DK132401C - Analogifremgangsmade til fremstilling af alicycliske phenoxycarboxylsyrederivater eller salte deraf - Google Patents

Analogifremgangsmade til fremstilling af alicycliske phenoxycarboxylsyrederivater eller salte deraf

Info

Publication number
DK132401C
DK132401C DK301373*A DK301373A DK132401C DK 132401 C DK132401 C DK 132401C DK 301373 A DK301373 A DK 301373A DK 132401 C DK132401 C DK 132401C
Authority
DK
Denmark
Prior art keywords
alicyclic
salts
preparation
acid derivatives
phenoxycarboxylic acid
Prior art date
Application number
DK301373*A
Other languages
Danish (da)
English (en)
Other versions
DK132401B (da
Inventor
Y Suzuki
M Minai
N Hamma
E Murayama
S Aono
Original Assignee
Sumitomo Chemical Co
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Sumitomo Chemical Co filed Critical Sumitomo Chemical Co
Publication of DK132401B publication Critical patent/DK132401B/da
Application granted granted Critical
Publication of DK132401C publication Critical patent/DK132401C/da

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C62/00Compounds having carboxyl groups bound to carbon atoms of rings other than six—membered aromatic rings and containing any of the groups OH, O—metal, —CHO, keto, ether, groups, groups, or groups
    • C07C62/30Unsaturated compounds
    • C07C62/34Unsaturated compounds containing ether groups, groups, groups, or groups
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C51/00Preparation of carboxylic acids or their salts, halides or anhydrides
    • C07C51/347Preparation of carboxylic acids or their salts, halides or anhydrides by reactions not involving formation of carboxyl groups
    • C07C51/367Preparation of carboxylic acids or their salts, halides or anhydrides by reactions not involving formation of carboxyl groups by introduction of functional groups containing oxygen only in singly bound form
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C69/00Esters of carboxylic acids; Esters of carbonic or haloformic acids
    • C07C69/74Esters of carboxylic acids having an esterified carboxyl group bound to a carbon atom of a ring other than a six-membered aromatic ring
    • C07C69/757Esters of carboxylic acids having an esterified carboxyl group bound to a carbon atom of a ring other than a six-membered aromatic ring having any of the groups OH, O—metal, —CHO, keto, ether, acyloxy, groups, groups, or in the acid moiety

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Engineering & Computer Science (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
DK301373*A 1972-06-01 1973-05-30 Analogifremgangsmade til fremstilling af alicycliske phenoxycarboxylsyrederivater eller salte deraf DK132401C (da)

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
JP5484972A JPS575214B2 (enFirst) 1972-06-01 1972-06-01

Publications (2)

Publication Number Publication Date
DK132401B DK132401B (da) 1975-12-01
DK132401C true DK132401C (da) 1976-05-31

Family

ID=12982036

Family Applications (1)

Application Number Title Priority Date Filing Date
DK301373*A DK132401C (da) 1972-06-01 1973-05-30 Analogifremgangsmade til fremstilling af alicycliske phenoxycarboxylsyrederivater eller salte deraf

Country Status (18)

Country Link
US (1) US4082913A (enFirst)
JP (1) JPS575214B2 (enFirst)
AU (1) AU469089B2 (enFirst)
BE (1) BE800243A (enFirst)
CA (1) CA1002061A (enFirst)
CH (1) CH591412A5 (enFirst)
CS (2) CS172392B2 (enFirst)
DD (1) DD107015A5 (enFirst)
DE (1) DE2327659C2 (enFirst)
DK (1) DK132401C (enFirst)
FI (1) FI55328C (enFirst)
FR (1) FR2186268B1 (enFirst)
GB (1) GB1397697A (enFirst)
HU (1) HU166642B (enFirst)
NL (1) NL7307531A (enFirst)
NO (1) NO141553C (enFirst)
SE (1) SE390728B (enFirst)
ZA (1) ZA733641B (enFirst)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ZA200609870B (en) * 2004-05-04 2009-12-30 Acadia Pharm Inc Compounds with activity at estrogen receptor
US7825265B2 (en) * 2004-05-04 2010-11-02 Acadia Pharmaceuticals Inc. Compounds with activity at estrogen receptors

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2370256A (en) * 1940-01-09 1945-02-27 Joseph B Niederl Alkylated phenolic glycolic acids
GB860303A (en) * 1958-06-20 1961-02-01 Ici Ltd Pharmaceutical compositions comprising ª‡-aryloxy-aliphatic carboxylic acids and/or ª
US3097139A (en) * 1960-03-10 1963-07-09 Ici Ltd Hypocholesterolaemia compositions
US3332957A (en) * 1964-09-02 1967-07-25 Ciba Geigy Corp Amino esters of substituted phenoxy acetic acids
US3546273A (en) * 1967-06-01 1970-12-08 Merck & Co Inc Ester derivatives of 2-(4-halophenoxy)alkanoic acids
FI52570C (fi) * 1969-04-16 1977-10-10 Sumitomo Chemical Co Menetelmä veren kolesteroli- tai lipoidipitoisuutta alentavien fenoxia lifaattisten karboksyylihappoyhdisteiden ja -esteriyhdisteiden valmist amiseksi.
US4008265A (en) * 1971-05-22 1977-02-15 Sumitomo Chemical Company, Limited Novel bisphenoxy carboxylic acid derivatives and their salts

Also Published As

Publication number Publication date
NO141553B (no) 1979-12-27
DK132401B (da) 1975-12-01
HU166642B (enFirst) 1975-04-28
CA1002061A (en) 1976-12-21
JPS4913156A (enFirst) 1974-02-05
CH591412A5 (enFirst) 1977-09-15
CS172392B2 (enFirst) 1976-12-29
ZA733641B (en) 1974-04-24
DE2327659C2 (de) 1984-03-22
FR2186268A1 (enFirst) 1974-01-11
AU5627973A (en) 1974-12-05
GB1397697A (en) 1975-06-18
FR2186268B1 (enFirst) 1976-05-14
FI55328C (fi) 1979-07-10
DD107015A5 (enFirst) 1974-07-12
BE800243A (fr) 1973-09-17
NO141553C (no) 1980-04-09
CS172391B2 (enFirst) 1976-12-29
AU469089B2 (en) 1976-02-05
FI55328B (fi) 1979-03-30
JPS575214B2 (enFirst) 1982-01-29
DE2327659A1 (de) 1973-12-20
NL7307531A (enFirst) 1973-12-04
US4082913A (en) 1978-04-04
SE390728B (sv) 1977-01-17

Similar Documents

Publication Publication Date Title
DK132119C (da) Analogifremgangsmade til fremstilling af cephalosporansyrederivater eller farmaceutisk acceptable salte deraf
DK149893C (da) Analogifremgangsmaade til fremstilling af thiazolderivater eller farmaceutisk acceptable salte deraf
DK131725C (da) Analogifremgangsmade til fremstilling af 2,4-diaminoquinazoliner eller salte deraf
DK135585C (da) Analogifremgangsmade til fremstilling af cycloheptenderivatereller syreadditionssalte deraf
DK139387C (da) Analogifremgangsmaade til fremstilling af apovincaminsyrederivater eller syreadditionssalte deraf
DK134400B (da) Analogifremgangsmade til fremstilling af (1-p-chlorbenzoyl)-5-methoxy-2-methyl-3-indol)acetoxyeddikesyre eller salte deraf
DK138855C (da) Analogifremgangsmaade til fremstilling af penicilliner eller ikke-toksiske farmaceutisk acceptable salte deraf
DK149230C (da) Analogifremgangsmaade til fremstilling af 5-benzoyl-6-hydroxy-indan-1-carboxylsyrederivater eller farmaceutisk acceptable salte deraf
DK136468C (da) Analogifremgangsmade til fremstilling af 1-ethylimidazoler eller salte deraf
DK131778C (da) Fremgangsmade til fremstilling af substituerede 3-hydroksymetylisokinolinderivater eller syreadditionssalte heraf
DK131857C (da) Analogifremgangsmade til fremstilling af 4-hydroxymethyl-1-phthalazonderivater eller syreadditionssalte deraf
DK133153C (da) Analogifremgangsmade til fremstilling af tetrahydrocyklopropadibenzazepinderivater eller salte deraf
DK133980C (da) Analogifremgangsmade til fremstilling af racemiske eller optisk aktive diphenylalkyllactamimidderivater eller syreadditionssalte deraf
DK137011B (da) Analogifremgangsmade til fremstilling af oxazoler eller salte heraf
DK134438C (da) Analogifremgangsmade til fremstilling af pencilliner eller salte deraf
DK133004C (da) Analogifremgangsmade til fremstilling af racemiske eller optisk aktive benzomorphanderivater eller salte deraf
DK132401C (da) Analogifremgangsmade til fremstilling af alicycliske phenoxycarboxylsyrederivater eller salte deraf
DK135941C (da) Analogifremgangsmaade til fremstilling af 1-cyclopropyl-1-phenyl-3-amino-1-propanoler eller syreaddittionssalte deraf
SE402452B (sv) Forfarande for framstellning av n-(dietylaminoetyl)-2-metoxi-4-amino-5-klorbensamid eller syraadditionssalter eller kvarternera ammoniumsalter derav
DK132662C (da) Analogifremgangsmade til fremstilling af 2beta,16beta-bis-(4-metyl-piperazino)-3alfa,17beta-diacetoxy-5alfa-androstan eller kvaternere salte deraf
DK134517C (da) Analogifremgangsmade til fremstilling af indolcarboxylsyrer eller estere eller salte heraf
DK139427C (da) Fremgangsmaade til fremstilling af benzensulfonylurinstoffer eller salte deraf
DK133005C (da) Analogifremgangsmade til fremstilling af racemisk eller optisk aktiv 1-cyclohexenyl-glycinamidopenicillansyre eller -cephalosporansyrer eller salte deraf
DK132551C (da) Analogifremgangsmade til fremstilling af racemiske eller optisk aktive carbamoylalkoxyphenoxyisopropanolaminderivater eller syreadditionssalte deraf
DK132076C (da) Fremgangsmade til fremstilling af benzomorphanderivater ellerdisses syreadditionssalte