DK158686C - Antennesystem med skaermet modtagerantenne til brug i elektronisk sikkerhedsudstyr - Google Patents

Antennesystem med skaermet modtagerantenne til brug i elektronisk sikkerhedsudstyr

Info

Publication number
DK158686C
DK158686C DK489380A DK489380A DK158686C DK 158686 C DK158686 C DK 158686C DK 489380 A DK489380 A DK 489380A DK 489380 A DK489380 A DK 489380A DK 158686 C DK158686 C DK 158686C
Authority
DK
Denmark
Prior art keywords
antenals
antenna system
electronic security
security equipment
shield received
Prior art date
Application number
DK489380A
Other languages
Danish (da)
English (en)
Other versions
DK489380A (da
DK158686B (da
Inventor
George Jay Lichtblau
Original Assignee
Lichtblau G J
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Lichtblau G J filed Critical Lichtblau G J
Publication of DK489380A publication Critical patent/DK489380A/da
Publication of DK158686B publication Critical patent/DK158686B/da
Application granted granted Critical
Publication of DK158686C publication Critical patent/DK158686C/da

Links

Classifications

    • GPHYSICS
    • G08SIGNALLING
    • G08BSIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
    • G08B13/00Burglar, theft or intruder alarms
    • G08B13/22Electrical actuation
    • G08B13/24Electrical actuation by interference with electromagnetic field distribution
    • G08B13/2402Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
    • G08B13/2465Aspects related to the EAS system, e.g. system components other than tags
    • G08B13/2468Antenna in system and the related signal processing
    • G08B13/2471Antenna signal processing by receiver or emitter
    • GPHYSICS
    • G08SIGNALLING
    • G08BSIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
    • G08B13/00Burglar, theft or intruder alarms
    • G08B13/22Electrical actuation
    • G08B13/24Electrical actuation by interference with electromagnetic field distribution
    • G08B13/2402Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
    • G08B13/2465Aspects related to the EAS system, e.g. system components other than tags
    • G08B13/2468Antenna in system and the related signal processing
    • G08B13/2474Antenna or antenna activator geometry, arrangement or layout
    • HELECTRICITY
    • H01ELECTRIC ELEMENTS
    • H01QANTENNAS, i.e. RADIO AERIALS
    • H01Q7/00Loop antennas with a substantially uniform current distribution around the loop and having a directional radiation pattern in a plane perpendicular to the plane of the loop
    • H01Q7/04Screened antennas

Landscapes

  • Engineering & Computer Science (AREA)
  • Physics & Mathematics (AREA)
  • Signal Processing (AREA)
  • Automation & Control Theory (AREA)
  • Computer Security & Cryptography (AREA)
  • Electromagnetism (AREA)
  • General Physics & Mathematics (AREA)
  • Burglar Alarm Systems (AREA)
  • Variable-Direction Aerials And Aerial Arrays (AREA)
  • Details Of Aerials (AREA)
DK489380A 1979-11-15 1980-11-14 Antennesystem med skaermet modtagerantenne til brug i elektronisk sikkerhedsudstyr DK158686C (da)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US06/094,429 US4251808A (en) 1979-11-15 1979-11-15 Shielded balanced loop antennas for electronic security systems
US9442979 1979-11-15

Publications (3)

Publication Number Publication Date
DK489380A DK489380A (da) 1981-05-16
DK158686B DK158686B (da) 1990-07-02
DK158686C true DK158686C (da) 1991-02-25

Family

ID=22245143

Family Applications (1)

Application Number Title Priority Date Filing Date
DK489380A DK158686C (da) 1979-11-15 1980-11-14 Antennesystem med skaermet modtagerantenne til brug i elektronisk sikkerhedsudstyr

Country Status (13)

Country Link
US (1) US4251808A (show.php)
JP (1) JPS5683000A (show.php)
AU (1) AU530083B2 (show.php)
CA (1) CA1148630A (show.php)
DE (1) DE3043026A1 (show.php)
DK (1) DK158686C (show.php)
ES (2) ES496218A0 (show.php)
FR (1) FR2470976A1 (show.php)
GB (1) GB2063569B (show.php)
IT (1) IT1129351B (show.php)
MX (1) MX148678A (show.php)
SE (1) SE445498B (show.php)
ZA (1) ZA806639B (show.php)

Families Citing this family (63)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA1138955A (en) * 1979-09-14 1983-01-04 Edward R. Fearon Anti-shoplifting system
US4373163A (en) * 1980-07-14 1983-02-08 I.D. Engineering, Inc. Loop antenna for security systems
US4384281A (en) * 1980-10-31 1983-05-17 Knogo Corporation Theft detection apparatus using saturable magnetic targets
US4342999A (en) * 1980-11-25 1982-08-03 Rca Corporation Loop antenna arrangements for inclusion in a television receiver
USRE32627E (en) * 1981-09-10 1988-03-22 Sensormatic Electronics Corporation Electrical surveillance apparatus with moveable antenna elements
US4394645A (en) * 1981-09-10 1983-07-19 Sensormatic Electronics Corporation Electrical surveillance apparatus with moveable antenna elements
EP0130973A1 (en) * 1983-01-03 1985-01-16 SHIN, Myong Anti-shoplifting system
US4509039A (en) * 1983-07-05 1985-04-02 Minnesota Mining And Manufacturing Company Shielded, closely spaced transmit-receiver antennas for electronic article surveillance system
US4531117A (en) * 1983-07-05 1985-07-23 Minnesota Mining And Manufacturing Company Variable frequency RF electronic surveillance system
US4609911A (en) * 1983-07-05 1986-09-02 Minnesota Mining And Manufacturing Company Variable frequency RF electronic surveillance system
US4642613A (en) * 1984-03-16 1987-02-10 Knogo Corporation Electronic theft detection apparatus with responder elements on protected articles
AU633247B2 (en) * 1985-01-10 1993-01-28 Checkpoint Systems, Inc. Antenna system for magnetic and resonant circuit detection
US4751516A (en) * 1985-01-10 1988-06-14 Lichtblau G J Antenna system for magnetic and resonant circuit detection
US4647910A (en) * 1985-09-17 1987-03-03 Allied Corporation Selector for AC magnetic inductive field receiver coils
US4728938A (en) * 1986-01-10 1988-03-01 Checkpoint Systems, Inc. Security tag deactivation system
US4769631A (en) * 1986-06-30 1988-09-06 Sensormatic Electronics Corporation Method, system and apparatus for magnetic surveillance of articles
JPS63236401A (ja) * 1987-03-25 1988-10-03 Kokusai Electric Co Ltd 誘導無線装置用ループアンテナ
US4779077A (en) * 1987-04-13 1988-10-18 Lichtblau G J Continuously armed high reliability pulse train processor
US4872018A (en) * 1987-08-31 1989-10-03 Monarch Marking Systems, Inc. Multiple loop antenna
US4972198A (en) * 1987-08-31 1990-11-20 Monarch Marking Systems, Inc. Multiple loop antenna
US5121103A (en) * 1988-07-29 1992-06-09 Knogo Corporation Load isolated article surveillance system and antenna assembly
US5103235A (en) * 1988-12-30 1992-04-07 Checkpoint Systems, Inc. Antenna structure for an electronic article surveillance system
US4999641A (en) * 1989-09-01 1991-03-12 Monarch Marking Systems, Inc. Magnetic antenna system having independently controllable electrical field shielding and magnetic field balance
GB9004431D0 (en) * 1990-02-28 1990-04-25 Scient Generics Ltd Detection system for security systems
US5051726A (en) * 1990-08-14 1991-09-24 Sensormatic Electronics Corporation Electronic article surveillance system with antenna array for enhanced field falloff
NL9100397A (nl) * 1991-03-06 1992-10-01 Nedap Nv Asymmetrische antenne voor winkeldiefstaldetectiesystemen.
US5142292A (en) * 1991-08-05 1992-08-25 Checkpoint Systems, Inc. Coplanar multiple loop antenna for electronic article surveillance systems
US5442334A (en) * 1992-07-20 1995-08-15 Stoplift Corporation Security system having deactivatable security tag
US5404147A (en) * 1992-10-28 1995-04-04 Sensormatic Electronics Corporation EAS system loop antenna having three loops of different area
US5373301A (en) * 1993-01-04 1994-12-13 Checkpoint Systems, Inc. Transmit and receive antenna having angled crossover elements
DE59406653D1 (de) * 1993-07-13 1998-09-17 Actron Entwicklungs Ag Antennenvorrichtung
US5694139A (en) * 1994-06-28 1997-12-02 Sony Corporation Short-distance communication antenna and methods of manufacturing and using the short-distance communication antenna
EP0703637A1 (de) 1994-09-23 1996-03-27 Actron Entwicklungs AG Antenne für ein elektronisches Sicherungssystem
EP0829108B1 (en) * 1995-05-30 2007-03-28 Sensormatic Electronics Corporation Eas system antenna configuration for providing improved interrogation field distribution
US5602556A (en) * 1995-06-07 1997-02-11 Check Point Systems, Inc. Transmit and receive loop antenna
US5825335A (en) * 1995-10-23 1998-10-20 Kubota Corporation Sheet antenna apparatus
US5653192A (en) * 1996-03-06 1997-08-05 Alfa Laval Agri Inc. Livestock identification apparatus
US5825291A (en) * 1996-04-10 1998-10-20 Sentry Technology Corporation Electronic article surveillance system
US5914692A (en) * 1997-01-14 1999-06-22 Checkpoint Systems, Inc. Multiple loop antenna with crossover element having a pair of spaced, parallel conductors for electrically connecting the multiple loops
DE19732254A1 (de) * 1997-07-26 1999-02-11 Kaba Benzing Gmbh Vorrichtung zur Übermittlung magnetischer Signale mittels einer Leiterplatte
JP3389464B2 (ja) 1997-08-07 2003-03-24 三洋電機株式会社 盗難防止ゲート
US6611783B2 (en) 2000-01-07 2003-08-26 Nocwatch, Inc. Attitude indicator and activity monitoring device
EP1158601A1 (de) * 2000-05-15 2001-11-28 Häni Prolectron Ag Trägerelement für eine Antenne mit geringer Handempfindlichkeit
US7030750B2 (en) 2002-07-16 2006-04-18 Bert Taeho Lee Detachable entrance and exit gate with a combined commodity burglarproofing and small arms detecting system
US6900727B2 (en) 2002-07-16 2005-05-31 Bert Taeho Lee Weapon detector system
KR200298223Y1 (ko) * 2002-09-11 2002-12-16 태호 리 버트 총기류 탐지 겸용 상품도난 방지장치의 출입게이트 구조
US20040102870A1 (en) * 2002-11-26 2004-05-27 Andersen Scott Paul RFID enabled paper rolls and system and method for tracking inventory
EP1719087B1 (en) * 2004-02-19 2008-05-07 Koninklijke Philips Electronics N.V. Method and apparatus for communicating the existence of an emergency situation without uniquely identifying the source of the communication
US7591415B2 (en) * 2004-09-28 2009-09-22 3M Innovative Properties Company Passport reader for processing a passport having an RFID element
US20070252001A1 (en) * 2006-04-25 2007-11-01 Kail Kevin J Access control system with RFID and biometric facial recognition
EP2327230B1 (en) 2008-09-04 2013-03-27 Allflex Usa, Inc. Combination full-duplex and half-duplex electronic identification tag
AU2010303188B2 (en) * 2009-10-09 2014-12-04 Allflex Australia Pty Limited HDX demodulator
NZ599876A (en) * 2009-10-09 2013-11-29 Aleis Pty Ltd Radio frequency identification reader antenna having a dynamically adjustable q-factor
CA2783571C (en) * 2009-11-04 2018-01-09 Allflex Usa, Inc. Signal cancelling transmit/receive multi-loop antenna for a radio frequency identification reader
US20120139730A1 (en) * 2010-12-03 2012-06-07 Metrologic Instruments, Inc. Electronic article surveillance system
CA2828750C (en) * 2011-04-25 2017-01-03 Harris Corporation In situ radio frequency catalytic upgrading
US9671478B2 (en) * 2011-07-22 2017-06-06 Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. Antenna and antenna arrangement for magnetic resonance applications
JP2014533994A (ja) 2011-10-11 2014-12-18 センセオニクス,インコーポレーテッド 電気力学的場強度誘起システム
US9577349B2 (en) 2015-06-29 2017-02-21 Near Field Magnetics, Inc. Near-field magnetic communication antenna
DE102017105649A1 (de) * 2017-03-16 2018-09-20 Bundesdruckerei Gmbh RFID-Lesegerät und Verfahren zu seiner Herstellung
US11277028B2 (en) 2017-05-26 2022-03-15 Nucurrent, Inc. Wireless electrical energy transmission system for flexible device orientation
US11283303B2 (en) * 2020-07-24 2022-03-22 Nucurrent, Inc. Area-apportioned wireless power antenna for maximized charging volume
US11695302B2 (en) 2021-02-01 2023-07-04 Nucurrent, Inc. Segmented shielding for wide area wireless power transmitter

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB419783A (en) * 1933-02-02 1934-11-19 Marconi Wireless Telegraph Co Improvements in and relating to wireless receiving apparatus
US2391026A (en) * 1943-11-15 1945-12-18 Standard Telephones Cables Ltd Shielded loop antenna
JPS4327094Y1 (show.php) * 1964-02-25 1968-11-09
US3810147A (en) * 1971-12-30 1974-05-07 G Lichtblau Electronic security system
US3863244A (en) * 1972-06-14 1975-01-28 Lichtblau G J Electronic security system having improved noise discrimination
US3967161A (en) * 1972-06-14 1976-06-29 Lichtblau G J A multi-frequency resonant tag circuit for use with an electronic security system having improved noise discrimination
US3973263A (en) * 1973-04-20 1976-08-03 The United States Of America As Represented By The Secretary Of The Navy Sensitivity improvement of spaced-loop antenna by capacitive gap loading
JPS5046062A (show.php) * 1973-08-28 1975-04-24
JPS5226879A (en) * 1975-08-26 1977-02-28 Nippon Telegr & Teleph Corp <Ntt> Method of measuring phase constants in waveguides
US4243980A (en) * 1978-02-17 1981-01-06 Lichtblau G J Antenna system for electronic security installations
US4260990A (en) * 1979-11-08 1981-04-07 Lichtblau G J Asymmetrical antennas for use in electronic security systems

Also Published As

Publication number Publication date
JPH0230553B2 (show.php) 1990-07-06
IT8068658A0 (it) 1980-10-30
ES8202958A1 (es) 1982-02-16
MX148678A (es) 1983-05-27
DE3043026A1 (de) 1981-05-21
CA1148630A (en) 1983-06-21
AU6298980A (en) 1981-06-04
AU530083B2 (en) 1983-06-30
FR2470976A1 (fr) 1981-06-12
ZA806639B (en) 1981-11-25
ES496218A0 (es) 1982-02-16
ES8302369A1 (es) 1982-12-16
SE445498B (sv) 1986-06-23
US4251808A (en) 1981-02-17
FR2470976B1 (show.php) 1984-11-23
GB2063569A (en) 1981-06-03
ES507188A0 (es) 1982-12-16
DK489380A (da) 1981-05-16
IT1129351B (it) 1986-06-04
GB2063569B (en) 1983-06-22
DK158686B (da) 1990-07-02
SE8007986L (sv) 1981-05-16
DE3043026C2 (show.php) 1990-02-22
JPS5683000A (en) 1981-07-07

Similar Documents

Publication Publication Date Title
DK158686C (da) Antennesystem med skaermet modtagerantenne til brug i elektronisk sikkerhedsudstyr
DK476280A (da) Asymnetrisk antenne til brug i elektroniske sikkerhedssystemer
JPS54115099A (en) Antenna system for electronic security system
GB2051442B (en) Security system
GB2123194B (en) Security apparatus
JPS5383900A (en) Protection system
GB2052023B (en) Hangfire protection system
DK158420C (da) Elektronisk sikkerhedsudstyr
GB2051211B (en) Security device
JPS5474399A (en) Security facility
IT1052933B (it) Apparecchiatura di telesegnalazione particolarmente adatta per protezione antifurto ed antieffrazione
DK506880A (da) Afspaerringsklap med laekagesikring i roerledningssystemer
FR2488231B1 (fr) Dispositif de blocage en matiere de manutention de fardeaux
SG35283G (en) Improvements in security systems
IL55850A (en) Security fence
GB2039683B (en) Security system
JPS55129897A (en) Protection device
ZA827956B (en) Portable security alarm
IL51464A0 (en) Improvements in locking arrangements particularly for safes
JPS55109816A (en) Selfflocking and aligning nut lock
SE7812057L (sv) Fallsekring for sekringslina
IL59018A (en) Corrosion protection structure and method
GB2132685B (en) Security device for use with casement stays
JPS5431396A (en) Electronic fixeddtime unlocking system
JPS5599691A (en) Shoplift and burglar preventing device