DK283281A - Fremgangsmaade til fremstilling af sulfoxidderivater af cephalosporiner - Google Patents

Fremgangsmaade til fremstilling af sulfoxidderivater af cephalosporiner

Info

Publication number
DK283281A
DK283281A DK283281A DK283281A DK283281A DK 283281 A DK283281 A DK 283281A DK 283281 A DK283281 A DK 283281A DK 283281 A DK283281 A DK 283281A DK 283281 A DK283281 A DK 283281A
Authority
DK
Denmark
Prior art keywords
cephalosporines
preparing
sulphoxide derivatives
sulphoxide
derivatives
Prior art date
Application number
DK283281A
Other languages
Danish (da)
English (en)
Inventor
B Labeeuw
A Sahli
Original Assignee
Sanofi Sa
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from FR8014512A external-priority patent/FR2485540A1/fr
Priority claimed from FR8104243A external-priority patent/FR2501209B1/fr
Application filed by Sanofi Sa filed Critical Sanofi Sa
Publication of DK283281A publication Critical patent/DK283281A/da

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D501/00Heterocyclic compounds containing 5-thia-1-azabicyclo [4.2.0] octane ring systems, i.e. compounds containing a ring system of the formula:, e.g. cephalosporins; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/55Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug, i.e. a dimer, oligomer or polymer of pharmacologically or therapeutically active compounds
    • A61K47/552Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug, i.e. a dimer, oligomer or polymer of pharmacologically or therapeutically active compounds one of the codrug's components being an antibiotic
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/555Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound pre-targeting systems involving an organic compound, other than a peptide, protein or antibody, for targeting specific cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Cephalosporin Compounds (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
DK283281A 1980-06-30 1981-06-26 Fremgangsmaade til fremstilling af sulfoxidderivater af cephalosporiner DK283281A (da)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
FR8014512A FR2485540A1 (fr) 1980-06-30 1980-06-30 Nouveaux derives antibiotiques des cephalosporines, leur procede de preparation et les medicaments en contenant
FR8104243A FR2501209B1 (fr) 1981-03-03 1981-03-03 Nouveaux derives des cephalosporines et medicaments antibiotiques contenant lesdits derives
FR8104242 1981-03-03

Publications (1)

Publication Number Publication Date
DK283281A true DK283281A (da) 1981-12-31

Family

ID=27251008

Family Applications (2)

Application Number Title Priority Date Filing Date
DK283281A DK283281A (da) 1980-06-30 1981-06-26 Fremgangsmaade til fremstilling af sulfoxidderivater af cephalosporiner
DK283381A DK283381A (da) 1980-06-30 1981-06-26 Fremgangsmaade til fremstilling af 1,2,4-triazinylthiomethyl-3-cephem-sulfoxid

Family Applications After (1)

Application Number Title Priority Date Filing Date
DK283381A DK283381A (da) 1980-06-30 1981-06-26 Fremgangsmaade til fremstilling af 1,2,4-triazinylthiomethyl-3-cephem-sulfoxid

Country Status (12)

Country Link
US (1) US4604387A (cs)
EP (2) EP0043756B1 (cs)
AU (1) AU543165B2 (cs)
CA (2) CA1173434A (cs)
DE (2) DE3162109D1 (cs)
DK (2) DK283281A (cs)
ES (2) ES8203384A1 (cs)
GR (2) GR75711B (cs)
IE (2) IE51358B1 (cs)
NO (2) NO159798C (cs)
NZ (2) NZ197563A (cs)
PT (2) PT73284A (cs)

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2570702B1 (fr) * 1984-09-27 1987-01-09 Sanofi Sa Derives des cephalosporines, procedes d'obtention et leur application a titre d'antibiotiques
US5147871A (en) * 1986-07-03 1992-09-15 Hoffmann La-Roche, Inc. Anti-bacterial cephalosporin compounds
US5336768A (en) * 1988-05-24 1994-08-09 Hoffmann-La Roche Inc. Antibacterial cephalosporin compounds
CS273349B2 (en) * 1988-03-31 1991-03-12 Hoffmann La Roche Method of cephalosporin's new derivatives production
US5159077A (en) * 1989-07-21 1992-10-27 Hoffmann-La Roche Inc. Penam antibacterial compounds
US5162523A (en) * 1989-07-21 1992-11-10 Hoffmann-La Roche Inc. Cephalosporin antibacterial compounds
US5318781A (en) * 1993-04-06 1994-06-07 Hoffmann-La Roche Inc. Absorption enhancement of antibiotics

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE2716677C2 (de) * 1977-04-15 1985-10-10 Hoechst Ag, 6230 Frankfurt Cephemderivate und Verfahren zu ihrer Herstellung
US4200745A (en) * 1977-12-20 1980-04-29 Eli Lilly And Company 7[2-(2-Aminothiazol-4-yl)-2-alkoxyimino]acetamido 3[4-alkyl-5-oxo-6-hydroxy-3,4 dihydro 1,2,4-triazin 3-yl]thio methyl cephalosporins
AR228726A1 (es) * 1978-05-26 1983-04-15 Glaxo Group Ltd Procedimiento para la preparacion del antibiotico(6r,7r)-7-((z)-2-(2-aminotiazol-4-il)-2-(2-carboxiprop-2-oxiimino)acetamido)-3-(1-piridiniometil)cef-3-em-4-carboxilato
MC1259A1 (fr) * 1978-05-30 1980-01-14 Hoffmann La Roche Derives acyles
US4237128A (en) * 1979-04-12 1980-12-02 E. R. Squibb & Sons, Inc. 7-[2-(2-Amino-4-thiazolyl)-2-[(1-carboxy-1,1-dialkyl)alkoxyimino]acetamido]cephem sulfoxides
US4349672A (en) * 1979-11-29 1982-09-14 Hoffmann-La Roche Inc. Cephalosporin derivatives

Also Published As

Publication number Publication date
EP0043756A1 (fr) 1982-01-13
GR75706B (cs) 1984-08-02
NZ197564A (en) 1983-12-16
CA1173434A (en) 1984-08-28
CA1175806A (en) 1984-10-09
ES503562A0 (es) 1982-05-16
GR75711B (cs) 1984-08-02
EP0044238B1 (fr) 1984-02-01
PT73284A (fr) 1981-07-01
DE3162109D1 (en) 1984-03-08
EP0043756B1 (fr) 1984-05-09
IE51358B1 (en) 1986-12-10
IE51359B1 (en) 1986-12-10
PT73283B (fr) 1984-11-19
DK283381A (da) 1981-12-31
IE811453L (en) 1981-12-30
NZ197563A (en) 1983-11-30
ES8204996A1 (es) 1982-05-16
EP0044238A1 (fr) 1982-01-20
US4604387A (en) 1986-08-05
NO812215L (no) 1982-01-04
NO159798C (no) 1989-02-08
NO159798B (no) 1988-10-31
ES503563A0 (es) 1982-04-01
ES8203384A1 (es) 1982-04-01
AU7241181A (en) 1982-01-07
IE811452L (en) 1981-12-30
AU543165B2 (en) 1985-04-04
PT73283A (fr) 1981-07-01
NO812214L (no) 1982-01-04
DE3163490D1 (en) 1984-06-14

Similar Documents

Publication Publication Date Title
DK417981A (da) Fremgangsmaade til fremstilling af 3-aryl-5-isothiazol-derivater
DK88081A (da) Fremgangsmaade til fremstilling af tetrazolderivater
ES498320A0 (es) Metodo de producir derivados de tiazolidina
DK435181A (da) Fremgangsmaade til fremstilling af thiazol-derivater
DK251079A (da) Fremgangsmaade til fremstilling af phenylpiperazinderivater
DK343682A (da) Fremgangsmaade til fremstilling af thiazolidinylalkylen-piperazin-derivater
DK160679A (da) Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid
DK73381A (da) Fremgangsmaade til fremstilling af 3-iodmethylcephalosporiner
DK416082A (da) Fremgangsmaade til fremstilling af aminopropanolderivater af 2-hydroxy-beta-phenylpropiophenoner
ES502761A0 (es) Metodo de preparar nuevos derivados de taurina
DK554481A (da) Fremgangsmaade til fremstilling af cephalosporansyrederivater
DK479981A (da) Fremgangsmaade til fremstilling af 3-aryl-3-hydroxyphthalimidiner
DK151256C (da) Analogifremgangsmaade til fremstilling af alkylendioxybenzenderivater
DK283281A (da) Fremgangsmaade til fremstilling af sulfoxidderivater af cephalosporiner
DK531085D0 (da) Fremgangsmaade til fremstilling af hydroquinonderivater
DK232080A (da) Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater
DK300781A (da) Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater
DK355584D0 (da) Fremgangsmaade til fremstilling af 3-exomethylen-cephalosporiner
DK343782A (da) Fremgangsmaade til fremstilling af spirothiazolidinyl-piperazin-derivater
DK183880A (da) Fremgangsmaade til fremstilling af hydroxyderivater af isopropyrimidin
DK96181A (da) Fremgangsmaade til fremstilling af n-imidazolylderivater af 1-chroman
DK105082A (da) Fremgangsmaade til fremstilling af substituerede trifluormethylphenyl-tetrahydropyridiner
DK501582A (da) Fremgangsmaade til fremstilling af acylcyanider
DK149026C (da) Analogifremgangsmaade til fremstilling af adeninnucleosidderivater
DK548081A (da) Fremgangsmaade til fremstilling af buspiron

Legal Events

Date Code Title Description
AHS Application shelved for other reasons than non-payment