DK302880A - Fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende en 3-amino1-aryl-2-pyrazolin - Google Patents
Fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende en 3-amino1-aryl-2-pyrazolinInfo
- Publication number
- DK302880A DK302880A DK302880A DK302880A DK302880A DK 302880 A DK302880 A DK 302880A DK 302880 A DK302880 A DK 302880A DK 302880 A DK302880 A DK 302880A DK 302880 A DK302880 A DK 302880A
- Authority
- DK
- Denmark
- Prior art keywords
- amino1
- pyrazoline
- aryl
- preparing
- pharmaceutical preparation
- Prior art date
Links
- 239000000825 pharmaceutical preparation Substances 0.000 title 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D231/00—Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings
- C07D231/02—Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings
- C07D231/06—Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having one double bond between ring members or between a ring member and a non-ring member
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C243/00—Compounds containing chains of nitrogen atoms singly-bound to each other, e.g. hydrazines, triazanes
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pain & Pain Management (AREA)
- Pharmacology & Pharmacy (AREA)
- Rheumatology (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Plural Heterocyclic Compounds (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US5736279A | 1979-07-13 | 1979-07-13 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| DK302880A true DK302880A (da) | 1981-01-14 |
Family
ID=22010106
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DK302880A DK302880A (da) | 1979-07-13 | 1980-07-11 | Fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende en 3-amino1-aryl-2-pyrazolin |
Country Status (10)
| Country | Link |
|---|---|
| EP (1) | EP0022578B1 (OSRAM) |
| JP (1) | JPS5632416A (OSRAM) |
| AU (1) | AU537499B2 (OSRAM) |
| CA (1) | CA1150632A (OSRAM) |
| DE (1) | DE3072103D1 (OSRAM) |
| DK (1) | DK302880A (OSRAM) |
| IL (1) | IL60550A (OSRAM) |
| IT (1) | IT1207128B (OSRAM) |
| NZ (1) | NZ194328A (OSRAM) |
| ZA (1) | ZA804196B (OSRAM) |
Families Citing this family (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE3149710A1 (de) * | 1980-12-16 | 1982-08-05 | The Wellcome Foundation Ltd., London | Heterocyclische verbindungen, verfahren zu ihrer herstellung, ihre verwendung und sie enthaltende pharmazeutische zubereitungen |
| AU549259B2 (en) * | 1980-12-23 | 1986-01-23 | Wellcome Foundation Limited, The | Substituted pyrazolines |
| US4465685A (en) * | 1980-12-23 | 1984-08-14 | Burroughs Wellcome Co. | Antiinflammatory pyrazole thioureas |
| US4447442A (en) * | 1981-07-13 | 1984-05-08 | American Cyanamid Company | 3-Trifluoroacetylamino-1-aryl-2-pyrazolines |
| US4432991A (en) * | 1981-07-13 | 1984-02-21 | American Cyanamid Company | Therapeutically active 3-amino-1-phenyl(and substituted phenyl)-2-pyrazolines |
| EP0070376A1 (en) * | 1981-07-13 | 1983-01-26 | American Cyanamid Company | Heterocyclic substituted-amino-pyrazolines |
| US4451479A (en) * | 1981-07-13 | 1984-05-29 | American Cyanamid Company | Therapeutically active 3-amino-1-halogenated phenyl-2-pyrazolines and their C4 and C5 analogs |
| US4448783A (en) * | 1982-05-17 | 1984-05-15 | Burroughs Wellcome Co. | Substituted pyrazoline, and its use in treatment of gastro-intestinal disturbances |
| EP0119450A1 (en) * | 1983-02-11 | 1984-09-26 | The Wellcome Foundation Limited | Preparation of aminopyrazolines and intermediates used therein |
| GB8303782D0 (en) * | 1983-02-11 | 1983-03-16 | Wellcome Found | Heterocyclic compounds |
| US4824859A (en) * | 1983-05-21 | 1989-04-25 | Fisons Plc. | Pyrazoline compounds compositions and use |
| ATE49198T1 (de) * | 1984-05-12 | 1990-01-15 | Fisons Plc | Antiinflammatorische 1,n-diarylpyrazol-3-amine, deren zusammensetzungen und verfahren zu deren herstellung. |
| US4970210A (en) * | 1987-07-17 | 1990-11-13 | Abbott Laboratories | Triazinone lipoxygenase compounds |
| DK2903440T3 (en) | 2012-10-02 | 2017-12-11 | Bayer Cropscience Ag | THETEROCYCLIC COMPOUNDS AS PESTICIDES |
| JP2016539095A (ja) * | 2013-10-17 | 2016-12-15 | ダウ アグロサイエンシィズ エルエルシー | 有害生物防除性化合物の製造方法 |
| AR098108A1 (es) * | 2014-07-31 | 2016-05-04 | Dow Agrosciences Llc | Proceso para la preparación de 3-(3-cloro-1h-pirazol-1-il)piridina |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB1324687A (en) * | 1970-08-06 | 1973-07-25 | Chinoin Gyogyszer Es Vegyeszet | 3-amino-delta2-pyrazoline derivatives and process for the preparation thereof |
| IT1061812B (it) * | 1976-06-25 | 1983-04-30 | Montedison Spa | Processo per la preparazione di i fenil 3 ammino pirazoli |
-
1980
- 1980-07-11 DE DE8080104029T patent/DE3072103D1/de not_active Expired
- 1980-07-11 EP EP80104029A patent/EP0022578B1/en not_active Expired
- 1980-07-11 DK DK302880A patent/DK302880A/da not_active Application Discontinuation
- 1980-07-11 CA CA000356068A patent/CA1150632A/en not_active Expired
- 1980-07-11 ZA ZA00804196A patent/ZA804196B/xx unknown
- 1980-07-11 IT IT8049233A patent/IT1207128B/it active
- 1980-07-11 NZ NZ194328A patent/NZ194328A/en unknown
- 1980-07-11 JP JP9494380A patent/JPS5632416A/ja active Granted
- 1980-07-11 IL IL60550A patent/IL60550A/xx unknown
- 1980-07-11 AU AU60327/80A patent/AU537499B2/en not_active Ceased
Also Published As
| Publication number | Publication date |
|---|---|
| IT8049233A0 (it) | 1980-07-11 |
| JPS5632416A (en) | 1981-04-01 |
| ZA804196B (en) | 1982-02-24 |
| IT1207128B (it) | 1989-05-17 |
| EP0022578A1 (en) | 1981-01-21 |
| AU537499B2 (en) | 1984-06-28 |
| DE3072103D1 (en) | 1988-08-04 |
| IL60550A (en) | 1984-12-31 |
| IL60550A0 (en) | 1980-09-16 |
| CA1150632A (en) | 1983-07-26 |
| NZ194328A (en) | 1985-03-20 |
| JPH0248549B2 (OSRAM) | 1990-10-25 |
| AU6032780A (en) | 1981-01-15 |
| EP0022578B1 (en) | 1988-06-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DK153440C (da) | Fremgangsmaade til fremstilling af et nasalt farmaceutisk ergotpeptidalkaloid-praeparat | |
| DK158932C (da) | Fremgangsmaade til fremstilling af pancreatinpiller | |
| DK345081A (da) | Fremgangsmaade til fremstilling af et stabilt vandigt praeparat indeholdende invermectin | |
| DK498481A (da) | Fremgangsmaade til fremstilling af et stabilt gelprodukt | |
| DK154267C (da) | Fremgangsmaade til fremstilling af et intravenoest indgiveligt antistofholdigt immunoglobulin og fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende dette | |
| DK160739C (da) | Fremgangsmaade til fremstilling af et stabilt prostaglandinindeholdende praeparat til laegemiddelanvendelse | |
| DK528879A (da) | Fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende isosorbiddinitrat | |
| DK302880A (da) | Fremgangsmaade til fremstilling af et farmaceutisk praeparat indeholdende en 3-amino1-aryl-2-pyrazolin | |
| DK140480A (da) | Fremgangsmaade til fremstilling af mercaptoacyldipeptider | |
| DK229980A (da) | Fremgangsmaade til fremstilling af n-heterocyclyl-thienamyciner | |
| DK157169C (da) | Fremgangsmaade til fremstilling af et koncentrat af prothrombinkompleks | |
| ES497831A0 (es) | Un metodo de preparacion de nuevos nitrotiofenos | |
| DK8080A (da) | Fremgangsmaade til fremstilling af en graneleret formulering af nabilon | |
| DK277880A (da) | Fremgangsmaade til fremstilling af dipeptider | |
| DK203879A (da) | Fremgangsmaade til fremstilling af en farmaceutisk doseringskomponent | |
| DK7679A (da) | Fremgangsmaade til fremstilling af et prostaglandinholdigt praeparat | |
| DK352578A (da) | Fremgangsmaade til fremstilling af et farmaceutisk praeparat | |
| DK174580A (da) | Fremgangsmaade til fremstilling af penicilliner | |
| DK232080A (da) | Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater | |
| DK154607C (da) | Fremgangsmaade til fremstilling af en laegemiddelform til oral administration af ergotalkaloider | |
| DK300781A (da) | Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater | |
| DK159136C (da) | Fremgangsmaade til fremstilling af et farmaceutisk praeparat til rectal indgivning | |
| DK345681A (da) | Fremgangsmaade til femstilling af et farmaceutisk praeparat | |
| DK396582A (da) | Fremgangsmaade til fremstilling af farmaceutisk praeparat | |
| DK153469C (da) | Fremgangsmaade til fremstilling af fluorerede alkenylaminer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AHB | Application shelved due to non-payment |