DK91088D0 - Analogifremgangsmaade til fremstilling af substituerede acylderivater af octahydro-1h-indol-2-carboxylsyrer - Google Patents

Analogifremgangsmaade til fremstilling af substituerede acylderivater af octahydro-1h-indol-2-carboxylsyrer

Info

Publication number
DK91088D0
DK91088D0 DK091088A DK91088A DK91088D0 DK 91088 D0 DK91088 D0 DK 91088D0 DK 091088 A DK091088 A DK 091088A DK 91088 A DK91088 A DK 91088A DK 91088 D0 DK91088 D0 DK 91088D0
Authority
DK
Denmark
Prior art keywords
octahydro
indol
analogy
substituted acyl
acyl derivatives
Prior art date
Application number
DK091088A
Other languages
English (en)
Other versions
DK91088A (da
DK159419C (da
DK159419B (da
Inventor
Milton L Hoefle
George Bobowski
Original Assignee
Warner Lambert Co
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US06/233,940 external-priority patent/US4350704A/en
Application filed by Warner Lambert Co filed Critical Warner Lambert Co
Publication of DK91088A publication Critical patent/DK91088A/da
Publication of DK91088D0 publication Critical patent/DK91088D0/da
Publication of DK159419B publication Critical patent/DK159419B/da
Application granted granted Critical
Publication of DK159419C publication Critical patent/DK159419C/da

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D209/00—Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom
    • C07D209/02—Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom condensed with one carbocyclic ring
    • C07D209/04—Indoles; Hydrogenated indoles
    • C07D209/30—Indoles; Hydrogenated indoles with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, directly attached to carbon atoms of the hetero ring
    • C07D209/42—Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A61P9/12—Antihypertensives
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/02—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing at least one abnormal peptide link
    • C07K5/022—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing at least one abnormal peptide link containing the structure -X-C(=O)-(C)n-N-C-C(=O)-Y-; X and Y being heteroatoms; n being 1 or 2
    • C07K5/0222—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing at least one abnormal peptide link containing the structure -X-C(=O)-(C)n-N-C-C(=O)-Y-; X and Y being heteroatoms; n being 1 or 2 with the first amino acid being heterocyclic, e.g. Pro, Trp
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/06—Dipeptides
    • C07K5/06008—Dipeptides with the first amino acid being neutral
    • C07K5/06017—Dipeptides with the first amino acid being neutral and aliphatic
    • C07K5/06026—Dipeptides with the first amino acid being neutral and aliphatic the side chain containing 0 or 1 carbon atom, i.e. Gly or Ala
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/06—Dipeptides
    • C07K5/06008—Dipeptides with the first amino acid being neutral
    • C07K5/06017—Dipeptides with the first amino acid being neutral and aliphatic
    • C07K5/06034—Dipeptides with the first amino acid being neutral and aliphatic the side chain containing 2 to 4 carbon atoms
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/06—Dipeptides
    • C07K5/06008—Dipeptides with the first amino acid being neutral
    • C07K5/06078—Dipeptides with the first amino acid being neutral and aromatic or cycloaliphatic
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Indole Compounds (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
DK091088A 1980-04-02 1988-02-22 Analogifremgangsmaade til fremstilling af substituerede acylderivater af octahydro-1h-indol-2-carboxylsyrer DK159419C (da)

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US13710680A 1980-04-02 1980-04-02
US13710680 1980-04-02
US19430780A 1980-10-06 1980-10-06
US19430780 1980-10-06
US23394081 1981-02-17
US06/233,940 US4350704A (en) 1980-10-06 1981-02-17 Substituted acyl derivatives of octahydro-1H-indole-2-carboxylic acids

Publications (4)

Publication Number Publication Date
DK91088A DK91088A (da) 1988-02-22
DK91088D0 true DK91088D0 (da) 1988-02-22
DK159419B DK159419B (da) 1990-10-15
DK159419C DK159419C (da) 1991-03-18

Family

ID=27384960

Family Applications (2)

Application Number Title Priority Date Filing Date
DK148281A DK157851C (da) 1980-04-02 1981-04-01 Analogifremgangsmaade til fremstilling af en octa-hydro-1-(omega-mercaptoalkanoyl)-1h-indol-2-carboxylsyreforbindelse
DK091088A DK159419C (da) 1980-04-02 1988-02-22 Analogifremgangsmaade til fremstilling af substituerede acylderivater af octahydro-1h-indol-2-carboxylsyrer

Family Applications Before (1)

Application Number Title Priority Date Filing Date
DK148281A DK157851C (da) 1980-04-02 1981-04-01 Analogifremgangsmaade til fremstilling af en octa-hydro-1-(omega-mercaptoalkanoyl)-1h-indol-2-carboxylsyreforbindelse

Country Status (14)

Country Link
EP (1) EP0037231B1 (da)
KR (2) KR850000302B1 (da)
AU (1) AU543861B2 (da)
CA (1) CA1205476A (da)
DE (1) DE3175875D1 (da)
DK (2) DK157851C (da)
ES (2) ES500965A0 (da)
FI (1) FI76072C (da)
HK (1) HK30489A (da)
IE (1) IE52663B1 (da)
IL (1) IL62294A (da)
NO (1) NO156609C (da)
NZ (1) NZ196704A (da)
SG (1) SG3889G (da)

Families Citing this family (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4599357A (en) * 1979-12-17 1986-07-08 Ciba-Geigy Corporation 1-mercaptoalkanoylindoline-2-carboxylic acids
DE3177311D1 (de) * 1980-08-30 1994-06-09 Hoechst Ag Aminosäurederivate, Verfahren zu ihrer Herstellung, diese enthaltende Mittel und deren Verwendung.
FR2492381A1 (fr) * 1980-10-21 1982-04-23 Science Union & Cie Nouveaux acides aza bicyclo alcane carboxyliques substitues leurs procedes de preparation et leur emploi comme inhibiteur d'enzyme
DE3174844D1 (en) * 1980-10-23 1986-07-24 Schering Corp Carboxyalkyl dipeptides, processes for their production and pharmaceutical compositions containing them
US4374847A (en) * 1980-10-27 1983-02-22 Ciba-Geigy Corporation 1-Carboxyalkanoylindoline-2-carboxylic acids
GB2086390B (en) * 1980-11-03 1984-06-06 Ciba Geigy Ag 1-carboxy-azaalkanoylindoline-2-carboxylic acids process for their manufacture pharmaceutical preparations containing these compounds and their therapeutic application
US4479963A (en) * 1981-02-17 1984-10-30 Ciba-Geigy Corporation 1-Carboxyalkanoylindoline-2-carboxylic acids
EP0093805B1 (en) * 1981-02-17 1987-05-13 Warner-Lambert Company Octahydro-2-(omega-mercaptoalkanoyl)3-oxo-1h-isoindole-1-carboxylic acids and esters
DE3134933A1 (de) * 1981-09-03 1983-03-31 Hoechst Ag, 6230 Frankfurt "harnstoffderivate, verfahren zu ihrer herstellung und diese enthaltende medikamente sowie deren verwendung"
DE3226768A1 (de) * 1981-11-05 1983-05-26 Hoechst Ag, 6230 Frankfurt Derivate der cis, endo-2-azabicyclo-(3.3.0)-octan-3-carbonsaeure, verfahren zu ihrer herstellung, diese enthaltende mittel und deren verwendung
EP0170775B2 (de) * 1981-12-29 1994-10-12 Hoechst Aktiengesellschaft Derivate bicyclischer Aminosäuren, Verfahren zu ihrer Herstellung, diese enthaltende Mittel und deren Verwendung sowie neue bicyclische Aminosäuren als Zwischenstufen und Verfahren zu deren Herstellung
CA1341296C (en) * 1981-12-29 2001-09-25 Hansjorg Urbach 2-azabicycloalkane-3-carboxylic acid derivatives, processes for their preparation, agents containing these compounds and their use
DE3210496A1 (de) * 1982-03-23 1983-10-06 Hoechst Ag Neue derivate bicyclischer aminsaeuren, verfahren zu ihrer herstellung, diese enthaltende mittel und deren verwendung sowie neue bicyclische aminosaeuren als zwischenstufen und verfahren zu deren herstellung
DE3211397A1 (de) * 1982-03-27 1983-11-10 Hoechst Ag, 6230 Frankfurt Spiro (4.(3+n))-2-aza-3-carbonsaeure-derivate, verfahren zu ihrer herstellung, diese enthaltende mittel und ihre verwendung
DE3246503A1 (de) * 1982-12-16 1984-06-20 Hoechst Ag, 6230 Frankfurt Derivate der cis, endo-2-azabicyclo-(5.3.0)-decan-3-carbonsaeure, verfahren zu ihrer herstellung, diese enthaltende mittel und deren verwendung
US5175306A (en) * 1983-01-31 1992-12-29 Hoechst Aktiengesellschaft Process for the resolution of racemates of optically active bicyclic imino-α-carboxylic esters
HU191120B (en) * 1983-01-31 1987-01-28 Hoechts Ag,De Process for raceme separation of optically active byciclic imino-alpha-carbonic acid esthers
DE3303344A1 (de) 1983-02-02 1984-08-02 Hoechst Ag, 6230 Frankfurt Verfahren zur herstellung von n-alkylierten aminosaeuren und deren estern
DE3333455A1 (de) * 1983-09-16 1985-04-11 Hoechst Ag, 6230 Frankfurt Verfahren zur herstellung n-alkylierter dipeptide und deren estern
DE3333454A1 (de) * 1983-09-16 1985-04-11 Hoechst Ag, 6230 Frankfurt Verfahren zur herstellung von n-alkylierten dipeptiden und deren estern
US5684016A (en) * 1984-04-12 1997-11-04 Hoechst Aktiengesellschaft Method of treating cardiac insufficiency
DE3413710A1 (de) * 1984-04-12 1985-10-24 Hoechst Ag, 6230 Frankfurt Verfahren zur behandlung der herzinsuffizienz
DE3431541A1 (de) * 1984-08-28 1986-03-06 Hoechst Ag, 6230 Frankfurt Cis,endo-2-azabicycloalkan-3-carbonsaeure-derivate, verfahren zu deren herstellung, deren verwendung sowie zwischenprodukte bei deren herstellung
US5231080A (en) * 1985-10-15 1993-07-27 Hoechst Aktiengesellschaft Method for the treatment of atherosclerosis, thrombosis, and peripheral vessel disease
US5231084A (en) * 1986-03-27 1993-07-27 Hoechst Aktiengesellschaft Compounds having a cognition adjuvant action, agents containing them, and the use thereof for the treatment and prophylaxis of cognitive dysfuncitons
US4749688A (en) * 1986-06-20 1988-06-07 Schering Corporation Use of neutral metalloendopeptidase inhibitors in the treatment of hypertension
EP0566157A1 (en) 1986-06-20 1993-10-20 Schering Corporation Neutral metalloendopeptidase inhibitors in the treatment of hypertension
EP0254032A3 (en) 1986-06-20 1990-09-05 Schering Corporation Neutral metalloendopeptidase inhibitors in the treatment of hypertension
DE3633496A1 (de) * 1986-10-02 1988-04-14 Hoechst Ag Kombination von angiotensin-converting-enzyme-hemmern mit calciumantagonisten sowie deren verwendung in arzneimitteln
FR2605630B1 (fr) * 1986-10-22 1989-06-30 Roussel Uclaf Procede de preparation de derives de l'octahydroindole et intermediaires de preparation
DE3639879A1 (de) * 1986-11-21 1988-06-01 Hoechst Ag Verfahren zur herstellung von mono-, bi- und tricyclischen aminosaeuren, zwischenprodukte dieses verfahrens sowie ein verfahren zu deren herstellung
DE3641451A1 (de) * 1986-12-04 1988-06-16 Hoechst Ag Derivate bicyclischer aminocarbonsaeuren, verfahren und zwischenprodukte zu deren herstellung sowie deren verwendung
DE3722007A1 (de) * 1987-07-03 1989-01-12 Hoechst Ag Verfahren zur herstellung bicyclischer aminocarbonsaeuren, zwischenprodukte dieses verfahrens und deren verwendung
FR2620703B1 (fr) * 1987-09-17 1991-10-04 Adir Procede de synthese industrielle de l'acide perhydroindole carboxylique - 2(2s, 3as, 7as). application a la synthese de carboxyalkyl dipeptides
WO2004092132A1 (en) * 2003-04-15 2004-10-28 Warner-Lambert Company Llc [b]-fused bicyclic proline derivatives and their use for treating arthritic conditions
SI21800A (sl) 2004-05-14 2005-12-31 Krka, Tovarna Zdravil, D.D., Novo Mesto Nov postopek sinteze perindoprila
EP1792896A1 (en) 2005-12-01 2007-06-06 KRKA, tovarna zdravil, d.d., Novo mesto Process for the preparation of perindopril and salts thereof

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BE608905R (fr) * 1960-12-19 1962-04-06 Bayer Ag Procédé de fabrication d'un composé agissant sur la tension sanguine.
DE1174781B (de) * 1960-12-24 1964-07-30 Bayer Ag Verfahren zur Herstellung von Salzen von 1-(Guanidinoalkyl)-pyrrolidinen
US4105776A (en) * 1976-06-21 1978-08-08 E. R. Squibb & Sons, Inc. Proline derivatives and related compounds
JPS5572169A (en) * 1978-11-27 1980-05-30 Tanabe Seiyaku Co Ltd Isoquinoline derivative and its preparation
IL58849A (en) * 1978-12-11 1983-03-31 Merck & Co Inc Carboxyalkyl dipeptides and derivatives thereof,their preparation and pharmaceutical compositions containing them
US4461896A (en) * 1979-02-07 1984-07-24 Norwich Eaton Pharmaceuticals, Inc. 1-[Acylthio) and (mercapto)-1-oxoalkyl]-1,2,3,4-tetrahydroquinoline-2-carboxylic acids
EP0018104B1 (en) * 1979-03-26 1983-05-25 Takeda Chemical Industries, Ltd. Tetrahydroisoquinolines, their production and the compounds and pharmaceutical compositions containing them for use in the prevention or treatment of hypertension
US4303583A (en) * 1979-08-13 1981-12-01 American Home Products Corporation 1H,5H-[1,4]Thiazepino[4,3-a]indole-1,5-diones
DE2937779A1 (de) * 1979-09-19 1981-04-09 Hoechst Ag, 6000 Frankfurt Aminosaeurederivate und verfahren zu ihrer herstellung
FR2487829A2 (fr) * 1979-12-07 1982-02-05 Science Union & Cie Nouveaux imino acides substitues, leurs procedes de preparation et leur emploi comme inhibiteur d'enzyme

Also Published As

Publication number Publication date
NO156609B (no) 1987-07-13
DK91088A (da) 1988-02-22
KR830005136A (ko) 1983-08-03
FI810971L (fi) 1981-10-03
SG3889G (en) 1989-06-02
IL62294A0 (en) 1981-05-20
AU543861B2 (en) 1985-05-09
NO811121L (no) 1981-10-05
DK159419C (da) 1991-03-18
EP0037231B1 (en) 1987-01-28
DK157851B (da) 1990-02-26
KR850000302B1 (ko) 1985-03-18
HK30489A (en) 1989-04-21
DK148281A (da) 1981-10-03
DK159419B (da) 1990-10-15
FI76072B (fi) 1988-05-31
NZ196704A (en) 1984-12-14
KR850000303B1 (ko) 1985-03-18
EP0037231A3 (en) 1982-04-28
NO156609C (no) 1987-10-21
EP0037231A2 (en) 1981-10-07
DK157851C (da) 1990-07-30
CA1205476A (en) 1986-06-03
ES8205771A1 (es) 1982-06-16
AU6893981A (en) 1981-10-08
FI76072C (fi) 1988-09-09
IL62294A (en) 1986-07-31
IE52663B1 (en) 1988-01-20
ES8206474A1 (es) 1982-08-16
ES504189A0 (es) 1982-06-16
IE810463L (en) 1981-10-02
ES500965A0 (es) 1982-08-16
DE3175875D1 (en) 1987-03-05

Similar Documents

Publication Publication Date Title
DK159419C (da) Analogifremgangsmaade til fremstilling af substituerede acylderivater af octahydro-1h-indol-2-carboxylsyrer
DK434381A (da) Fremgangsmaade til fremstilling af substituerede imonodicarboxylsyrer
DK158788C (da) Analogifremgangsmaade til fremstilling af tetrazolylalkoxycarbostyrilderivater
DK336783D0 (da) Fremgangsmade til fremstilling af methylendiphosphonsyrederivater
DK170680A (da) Fremgangsmaade til fremstilling af amider af acyl-carnitiner
DK417981A (da) Fremgangsmaade til fremstilling af 3-aryl-5-isothiazol-derivater
DK188683D0 (da) Fremgangsmade til fremstilling af heterocycliske forbindelser
DK88081A (da) Fremgangsmaade til fremstilling af tetrazolderivater
DK160679A (da) Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid
DK148300C (da) Analogifremgangsmaade til fremstilling af acylderivater af carnitin
DK343682A (da) Fremgangsmaade til fremstilling af thiazolidinylalkylen-piperazin-derivater
DK154291C (da) Analogifremgangsmaade til fremstilling af aroylpyrrolylcarboxylsyrer eller derivater deraf
DK416082A (da) Fremgangsmaade til fremstilling af aminopropanolderivater af 2-hydroxy-beta-phenylpropiophenoner
DK163580C (da) Analogifremgangsmaade til fremstilling af cyclohexancarboxylsyrederivater
DK357782A (da) Fremgangsmaade til fremstilling af tetrahydrofurancarboxylsyrederivater
DK157673C (da) Analogifremgangsmaade til fremstilling af phenylaliphatiske carboxylsyrederivater
DK554481A (da) Fremgangsmaade til fremstilling af cephalosporansyrederivater
DK151256C (da) Analogifremgangsmaade til fremstilling af alkylendioxybenzenderivater
DK154424C (da) Analogifremgangsmaade til fremstilling af acylderivater af carnitin
DK449981A (da) Fremgangsmaade til fremstilling af acylderivater
DK232080A (da) Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater
DK300781A (da) Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater
DK508881A (da) Fremgangsmaade til fremstilling af oploesninger af 7-amincophelosporansyrer
DK344679A (da) Fremgangsmaade til fremstilling af arylglyoxylsyrer
DK343782A (da) Fremgangsmaade til fremstilling af spirothiazolidinyl-piperazin-derivater

Legal Events

Date Code Title Description
PBP Patent lapsed