DK283281A - Fremgangsmaade til fremstilling af sulfoxidderivater af cephalosporiner - Google Patents
Fremgangsmaade til fremstilling af sulfoxidderivater af cephalosporinerInfo
- Publication number
- DK283281A DK283281A DK283281A DK283281A DK283281A DK 283281 A DK283281 A DK 283281A DK 283281 A DK283281 A DK 283281A DK 283281 A DK283281 A DK 283281A DK 283281 A DK283281 A DK 283281A
- Authority
- DK
- Denmark
- Prior art keywords
- cephalosporines
- preparing
- sulphoxide derivatives
- sulphoxide
- derivatives
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D501/00—Heterocyclic compounds containing 5-thia-1-azabicyclo [4.2.0] octane ring systems, i.e. compounds containing a ring system of the formula:, e.g. cephalosporins; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/55—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug, i.e. a dimer, oligomer or polymer of pharmacologically or therapeutically active compounds
- A61K47/552—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug, i.e. a dimer, oligomer or polymer of pharmacologically or therapeutically active compounds one of the codrug's components being an antibiotic
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/555—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound pre-targeting systems involving an organic compound, other than a peptide, protein or antibody, for targeting specific cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Cephalosporin Compounds (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
FR8014512A FR2485540A1 (fr) | 1980-06-30 | 1980-06-30 | Nouveaux derives antibiotiques des cephalosporines, leur procede de preparation et les medicaments en contenant |
FR8104243A FR2501209B1 (fr) | 1981-03-03 | 1981-03-03 | Nouveaux derives des cephalosporines et medicaments antibiotiques contenant lesdits derives |
FR8104242 | 1981-03-03 |
Publications (1)
Publication Number | Publication Date |
---|---|
DK283281A true DK283281A (da) | 1981-12-31 |
Family
ID=27251008
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
DK283281A DK283281A (da) | 1980-06-30 | 1981-06-26 | Fremgangsmaade til fremstilling af sulfoxidderivater af cephalosporiner |
DK283381A DK283381A (da) | 1980-06-30 | 1981-06-26 | Fremgangsmaade til fremstilling af 1,2,4-triazinylthiomethyl-3-cephem-sulfoxid |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
DK283381A DK283381A (da) | 1980-06-30 | 1981-06-26 | Fremgangsmaade til fremstilling af 1,2,4-triazinylthiomethyl-3-cephem-sulfoxid |
Country Status (12)
Country | Link |
---|---|
US (1) | US4604387A (cs) |
EP (2) | EP0043756B1 (cs) |
AU (1) | AU543165B2 (cs) |
CA (2) | CA1173434A (cs) |
DE (2) | DE3162109D1 (cs) |
DK (2) | DK283281A (cs) |
ES (2) | ES8204996A1 (cs) |
GR (2) | GR75711B (cs) |
IE (2) | IE51358B1 (cs) |
NO (2) | NO159798C (cs) |
NZ (2) | NZ197563A (cs) |
PT (2) | PT73283B (cs) |
Families Citing this family (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
FR2570702B1 (fr) * | 1984-09-27 | 1987-01-09 | Sanofi Sa | Derives des cephalosporines, procedes d'obtention et leur application a titre d'antibiotiques |
US5147871A (en) * | 1986-07-03 | 1992-09-15 | Hoffmann La-Roche, Inc. | Anti-bacterial cephalosporin compounds |
CS273349B2 (en) * | 1988-03-31 | 1991-03-12 | Hoffmann La Roche | Method of cephalosporin's new derivatives production |
US5336768A (en) * | 1988-05-24 | 1994-08-09 | Hoffmann-La Roche Inc. | Antibacterial cephalosporin compounds |
US5159077A (en) * | 1989-07-21 | 1992-10-27 | Hoffmann-La Roche Inc. | Penam antibacterial compounds |
US5162523A (en) * | 1989-07-21 | 1992-11-10 | Hoffmann-La Roche Inc. | Cephalosporin antibacterial compounds |
US5318781A (en) * | 1993-04-06 | 1994-06-07 | Hoffmann-La Roche Inc. | Absorption enhancement of antibiotics |
Family Cites Families (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE2716677C2 (de) * | 1977-04-15 | 1985-10-10 | Hoechst Ag, 6230 Frankfurt | Cephemderivate und Verfahren zu ihrer Herstellung |
US4200745A (en) * | 1977-12-20 | 1980-04-29 | Eli Lilly And Company | 7[2-(2-Aminothiazol-4-yl)-2-alkoxyimino]acetamido 3[4-alkyl-5-oxo-6-hydroxy-3,4 dihydro 1,2,4-triazin 3-yl]thio methyl cephalosporins |
AR228726A1 (es) * | 1978-05-26 | 1983-04-15 | Glaxo Group Ltd | Procedimiento para la preparacion del antibiotico(6r,7r)-7-((z)-2-(2-aminotiazol-4-il)-2-(2-carboxiprop-2-oxiimino)acetamido)-3-(1-piridiniometil)cef-3-em-4-carboxilato |
MC1259A1 (fr) * | 1978-05-30 | 1980-01-14 | Hoffmann La Roche | Derives acyles |
US4237128A (en) * | 1979-04-12 | 1980-12-02 | E. R. Squibb & Sons, Inc. | 7-[2-(2-Amino-4-thiazolyl)-2-[(1-carboxy-1,1-dialkyl)alkoxyimino]acetamido]cephem sulfoxides |
US4349672A (en) * | 1979-11-29 | 1982-09-14 | Hoffmann-La Roche Inc. | Cephalosporin derivatives |
-
1981
- 1981-06-25 GR GR65352A patent/GR75711B/el unknown
- 1981-06-25 GR GR65351A patent/GR75706B/el unknown
- 1981-06-26 EP EP81401028A patent/EP0043756B1/fr not_active Expired
- 1981-06-26 DE DE8181401027T patent/DE3162109D1/de not_active Expired
- 1981-06-26 DK DK283281A patent/DK283281A/da not_active Application Discontinuation
- 1981-06-26 DE DE8181401028T patent/DE3163490D1/de not_active Expired
- 1981-06-26 DK DK283381A patent/DK283381A/da not_active Application Discontinuation
- 1981-06-26 EP EP81401027A patent/EP0044238B1/fr not_active Expired
- 1981-06-29 NO NO812215A patent/NO159798C/no unknown
- 1981-06-29 PT PT73283A patent/PT73283B/pt unknown
- 1981-06-29 NO NO812214A patent/NO812214L/no unknown
- 1981-06-29 IE IE1452/81A patent/IE51358B1/en unknown
- 1981-06-29 NZ NZ197563A patent/NZ197563A/xx unknown
- 1981-06-29 NZ NZ197564A patent/NZ197564A/xx unknown
- 1981-06-29 IE IE1453/81A patent/IE51359B1/en unknown
- 1981-06-29 PT PT73284A patent/PT73284A/pt unknown
- 1981-06-30 CA CA000380872A patent/CA1173434A/en not_active Expired
- 1981-06-30 ES ES503562A patent/ES8204996A1/es not_active Expired
- 1981-06-30 AU AU72411/81A patent/AU543165B2/en not_active Ceased
- 1981-06-30 ES ES81503563A patent/ES8203384A1/es not_active Expired
- 1981-06-30 CA CA000380874A patent/CA1175806A/en not_active Expired
-
1983
- 1983-08-23 US US06/525,797 patent/US4604387A/en not_active Expired - Fee Related
Also Published As
Publication number | Publication date |
---|---|
US4604387A (en) | 1986-08-05 |
EP0043756A1 (fr) | 1982-01-13 |
EP0044238A1 (fr) | 1982-01-20 |
IE811452L (en) | 1981-12-30 |
GR75706B (cs) | 1984-08-02 |
EP0044238B1 (fr) | 1984-02-01 |
PT73283A (fr) | 1981-07-01 |
PT73284A (fr) | 1981-07-01 |
DE3162109D1 (en) | 1984-03-08 |
ES503562A0 (es) | 1982-05-16 |
IE811453L (en) | 1981-12-30 |
NZ197564A (en) | 1983-12-16 |
ES8204996A1 (es) | 1982-05-16 |
AU7241181A (en) | 1982-01-07 |
CA1175806A (en) | 1984-10-09 |
EP0043756B1 (fr) | 1984-05-09 |
NZ197563A (en) | 1983-11-30 |
IE51358B1 (en) | 1986-12-10 |
DK283381A (da) | 1981-12-31 |
CA1173434A (en) | 1984-08-28 |
NO159798B (no) | 1988-10-31 |
ES503563A0 (es) | 1982-04-01 |
NO812215L (no) | 1982-01-04 |
DE3163490D1 (en) | 1984-06-14 |
IE51359B1 (en) | 1986-12-10 |
PT73283B (fr) | 1984-11-19 |
GR75711B (cs) | 1984-08-02 |
AU543165B2 (en) | 1985-04-04 |
NO159798C (no) | 1989-02-08 |
NO812214L (no) | 1982-01-04 |
ES8203384A1 (es) | 1982-04-01 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
DK417981A (da) | Fremgangsmaade til fremstilling af 3-aryl-5-isothiazol-derivater | |
ES498320A0 (es) | Metodo de producir derivados de tiazolidina | |
DK88081A (da) | Fremgangsmaade til fremstilling af tetrazolderivater | |
DK435181A (da) | Fremgangsmaade til fremstilling af thiazol-derivater | |
DK251079A (da) | Fremgangsmaade til fremstilling af phenylpiperazinderivater | |
DK160679A (da) | Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid | |
DK343682A (da) | Fremgangsmaade til fremstilling af thiazolidinylalkylen-piperazin-derivater | |
DK73381A (da) | Fremgangsmaade til fremstilling af 3-iodmethylcephalosporiner | |
DK416082A (da) | Fremgangsmaade til fremstilling af aminopropanolderivater af 2-hydroxy-beta-phenylpropiophenoner | |
ES502761A0 (es) | Metodo de preparar nuevos derivados de taurina | |
DK554481A (da) | Fremgangsmaade til fremstilling af cephalosporansyrederivater | |
DK479981A (da) | Fremgangsmaade til fremstilling af 3-aryl-3-hydroxyphthalimidiner | |
DK151256C (da) | Analogifremgangsmaade til fremstilling af alkylendioxybenzenderivater | |
DK283281A (da) | Fremgangsmaade til fremstilling af sulfoxidderivater af cephalosporiner | |
DK232080A (da) | Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater | |
DK531085A (da) | Fremgangsmaade til fremstilling af hydroquinonderivater | |
DK300781A (da) | Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater | |
DK355584D0 (da) | Fremgangsmaade til fremstilling af 3-exomethylen-cephalosporiner | |
DK343782A (da) | Fremgangsmaade til fremstilling af spirothiazolidinyl-piperazin-derivater | |
DK96181A (da) | Fremgangsmaade til fremstilling af n-imidazolylderivater af 1-chroman | |
DK105082A (da) | Fremgangsmaade til fremstilling af substituerede trifluormethylphenyl-tetrahydropyridiner | |
DK501582A (da) | Fremgangsmaade til fremstilling af acylcyanider | |
DK149026C (da) | Analogifremgangsmaade til fremstilling af adeninnucleosidderivater | |
DK548081A (da) | Fremgangsmaade til fremstilling af buspiron | |
ES526647A0 (es) | Metodo de preparar derivados de p-acilaminofenol |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AHS | Application shelved for other reasons than non-payment |