strand" primer homologous to the region from +134 to +151 relative to the TAA stop codon of ⁇ s76that inco ⁇ orates an introduced Hindlll restriction site at the 3' end of the ⁇ s16 ' UTR (primer ⁇ s16P_1b (5'- CGCAAGCTTCAATGGAAGCAATGATAA-3' (SEQ ID NO:31); Hindlll restriction site underlined).
- the 169-bp amplification product comprising the 3' untranslated region of the ⁇ s76gene containing an Xbal site at its left end and a Hindlll site at its right end and containing the region corresponding to nucleotides 4943 to 5093 of the N. tabacum plastid D ⁇ A sequence (Shinozaki etal, 1986) was gel purified and digested with Xbal and Hindlll
- GUS ⁇ -glucuronidase reporter gene fragment derived from plasmid pRAJ275 (Clontech) containing an Ncol restriction site at the ATG start codon and an Xbal site following the native 3' UTR was produced by digestion with Ncol and Xbal This fragment was ligated in a four-way reaction to the 201 -bp EcoRIINcol clpP promoter fragment, the 157-bp Xball Hindlll ⁇ s763'UTR fragment, and a 3148-bp EcoRIIHIndlll fragment from cloning vector pGEM3Zf(-) (Promega, Madison WI) to construct plasmid pPH138.
- GUS ⁇ -glucuronidase
- Plastid transformation vector pPH140 was constructed by digesting plasmid pPRV111a (Zoubenko etal. 1994) with EcoRI and Hindlll and ligating the resulting 7287-bp fragment to a 2222-bp EcoRUHindlll fragment of pPH138.
- Example 36 Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP Gene
- GCGICTAGAAAGAACTAAATACTATATTTCAC-3' (SEQ ID NO:29); Xbal restriction site underlined).
- the 202-bp amplification product comprising the promoter and truncated 5' UTR of the clpP gene containing an EcoRI site at its left end and an Xbal site at its right end was gel purified and digested with Xbal. The Xbal site was subsequently filled in with Klenow DNA polymerase (New England Biolabs) and the fragment digested with EcoRI.
- GGGAGTCCCTGATGATTAAATAAACCAAGATTTTAC-3' (SEQ ID NO:32)) and minpsb.L (bottom strand: 5'-CATGGTAA TCTTGGTTrATTTAATCATCAGGGACTCCC-3' (SEQ ID NO:33); Ncol restriction site 5' overhang underlined), the NcollXbal GUS reporter gene fragment described above, the XballHindlll rps163'UTR fragment described above, and the EcoRI/Hindlll pGEM3Zf(-) fragment described above to construct plasmid pPH139.
- Plastid transformation vector pPH144 was constmcted by digesting plasmid pPRVI 11a (Zoubenko, etal, Nucleic Acids Res 22: 3819-3824 (1994)) with EcoRI and Hindlll and ligating the resulting 7287-bp fragment to a 2251 -bp EcoRI/Hindlll fragment of pPH139.
- the 778-bp product was digested with Ncol and Sful and the resulting 682-bp fragment ligated to an 844-bp Sful/Notl DNA fragment of AraC-2Met comprising the 3' portion of the protox coding sequence and a 2978-bp NcollNotl fragment of the cloning vector pGEM5Zf(+) (Promega, Madison WI) to construct plasmid pPH141.
- Plastid transformation vector pPH143 containing the clpP promoter driving the Formula XVII-resistant AraC-2Met protox gene with the ⁇ s163' UTR was constructed by digesting pPH141 with Ncol and Sspl and isolating the 1491 -bp fragment containing the complete protox coding sequence, digesting the rps16P_1a and rps16P_1 b PCR product described above with Hindlll, and ligating these to a 7436-bp Ncoll Hindlll fragment of pPH140.
- Plastid transformation vector pPH145 containing the clpP promoter/psM 5' UTR fusion driving the Formula XVII-resistant AraC-2Met protox gene with the rps163' UTR was constructed by digesting pPH141 with Ncol and Sspl and isolating the 1491-bp fragment containing the complete protox coding sequence, digesting the ⁇ s16P_1a and ⁇ s16P_1b PCR product described above with Hindlll, and ligating these to a 7465-bp NcollHindlll fragment of pPH144.
- a cDNA library is screened for the 5-enolpyruvyl-3-phosphoshikimate synthase (EPSP synthase) gene (U.S. Patent Nos. 5,310,667, 5,312,910, and 5,633,435, all incorporated herein by reference).
- EPSP synthase 5-enolpyruvyl-3-phosphoshikimate synthase
- a plasmid clone containing the full length EPSP synthase gene cDNA is isolated by standard techniques of molecular cloning.
- PCR primers are designed for amplification of the mature-size EPSP synthase coding sequence from this plasmid using a top strand primer having a 5' extension containing an Ncol restriction site inserted at amino acid -1 from the deduced mature protein start, thus creating an ATG start codon at this position, and a bottom strand primer having a 5' extension containing an Xbal restriction site downstream of the stop codon of the EPSP mature coding sequence in the amplified PCR product.
- the PCR amplification is performed using the designated primers and plasmid DNA template according to standard protocols.
- Amplified products are cloned and sequenced and a Ncol-Xbal DNA fragment containing the complete mature EPSP synthase coding sequence is isolated by restriction digest with Ncol and Xbal, electrophoresis on a 0.8% TAE agarose gel, and phenol extraction of the excised band.
- a plastid transformation vector containing the clpP promoter directing transcription of the mature-sized EPSP synthase gene with the rps163' UTR is constmcted by digesting pPH140 with Ncol and Xbal and purifying the fragment containing the vector backbone, 5' and 3' plastid integration targeting sequences, aadA selectable marker cassette, and clpP promoter/ ⁇ s763' UTR expression sequences. This product is ligated in a two-way reaction with the Ncol-Xbal DNA fragment containing the mature-sized EPSP synthase coding sequence isolated as described above.
- Example 40 Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP Gene
- a cDNA library is screened for the acetolactate synthase (ALS) gene (U.S. Patent No.5,013,659).
- a plasmid clone containing the full length ALS gene cDNA is isolated by standard techniques of molecular cloning.
- PCR primers are designed for amplification of the mature-size ALS coding sequence from this plasmid using a top strand primer having a 5' extension containing an Ncol restriction site inserted at amino acid -1 from the deduced mature protein start, thus creating an ATG start codon at this position, and a bottom strand primer having a 5' extension containing an Xbal restriction site downstream of the stop codon of the ALS mature coding sequence in the amplified PCR product.
- the PCR amplification is performed using the designated primers and plasmid DNA template according to standard protocols. Amplified products are cloned and sequenced and a Ncol- Xbal DNA fragment containing the complete mature ALS coding sequence is isolated by restriction digest with Ncol and Xbal, electrophoresis on a 0.8% TAE agarose gel, and phenol extraction of the excised band.
- a plastid transformation vector containing the clpP promoter driving the mature-sized ALS gene with the rps163' UTR is constructed by digesting pPH140 with Ncol and Xbal and purifying the fragment containing the vector backbone, 5' and 3' plastid integration targeting sequences, aadA selectable marker cassette, and clpP promoter / rps163' UTR expression sequences. This product is ligated in a two-way reaction with the Ncol-Xbal DNA fragment containing the mature-sized ALS coding sequence isolated as described above.
- a cDNA library is screened for the acetohydroxyacid synthase (AHAS) gene (U.S. Patent No. 4,761 ,373).
- AHAS acetohydroxyacid synthase
- a plasmid clone containing the full length AHAS gene cDNA is isolated by standard techniques of molecular cloning.
- PCR primers are designed for amplification of the mature-size AHAS coding sequence from this plasmid using a top strand primer having a 5' extension containing an Ncol restriction site inserted at amino acid -1 from the deduced mature protein start, thus creating an ATG start codon at this position, and a bottom strand primer having a 5' extension containing an Xbal restriction site downstream of the stop codon of the AHAS mature coding sequence in the amplified PCR product.
- the PCR amplification is performed using the designated primers and plasmid DNA template according to standard protocols.
- Amplified products are cloned and sequenced and a Ncol-Xbal DNA fragment containing the complete mature AHAS coding sequence is isolated by restriction digest with Ncol and Xbal, electrophoresis on a 0.8% TAE agarose gel, and phenol extraction of the excised band.
- a plastid transformation vector containing the clpP promoter driving the mature-sized AHAS gene with the rps163' UTR is constructed by digesting pPH140 with Ncol and Xbal and purifying the fragment containing the vector backbone, 5' and 3' plastid integration targeting sequences, aadA selectable marker cassette, and clpP promoter / ⁇ s763' UTR expression sequences. This product is ligated in a two-way reaction with the Ncol-Xbal DNA fragment containing the mature-sized AHAS coding sequence isolated as described above.
- Example 42 Preparation of a Chimeric Gene Containing the Tobacco Plastid clpP Gene Promoter and 5' Untranslated Sequence Fused to the ACCase Coding Sequence and Plastid ⁇ s76 Gene 3' Untranslated Sequence in a Vector for Tobacco Plastid Transformation
- a cDNA library is screened for the acetylcoenzyme A carboxylase (ACCase) gene (U.S. Patent No. 5,162,602).
- ACCase acetylcoenzyme A carboxylase
- U.S. Patent No. 5,162,602 A plasmid clone containing the full length ACCase gene cDNA is isolated by standard techniques of molecular cloning.
- PCR primers are designed for amplification of the mature-size ACCase coding sequence from this plasmid using a top strand primer having a 5' extension containing an Ncol restriction site inserted at amino acid -1 from the deduced mature protein start, thus creating an ATG start codon at this position, and a bottom strand primer having a 5' extension containing an Xbal restriction site downstream of the stop codon of the ACCase mature coding sequence in the amplified PCR product.
- the PCR amplification is performed using the designated primers and plasmid DNA template according to standard protocols.
- Amplified products are cloned and sequenced and a Ncol-Xbal DNA fragment containing the complete mature ACCase coding sequence is isolated by restriction digest with Ncol and Xbal, electrophoresis on a 0.8% TAE agarose gel, and phenol extraction of the excised band.
- a plastid transformation vector containing the clpP promoter driving the mature-sized ACCase gene with the ⁇ s163' UTR is constmcted by digesting pPH140 with Ncol and Xbal and purifying the fragment containing the vector backbone, 5' and 3' plastid integration targeting sequences, aadA selectable marker cassette, and clpP promoter / ⁇ s163' UTR expression sequences. This product is ligated in a two-way reaction with the Ncol-Xbal DNA fragment containing the mature-sized ACCase coding sequence isolated as described above.
- Nicotiana tabacum c.v. 'Xanthi nc' were germinated seven per plate in a 1" circular array on T agar medium and bombarded 12-14 days after sowing with 1 ⁇ m tungsten particles (M10, Biorad, Hercules, CA) coated with DNA from plasmids pPH143 and pPH145 essentially as described in Svab, Z. and Maliga, P. (1993) PNAS 90, 913-917.
- Type I embryogenic callus cultures (Green ef al (1983) in A. Fazelahmad, K. Downey, J. Schultz, R.W. Voellmy, eds. Advances in Gene Technology: Molecular Genetics of Plants and Animals. Miami Winter Symposium Series, Vol. 20. Academic Press, N.Y.) of the proprietary genotypes CG00526 and CG00714 are initiated from immature embryos, 1.5 - 2.5 mm in length, from greenhouse grown material. Embryos are aseptically excised from surface-sterilized ears approximately 14 days after pollination.
- Embryos of CG00526 are placed on D callus initiation media with 2% sucrose and 5mg/L chloramben (Duncan etal. (1985) Planta 165: 322-332) while those of CG00714 are placed onto KM callus initiation media with 3% sucrose and 0.75mg/L 2,4-d (Kao and Michayluk (1975) Planta 126, 105-110). Embryos and embryogenic cultures are subsequently cultured in the dark. Embryogenic responses are removed from the explants after -14 days.
- CG00526 responses are placed onto D callus maintenance media with 2% sucrose and 0.5mg/L 2,4-d while those of CG00714 are placed onto KM callus maintenance media with 2% sucrose and 5mg/L Dicamba.
- KM callus maintenance media with 2% sucrose and 5mg/L Dicamba.
- high quality compact embryogenic cultures are established. Actively growing embryogenic callus pieces are selected as target tissue for gene delivery.
- the callus pieces are plated onto target plates containing maintenance medium with 12% sucrose approximately 4 hours prior to gene delivery.
- the callus pieces are arranged in circles, with radii of 8 and 10mm from the center of the target plate. Plasmid DNA is precipitated onto gold microcarriers as described in the DuPont Biolistics manual.
- each plasmid Two to three ⁇ g of each plasmid is used in each 6 shot microcarrier preparation. Genes are delivered to the target tissue cells using the PDS-1000He Biolistics device. The settings on the Biolistics device are as follows: 8 mm between the rupture disc and the macrocarrier, 10 mm between the macrocarrier and the stopping screen and 7 cm between the stopping screen and the target. Each target plate is shot twice using 650psi rupture discs. A 200 X 200 stainless steel mesh (McMaster-Carr, New Bmnswick, NJ) is placed between the stopping screen and the target tissue.
- the bombed callus pieces are transferred to maintenance medium with 2% sucrose and 0.5mg/L 2,4-d, but without amino acids, and containing 750 or 1000 nM Formula XVII.
- the callus pieces are placed for 1 hour on the light shelf 4-5 hours after transfer or on the next day, and stored in the dark at 27°C for 5-6 weeks.
- yellow to white tissue is transferred to fresh plates containing the same medium supplemented with 500 or 750 nM Formula XVII. 4-5 hours after transfer or on the next day, the tissues are placed for 1 hour on the light shelf and stored in the dark at 27°C for 3-4 weeks.
- the tissues are transferred to plates containing the same medium supplemented with 500 nM Formula XVII. Healthy growing tissue is placed for 1 hour on the light shelf and stored in the dark at 27°C. It is subcultured every two weeks until the colonies are large enough for regeneration. At that point, colonies are transferred to a modified MS medium (Murashige and Skoog (1962) Physiol. Plant 15: 473-497) containing 3% sucrose (MS3S) with no selection agent and placed in the light.
- MS medium Merashige and Skoog (1962) Physiol. Plant 15: 473-497
- CG00526 0.25mg/L ancymidol and 0.5mg/L kinetin are added to this medium to induce embryo germination, while for CG00714, 2mg/L benzyl adenine is added.
- Regenerating colonies are transferred to MS3S media without ancymidol and kinetin, or benzyl adenine, for CG00526 or CG00714, respectively, after 2 weeks.
- Regenerating shoots with or without roots are transferred to boxes containing MS3S medium and small plants with roots are eventually recovered and transferred to soil in the greenhouse.
- Soybeanptl ILRCSIAEES TASPPKTR. DSA...PVDC VWGGGVSGL CIAQALATKH
- Cottonpt-1 AVDSGLKDDL VLGDPNAPRF VLWEGKLRPV PSKPTDLPFF DLMSIAGKLR
- I I I I : I I • : • I I I I I I I I I I : : I • I • : : I - : I I • I : • 101 MTEGEWEASRLIDDLGLQDKQQYPNSQHKRYIVKDGAPALIPSDPISLMK 150
- Applicanfsoragenfs _ lie out ..., . m -,,- International applica -Jo. dereference PB, ⁇ -30911 A/RTP
Landscapes
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US373691 | 1995-01-17 | ||
US37369199A | 1999-08-13 | 1999-08-13 | |
PCT/EP2000/006127 WO2001012825A1 (en) | 1999-08-13 | 2000-06-30 | Herbicide-tolerant protoporphyrinogen oxidase |
Publications (1)
Publication Number | Publication Date |
---|---|
EP1200611A1 true EP1200611A1 (de) | 2002-05-02 |
Family
ID=23473465
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP00940419A Withdrawn EP1200611A1 (de) | 1999-08-13 | 2000-06-30 | Herbizid-resistente protoporphyrinogen oxidase |
Country Status (7)
Country | Link |
---|---|
EP (1) | EP1200611A1 (de) |
JP (1) | JP2003507019A (de) |
CN (1) | CN1373811A (de) |
AR (1) | AR024642A1 (de) |
AU (1) | AU5536000A (de) |
CA (1) | CA2381927A1 (de) |
WO (1) | WO2001012825A1 (de) |
Families Citing this family (92)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
BRPI0409816B8 (pt) | 2003-04-29 | 2022-12-06 | Pioneer Hi Bred Int | Genes de glifosato-n-acetiltransferase (gat), construtos os compreendendo, célula bacteriana, polipeptídeo tendo atividade de gat, bem como método para a produção de uma planta transgênica resistente ao glifosato e métodos para controlar ervas daninhas em um campo contendo uma safra |
JP4720223B2 (ja) | 2004-05-18 | 2011-07-13 | 住友化学株式会社 | 除草活性化合物耐性植物 |
WO2006119318A2 (en) | 2005-05-02 | 2006-11-09 | Purdue Research Foundation | Methods for increasing the yield of fermentable sugars from plant stover |
NZ571115A (en) | 2006-03-02 | 2011-11-25 | Athenix Corp | Method and compositions for improved enzyme activity in transgenic plant |
US7951995B2 (en) | 2006-06-28 | 2011-05-31 | Pioneer Hi-Bred International, Inc. | Soybean event 3560.4.3.5 and compositions and methods for the identification and detection thereof |
EA021541B9 (ru) * | 2007-04-04 | 2017-04-28 | Басф Плант Сайенс Гмбх | Рекомбинантный или мутантный полинуклеотид для придания растениям толерантности к гербицидам, ингибирующим ацетогидроксикислотную синтазу (ahas) (варианты), растение, не встречающееся в природе, и его семена, способ борьбы с сорняками, способ получения трансгенного растения, толерантного к соединениям, ингибирующим ahas, способ идентификации или отбора клетки растения, ткани растения или растения или части растения, способ предотвращения нежелательного вегетативного роста и способ идентификации растения |
US7964774B2 (en) | 2008-05-14 | 2011-06-21 | Monsanto Technology Llc | Plants and seeds of spring canola variety SCV384196 |
US8697941B2 (en) | 2008-07-23 | 2014-04-15 | Pioneer Hi-Bred International, Inc. | Molecular markers linked to PPO inhibitor tolerance in soybeans |
US8748695B2 (en) | 2008-07-23 | 2014-06-10 | Pioneer Hi-Bred International, Inc. | Molecular markers linked to PPO inhibitor tolerance in soybeans |
AP2011005671A0 (en) | 2008-09-26 | 2011-04-30 | Basf Agrochemical Products Bv | Herbicide-resistant AHAS-mutants and methods of use. |
US8373025B2 (en) | 2009-02-09 | 2013-02-12 | Chromatin Germplasm, Llc | Herbicide resistant sorghum |
MX2011013224A (es) | 2009-06-09 | 2012-06-01 | Pioneer Hi Bred Int | Promotor de endospermo temprano y metodos de uso. |
JP2011083260A (ja) * | 2009-10-19 | 2011-04-28 | Chubu Electric Power Co Inc | キク属植物およびその作出方法 |
CN102597244B (zh) | 2009-10-26 | 2014-07-23 | 先锋国际良种公司 | 胚珠体细胞特异性启动子及应用方法 |
US9611485B2 (en) | 2010-01-26 | 2017-04-04 | Pioneer Hi-Bred International, Inc. | Polynucleotide and polypeptide sequences associated with herbicide tolerance |
WO2013028188A1 (en) * | 2011-08-24 | 2013-02-28 | Cibus Us Llc | Mutated protoporphyrinogen ix oxidase (ppx) genes |
BR112013003135A2 (pt) | 2010-08-13 | 2017-11-07 | Pioneer Hi Bred Int | polinucletídeo e polipeptídeo isolado ou recombinante, construto de ácido nucleico, célula, planta, explante vegetal, semente transgênica, método para produção de célula vegetal para controle de plantas daninhas e para detecção de um polipeptídeo hppd e um polinucleotídeo. |
CA2810180C (en) | 2010-11-24 | 2015-07-28 | Pioneer Hi-Bred International, Inc. | Brassica gat event dp-073496-4 and compositions and methods for the identification and/or detection thereof |
WO2012071039A1 (en) | 2010-11-24 | 2012-05-31 | Pioner Hi-Bred International, Inc. | Brassica gat event dp-061061-7 and compositions and methods for the identification and/or detection thereof |
TWI667347B (zh) | 2010-12-15 | 2019-08-01 | 瑞士商先正達合夥公司 | 大豆品種syht0h2及偵測其之組合物及方法 |
US8785729B2 (en) | 2011-08-09 | 2014-07-22 | Nunhems, B.V. | Lettuce variety redglace |
US8754293B2 (en) | 2011-09-09 | 2014-06-17 | Nunhems B.V. | Lettuce variety intred |
WO2013040033A1 (en) | 2011-09-13 | 2013-03-21 | Monsanto Technology Llc | Methods and compositions for weed control |
CN103958686A (zh) | 2011-09-13 | 2014-07-30 | 孟山都技术公司 | 用于杂草控制的方法和组合物 |
UA116088C2 (uk) | 2011-09-13 | 2018-02-12 | Монсанто Текнолоджи Ллс | Спосіб та композиція для боротьби з бур'янами (варіанти) |
MX343071B (es) | 2011-09-13 | 2016-10-21 | Monsanto Technology Llc | Metodos y composiciones para el control de malezas. |
CA2848689A1 (en) | 2011-09-13 | 2013-03-21 | Monsanto Technology Llc | Methods and compositions for weed control targeting pds |
EP2756085B1 (de) | 2011-09-13 | 2019-03-20 | Monsanto Technology LLC | Verfahren und zusammensetzungen zur unkrautbekämpfung |
CN103958539B (zh) | 2011-09-13 | 2019-12-17 | 孟山都技术公司 | 用于杂草控制的方法和组合物 |
ES2645927T3 (es) | 2011-09-13 | 2017-12-11 | Monsanto Technology Llc | Procedimientos y composiciones para el control de malezas |
WO2013096818A1 (en) | 2011-12-21 | 2013-06-27 | The Curators Of The University Of Missouri | Soybean variety s05-11268 |
WO2013096810A1 (en) | 2011-12-21 | 2013-06-27 | The Curators Of The University Of Missouri | Soybean variety s05-11482 |
US9380756B2 (en) | 2012-01-04 | 2016-07-05 | Nunhems B.V. | Lettuce variety multigreen 50 |
CA2860783A1 (en) | 2012-01-06 | 2013-07-11 | Pioneer Hi-Bred International, Inc. | Ovule specific promoter and methods of use |
US9006515B2 (en) | 2012-01-06 | 2015-04-14 | Pioneer Hi Bred International Inc | Pollen preferred promoters and methods of use |
AU2013209738A1 (en) | 2012-01-17 | 2014-08-07 | Australian Center For Plant Functional Genomics, Pty, Ltd | Plant transcription factors, promoters and uses thereof |
CN104703998B (zh) | 2012-03-13 | 2020-08-21 | 先锋国际良种公司 | 植物中雄性育性的遗传减少 |
WO2013138309A1 (en) | 2012-03-13 | 2013-09-19 | Pioneer Hi-Bred International, Inc. | Genetic reduction of male fertility in plants |
US8859857B2 (en) | 2012-04-26 | 2014-10-14 | Monsanto Technology Llc | Plants and seeds of spring canola variety SCV259778 |
US8835720B2 (en) | 2012-04-26 | 2014-09-16 | Monsanto Technology Llc | Plants and seeds of spring canola variety SCV967592 |
US8878009B2 (en) | 2012-04-26 | 2014-11-04 | Monsanto Technology, LLP | Plants and seeds of spring canola variety SCV318181 |
WO2013188291A2 (en) | 2012-06-15 | 2013-12-19 | E. I. Du Pont De Nemours And Company | Methods and compositions involving als variants with native substrate preference |
AR091489A1 (es) * | 2012-06-19 | 2015-02-11 | Basf Se | Plantas que tienen una mayor tolerancia a herbicidas inhibidores de la protoporfirinogeno oxidasa (ppo) |
US20150259696A1 (en) | 2012-10-11 | 2015-09-17 | Shane E. Abbitt | Guard cell promoters and uses thereof |
US20140173781A1 (en) | 2012-12-13 | 2014-06-19 | Pioneer Hi-Bred International, Inc. | Methods and compositions for producing and selecting transgenic wheat plants |
AU2013361220A1 (en) | 2012-12-21 | 2015-04-02 | Pioneer Hi-Bred International, Inc. | Compositions and methods for auxin-analog conjugation |
US9713332B2 (en) | 2013-03-13 | 2017-07-25 | Pioneer Hi-Bred International, Inc. | Glyphosate application for weed control in Brassica |
BR112015023304A2 (pt) | 2013-03-14 | 2017-07-18 | Pioneer Hi Bred Int | método para melhorar a tolerância ao estresse abiótico de uma planta, planta e semente |
UA121847C2 (uk) | 2013-03-14 | 2020-08-10 | Піонір Хай-Бред Інтернешнл Інк. | Полінуклеотид, що кодує елемент сайленсингу з інсектицидною активністю проти шкідника рослин із ряду coleoptera, та спосіб його застосування |
BR112015023286A2 (pt) | 2013-03-14 | 2018-03-06 | Arzeda Corp | polipeptídeo recombinante com atividade da dicamba descarboxilase, construto de polinucleotídeo, célula, método de produção de uma célula hospedeira compreendendo um polinucleotídeo heterólogo que codifica um polipeptídeo tendo atividade da dicamba descarboxilase, método para descarboxilar dicamba, um derivado de dicamba ou um metabolito de dicamba, método para a detecção de um polipeptideo e método para a detecção da presença de um polinucleotideo que codifica um polipeptideo tendo atividade da dicamba descarboxilase |
US20140289906A1 (en) | 2013-03-14 | 2014-09-25 | Pioneer Hi-Bred International, Inc. | Compositions Having Dicamba Decarboxylase Activity and Methods of Use |
BR112015023700A2 (pt) | 2013-03-15 | 2017-07-18 | Pioneer Hi Bred Int | método de aprimoramento da tolerância ao estresse abiótico em uma planta de cultura agrícola , planta de milho transgênica, célula vegetal, semente, método de regulação negativa de um gene de acc oxidase endógeno em uma planta de milho. |
WO2014150914A2 (en) | 2013-03-15 | 2014-09-25 | Pioneer Hi-Bred International, Inc. | Phi-4 polypeptides and methods for their use |
CA2918909A1 (en) | 2013-07-25 | 2015-01-29 | Pioneer Hi-Bred International, Inc. | Method for producing hybrid brassica seed |
MX359026B (es) | 2013-08-16 | 2018-09-12 | Pioneer Hi Bred Int | Proteinas insecticidas y metodos de uso. |
BR122021005579B1 (pt) | 2013-09-13 | 2022-11-29 | Pioneer Hi-Bred International, Inc | Construto de dna, método de obtenção de planta transgênica, proteína de fusão, método para controlar uma população de praga de inseto, método para inibir o crescimento ou matar uma praga de inseto |
CA2927180A1 (en) | 2013-10-18 | 2015-04-23 | Pioneer Hi-Bred International, Inc. | Glyphosate-n-acetyltransferase (glyat) sequences and methods of use |
WO2015061548A1 (en) | 2013-10-25 | 2015-04-30 | Pioneer Hi-Bred International, Inc. | Stem canker tolerant soybeans and methods of use |
CN105979770B (zh) | 2014-01-15 | 2019-07-05 | 孟山都技术公司 | 用于使用epsps多核苷酸的杂草控制的方法和组合物 |
BR112016018103B1 (pt) | 2014-02-07 | 2024-01-16 | E.I. Du Pont De Nemours And Company | Polipeptídeo e seu uso, polinucleotídeo, composição, proteína de fusão, método para controlar uma população, método para inibir o crescimento, método para controlar a infestação, método para obtenção de uma planta ou célula vegetal, construto |
ES2806473T3 (es) | 2014-02-07 | 2021-02-17 | Pioneer Hi Bred Int | Proteínas insecticidas y métodos para su uso |
WO2016022516A1 (en) | 2014-08-08 | 2016-02-11 | Pioneer Hi-Bred International, Inc. | Ubiquitin promoters and introns and methods of use |
WO2016044092A1 (en) | 2014-09-17 | 2016-03-24 | Pioneer Hi Bred International Inc | Compositions and methods to control insect pests |
BR112017007932A2 (pt) | 2014-10-16 | 2018-01-23 | Du Pont | proteínas inseticidas e métodos para uso das mesmas |
US20170359965A1 (en) | 2014-12-19 | 2017-12-21 | E I Du Pont De Nemours And Company | Polylactic acid compositions with accelerated degradation rate and increased heat stability |
RU2017144238A (ru) | 2015-05-19 | 2019-06-19 | Пайонир Хай-Бред Интернэшнл, Инк. | Инсектицидные белки и способы их применения |
CA2986265A1 (en) | 2015-06-16 | 2016-12-22 | Pioneer Hi-Bred International, Inc. | Compositions and methods to control insect pests |
US10370677B2 (en) * | 2015-08-03 | 2019-08-06 | Monsanto Technology Llc | Methods and compositions for herbicide tolerance in plants |
UA124495C2 (uk) | 2015-08-06 | 2021-09-29 | Піонір Хай-Бред Інтернешнл, Інк. | Інсектицидний білок рослинного походження та спосіб його застосування |
EP3390431A1 (de) | 2015-12-18 | 2018-10-24 | Pioneer Hi-Bred International, Inc. | Insektizide proteine und verfahren zu deren verwendung |
BR112018012887B1 (pt) | 2015-12-22 | 2024-02-06 | Pioneer Hi-Bred International, Inc | Cassete de expressão, vetor, métodos de obtenção de célula vegetal e planta transgênica, métodos para expressar um polinucleotídeo |
CA3004914A1 (en) | 2016-02-05 | 2017-08-10 | Pioneer Hi-Bred International, Inc. | Genetic loci associated with brown stem rot resistance in soybean and methods of use |
US11008585B2 (en) | 2016-05-04 | 2021-05-18 | Pioneer Hi-Bred International, Inc. | Insecticidal proteins and methods for their use |
CN109312359A (zh) | 2016-06-16 | 2019-02-05 | 先锋国际良种公司 | 用以防治昆虫有害生物的组合物和方法 |
SG11201811219UA (en) | 2016-06-16 | 2019-01-30 | Nuseed Pty Ltd | Inbred transgenic canola line ns-b50027-4 and seeds thereof |
BR112018076314A2 (pt) | 2016-06-16 | 2019-03-26 | Nuseed Pty Ltd. | canola de evento elite ns-b50027-4 |
CN109642237B (zh) | 2016-06-24 | 2022-09-30 | 先锋国际良种公司 | 植物调节元件及其使用方法 |
EP3954202A1 (de) | 2016-07-01 | 2022-02-16 | Pioneer Hi-Bred International, Inc. | Insektizide proteine aus pflanzen und verfahren zu deren verwendung |
WO2018013333A1 (en) | 2016-07-12 | 2018-01-18 | Pioneer Hi-Bred International, Inc. | Compositions and methods to control insect pests |
EP3535285B1 (de) | 2016-11-01 | 2022-04-06 | Pioneer Hi-Bred International, Inc. | Insektizide proteine und verfahren zu deren verwendung |
US11879132B2 (en) | 2016-12-20 | 2024-01-23 | BASF Agro B.V. | Plants having increased tolerance to herbicides |
CN111373046A (zh) | 2017-09-25 | 2020-07-03 | 先锋国际良种公司 | 组织偏好性启动子和使用方法 |
WO2019226508A1 (en) | 2018-05-22 | 2019-11-28 | Pioneer Hi-Bred International, Inc. | Plant regulatory elements and methods of use thereof |
US20210277409A1 (en) | 2018-06-28 | 2021-09-09 | Pioneer Hi-Bred International, Inc. | Methods for selecting transformed plants |
AU2019369415A1 (en) | 2018-10-31 | 2021-03-25 | Pioneer Hi-Bred International, Inc. | Compositions and methods for Ochrobactrum-mediated plant transformation |
WO2022015619A2 (en) | 2020-07-14 | 2022-01-20 | Pioneer Hi-Bred International, Inc. | Insecticidal proteins and methods for their use |
CA3191142A1 (en) | 2020-08-26 | 2022-03-03 | Vindara, Inc. | Method and/or compositions for lettuce (lactuca sativa) breeding and/or varieties developed thereby |
CN112175985B (zh) * | 2020-09-11 | 2022-08-19 | 南开大学 | 提高豆科植物除草剂抗性的方法及其应用 |
CN115340987B (zh) * | 2021-05-12 | 2023-12-01 | 北京大北农生物技术有限公司 | 除草剂耐受性蛋白质、其编码基因及用途 |
CN115336534A (zh) * | 2021-05-12 | 2022-11-15 | 北京大北农生物技术有限公司 | 原卟啉原氧化酶的用途 |
WO2023185306A1 (zh) * | 2022-03-29 | 2023-10-05 | 青岛清原化合物有限公司 | 对ppo抑制剂类除草剂具有耐受性的ppo2多肽及应用 |
WO2023206126A1 (zh) * | 2022-04-27 | 2023-11-02 | 北京大北农生物技术有限公司 | 原卟啉原氧化酶的用途 |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5767373A (en) * | 1994-06-16 | 1998-06-16 | Novartis Finance Corporation | Manipulation of protoporphyrinogen oxidase enzyme activity in eukaryotic organisms |
US6084155A (en) * | 1995-06-06 | 2000-07-04 | Novartis Ag | Herbicide-tolerant protoporphyrinogen oxidase ("protox") genes |
KR19990087356A (ko) * | 1996-02-28 | 1999-12-27 | 더블류. 하링, 지. 보이롤 | 식물 프로토포르피리노겐 옥시다제 유전자로부터의 프로모터 |
-
2000
- 2000-06-30 EP EP00940419A patent/EP1200611A1/de not_active Withdrawn
- 2000-06-30 CA CA002381927A patent/CA2381927A1/en not_active Abandoned
- 2000-06-30 WO PCT/EP2000/006127 patent/WO2001012825A1/en not_active Application Discontinuation
- 2000-06-30 CN CN 00812881 patent/CN1373811A/zh active Pending
- 2000-06-30 JP JP2001516912A patent/JP2003507019A/ja active Pending
- 2000-06-30 AU AU55360/00A patent/AU5536000A/en not_active Abandoned
- 2000-07-03 AR ARP000103390 patent/AR024642A1/es unknown
Non-Patent Citations (1)
Title |
---|
See references of WO0112825A1 * |
Also Published As
Publication number | Publication date |
---|---|
AR024642A1 (es) | 2002-10-16 |
CA2381927A1 (en) | 2001-02-22 |
WO2001012825A1 (en) | 2001-02-22 |
JP2003507019A (ja) | 2003-02-25 |
AU5536000A (en) | 2001-03-13 |
CN1373811A (zh) | 2002-10-09 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US6308458B1 (en) | Herbicide-tolerant plants and methods of controlling the growth of undesired vegetation | |
WO2001012825A1 (en) | Herbicide-tolerant protoporphyrinogen oxidase | |
CA2247074C (en) | Dna molecules encoding plant protoporphyrinogen oxidase and inhibitor-resistant mutants thereof | |
US6808904B2 (en) | Herbicide-tolerant protox genes produced by DNA shuffling | |
CA2189349C (en) | Manipulation of protoporphyrinogen oxidase enzyme activity in eukaryotic organisms | |
US5939602A (en) | DNA molecules encoding plant protoporphyrinogen oxidase and inhibitor-resistant mutants thereof | |
US20020073443A1 (en) | Herbicide tolerance achieved through plastid transformation | |
WO2001068826A2 (en) | Protoporphyrinogen oxidase ('protox') genes | |
US6023012A (en) | DNA molecules encoding plant protoporphyrinogen oxidase |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
17P | Request for examination filed |
Effective date: 20020130 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE |
|
AX | Request for extension of the european patent |
Free format text: AL;LT;LV;MK;RO;SI |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
18D | Application deemed to be withdrawn |
Effective date: 20031231 |