DE4041623A1 - NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYING - Google Patents

NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYING

Info

Publication number
DE4041623A1
DE4041623A1 DE4041623A DE4041623A DE4041623A1 DE 4041623 A1 DE4041623 A1 DE 4041623A1 DE 4041623 A DE4041623 A DE 4041623A DE 4041623 A DE4041623 A DE 4041623A DE 4041623 A1 DE4041623 A1 DE 4041623A1
Authority
DE
Germany
Prior art keywords
cooling
nozzle
gas
area
ambient air
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
DE4041623A
Other languages
German (de)
Inventor
Goetz Matthaeus
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
OSU MASCHINENBAU GmbH
Original Assignee
OSU MASCHINENBAU GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by OSU MASCHINENBAU GmbH filed Critical OSU MASCHINENBAU GmbH
Priority to DE4041623A priority Critical patent/DE4041623A1/en
Priority to EP91121679A priority patent/EP0492384B1/en
Priority to DE59105625T priority patent/DE59105625D1/en
Priority to AT91121679T priority patent/ATE123238T1/en
Publication of DE4041623A1 publication Critical patent/DE4041623A1/en
Withdrawn legal-status Critical Current

Links

Classifications

    • BPERFORMING OPERATIONS; TRANSPORTING
    • B05SPRAYING OR ATOMISING IN GENERAL; APPLYING FLUENT MATERIALS TO SURFACES, IN GENERAL
    • B05BSPRAYING APPARATUS; ATOMISING APPARATUS; NOZZLES
    • B05B7/00Spraying apparatus for discharge of liquids or other fluent materials from two or more sources, e.g. of liquid and air, of powder and gas
    • B05B7/16Spraying apparatus for discharge of liquids or other fluent materials from two or more sources, e.g. of liquid and air, of powder and gas incorporating means for heating or cooling the material to be sprayed
    • B05B7/20Spraying apparatus for discharge of liquids or other fluent materials from two or more sources, e.g. of liquid and air, of powder and gas incorporating means for heating or cooling the material to be sprayed by flame or combustion
    • B05B7/201Spraying apparatus for discharge of liquids or other fluent materials from two or more sources, e.g. of liquid and air, of powder and gas incorporating means for heating or cooling the material to be sprayed by flame or combustion downstream of the nozzle
    • FMECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
    • F23COMBUSTION APPARATUS; COMBUSTION PROCESSES
    • F23DBURNERS
    • F23D14/00Burners for combustion of a gas, e.g. of a gas stored under pressure as a liquid
    • F23D14/46Details, e.g. noise reduction means
    • F23D14/72Safety devices, e.g. operative in case of failure of gas supply
    • F23D14/78Cooling burner parts

Abstract

A nozzle (1) for a device for high-speed flame spraying of metallic, metallic-carbidic and/or oxide-ceramic materials, the nozzle (1) being fitted with a spraying medium feed, a gas mixture feed with combustion chamber and a cooled acceleration zone (4), is intended to provide a solution by means of which the temperature of the flame is adjustable, wherein the temperature-regulating fluid can be used directly in the high-speed flame spraying. This is achieved if, at least for a part of the cooling of the acceleration zone (4), gas-cooling channels (9) and/or gas-cooling annular spaces for ambient air as cooling gas with injection orifices (11) for drawing the cooling gas into the interior of the nozzle (1) are provided.

Description

Die Erfindung richtet sich auf eine Düse für eine Vorrich­ tung zum Hochgeschwindigkeitsflammenspritzen von metalli­ schen, metallisch-carabidischen und/oder oxidkeramischen Werkstoffen, wobei die Düse mit einer Spritzmedienzufuhr, einer Gasgemischzufuhr mit Brennkammer und einem gekühlten Beschleunigungsbereich ausgerüstet ist, sowie auf ein ent­ sprechendes Verfahren.The invention is directed to a nozzle for a Vorrich device for high-speed flame spraying from metalli metallic, carabid and / or oxide ceramic Materials, the nozzle being supplied with a spray medium, a gas mixture supply with combustion chamber and a cooled one Acceleration range is equipped, as well as on an ent speaking procedure.

Düsen zum Hochgeschwindigkeitsflammenspritzen sind in un­ terschiedlichen Gestaltungen bekannt, wobei den bekannten Düsen gemeinsam ist, daß diese wassergekühlten Beschleuni­ gungs- bzw. Stabilisierungsbereiche aufweisen. Als Bei­ spiel für eine Vielzahl derartiger Lösungen seien hier an­ geben die DE 39 03 887-A1 sowie die europäischen Patentan­ meldungen EP 00 49 915-A1, EP 01 35 826-A1, EP 02 49 790-A2 und EP 03 61 709-A1. Nachteilig an dieser Lösung ist, daß die vom Kühlwasser aufgenommene Energie dem Prozeß verloren geht. Auch kann das Kühlwasser zu son­ stigen Zwecken in der Regel nicht eingesetzt werden, d. h. hier wird ein Fluid bewegt, das nur und ausschließlich zur Kühlung herangezogen wird.Nozzles for high speed flame spraying are in un Different designs known, the known Common to nozzles is that these water-cooled accelerations have areas of stabilization. As at play here for a variety of such solutions give DE 39 03 887-A1 and the European patent reports EP 00 49 915-A1, EP 01 35 826-A1, EP 02 49 790-A2 and EP 03 61 709-A1. Disadvantage of this The solution is that the energy absorbed by the cooling water the process is lost. The cooling water can also become too hot other purposes are generally not used, d. H. here a fluid is moved that is only and exclusively for Cooling is used.

Aufgabe der Erfindung ist die Schaffung einer Lösung, mit der die Temperatur der Flamme einstellbar ist, wobei das temperaturregelnde Fluid unmittelbar beim Hochgeschwindig­ keitsflammenspritzen eingesetzt werden kann.The object of the invention is to provide a solution with which is the temperature of the flame adjustable, the  temperature regulating fluid immediately at high speed flame spraying can be used.

Mit einer Düse der eingangs bezeichneten Art wird diese Aufgabe gemäß der Erfindung dadurch gelöst, daß wenigstens für einen Teil der Kühlung des Beschleunigungsbereiches Gaskühlkanäle und/oder Ringräume für Umgebungsluft als Kühlgas mit Injektionsöffnungen zum Ansaugen des Kühlgases in das Innere der Düse vorgesehen sind.With a nozzle of the type described in the beginning Object achieved according to the invention in that at least for part of the cooling of the acceleration area Gas cooling channels and / or annular spaces for ambient air as Cooling gas with injection openings for sucking in the cooling gas are provided in the interior of the nozzle.

Verfahrensmäßig wird diese Aufgabe gemäß der Erfindung da­ durch gelöst, daß zur Optimierung der Temperatur und/oder Geschwindigkeit der Spritzflamme zur Kühlung wenigstens ei­ nes Teiles des Beschleunigungsbereiches Umgebungsluft der Düse eingesetzt und dem Flammenspritzbereich zugeführt wird.In terms of method, this object is achieved according to the invention solved by that to optimize the temperature and / or Speed of the spray flame for cooling at least one egg part of the acceleration range ambient air Nozzle inserted and fed to the flame spray area becomes.

Mit der erfindungsgemäßen Verfahrensweise bzw. der erfin­ dungsgemäßen Düse läßt sich mit einfachen Mitteln eine sehr vielfältige Einflußnahme auf das Flammenspritzen er­ möglichen. So besteht bei kurzen Düsen die Möglichkeit auf eine Wasserkühlung gänzlich zu verzichten. Die Kühlluft wird von der Düse in das Innere gesaugt und steht daher mit ihrer gesamten Energie unmittelbar dem Flammenspritzen zur Verfügung, d. h. die einzusetzende Energie kann redu­ ziert werden. Umgekehrt kann bei Aufrechterhaltung der gleichen Energie durch die Kühlung die Geschwindigkeit des Gasstromes durch die angesogene Kühlluft vergrößert wer­ den.With the procedure according to the invention or the inventions Invention nozzle can be a simple means very diverse influence on flame spraying he possible. So there is the possibility with short nozzles to dispense with water cooling entirely. The cooling air is sucked into the interior of the nozzle and therefore stands with all their energy directly from the flame spray available, d. H. the energy to be used can be reduced be decorated. Conversely, while maintaining the same energy by cooling the speed of the  Gas flow through the sucked cooling air increases who the.

Eine andere Möglichkeit besteht mit der erfindungsgemäßen Düse bzw. mit der erfindungsgemäßen Verfahrensweise darin, die Flamme heiß zu belassen durch das Hinzufügen der Umge­ bungsluft, aber die Strömung zu verlangsamen, wenn sie nicht unmittelbar in das Innere eingesogen oder nur teil­ weise angesogen wird.Another possibility is with the invention Nozzle or with the procedure according to the invention therein, to keep the flame hot by adding the reverse exercise air, but to slow the flow when it not directly absorbed into the interior or only partially being sucked wisely.

Weitere vorteilhafte Ausgestaltungen sowohl der Düse als auch der erfindungsgemäßen Verfahrensweise ergeben sich aus den Unteransprüchen.Further advantageous configurations of both the nozzle and the procedure according to the invention also results from the subclaims.

Die Düsen können dabei mit Kühlkanälen ausgerüstet sein, in denen zusätzliche Kühlrippen vorgesehen sind. Die Gas­ führung kann auch so gewählt werden, daß sie von außen nach innen querschnittlich meanderförmig einen vergleichs­ weise langen Strömungsweg bis in das Innere der Düse zur Verfügung hat, um eine große Menge an Wärme aufzunehmen.The nozzles can be equipped with cooling channels, in which additional cooling fins are provided. The gas leadership can also be chosen so that it from the outside internally cross-sectional meandering a comparison wise long flow path to the inside of the nozzle To absorb a large amount of heat.

Es können mehrere Einströmungsbereiche in das Innere des Strömungskanales der Düse für Kühlluft vorgesehen sein, wo­ bei es auch möglich ist, Kühlringkanäle vorzusehen, die sich kaskadenartig zur Spitze hin erweitern, allerdings mit getrennten Gaszuführungen versehen sind und die sich bis zur Spitze hin vergrößern, um die Gasvolumina ableiten zu können.There can be several areas of inflow into the interior of the Flow channel of the nozzle for cooling air can be provided where when it is also possible to provide cooling ring channels that expand cascading towards the top, however are provided with separate gas feeds and the Increase to the top to derive gas volumes  to be able to.

Zweckmäßig kann es auch sein, wenn ein Teil der Kühlgase als Mantelgase am Ende der Düse aufgegeben wird und nur ein Teil im Bereich der Zünd- bzw. Brennkammer in das Inne­ re der Düse eingesogen wird.It can also be useful if some of the cooling gases is given up as jacket gases at the end of the nozzle and only a part inside the ignition or combustion chamber the nozzle is sucked in.

Je nach Betriebsart kann es sinnvoll sein, sich nicht nur auf das Ansaugverhalten zu verlassen, sondern gezielt zu­ sätzlich als Kühlluft Preßluft aufzugeben, wie dies die Er­ findung ebenfalls vorsieht.Depending on the operating mode, it can be useful not only rely on the suction behavior, but specifically additionally give up compressed air as cooling air, as is the case with the Er provision also provides.

Die Erfindung ist nachstehend anhand der Zeichnung bei­ spielsweise näher erläutert. Diese zeigt jeweils im Schnitt in den Fig. 1-7 einen Ouerschnitt durch unter­ schiedliche Düsenformen nach der Erfindung.The invention is explained below with reference to the drawing, for example. These each show in section in FIGS . 1-7 an Ouerschnitt through under different nozzle shapes according to the invention.

In der nachfolgenden Beschreibung der Fig. 1-7 werden al­ le diejenigen Teile mit den identischen Bezugsziffern ver­ sehen, die funktionsmäßig gleich sind, ggf. zur besseren Identifizierung ergänzt durch Kleinbuchstaben.In the following description of FIGS. 1-7, all those parts with the identical reference numerals that are functionally the same are seen, possibly supplemented by lower case letters for better identification.

Zunächst sei am Beispiel der Fig. 1 der grundsätzliche Auf­ bau einer Düse nach der Erfindung beschrieben. Die allge­ mein mit 1 bezeichnete Düse weist einen Düsenkopf 2 auf, wobei in Strömungsrichtung stromabwärts, d. h. in Fig. 1 nach rechts, dem mit 3 bezeichneten Brennerdüsenmund ein Beschleunigungs- bzw. Bündelungsbereich 4 folgt. Der Be­ schleunigungsbereich 4 endet am eigentlichen Düsenmund, der im Beispiel nach Fig. 1 mit 5 bezeichnet ist.First, the basic construction of a nozzle according to the invention will be described using the example of FIG. 1. The general my with 1 nozzle has a nozzle head 2 , wherein in the flow direction downstream, ie in Fig. 1 to the right, the burner nozzle mouth designated 3 , an acceleration or bundling area 4 follows. Be the acceleration region 4 ends at the actual nozzle mouth, which is denoted by 5 in the example of FIG. 1.

Der Beschleunigungsbereich 4 ist von einem etwa zylindri­ schen Bauteil 6 umgeben, das mit seiner in Fig. 1 kegel­ stumpfförmig ausgebildeten Innenbohrung teilweise den Dü­ senkopf 2 umgibt und außen von zwei Überwurfhülsen 7 bzw. 8 derart umgeben ist, daß sich, wie dargestellt, ein Strö­ mungskanal bildet. Am äußeren inneren, mit 10 bezeichneten Ende der Düse 2, sind am Umfang verteilt Ansaugbohrungen 11 vorgesehen.The acceleration range 4 is surrounded by an approximately cylindrical component 6 , which partially surrounds the nozzle head 2 with its frustoconical inner bore in FIG. 1 and is surrounded on the outside by two coupling sleeves 7 and 8 such that, as shown, a Flow channel forms. At the outer inner end, designated 10 , of the nozzle 2 , suction bores 11 are provided distributed around the circumference.

Bei Betrieb der Düse 1 wird eine in Fig. 1 von links nach rechts angenommene Düsenströmung erzeugt, die mit einer Vielzahl von kleinen Pfeilen 12 angedeutet ist. Damit wird in dem Beschleunigungsbereich 4 ein Unterdruck erzeugt, derart, daß über die ringförmigen Gaskühlkanäle 9 von au­ ßen Umgebungsluft durch die Injektionsöffnungen bzw. An­ saugöffnungen 11 angesogen wird, der Verlauf der Umgebungs­ luftströmung ist ebenfalls durch kleine Pfeile wiedergege­ ben, im Bereich der Ansaugung ist einer der Pfeile mit 13 bezeichnet.When the nozzle 1 is in operation, a nozzle flow assumed from left to right in FIG. 1 is generated, which is indicated by a large number of small arrows 12 . So that a vacuum is generated in the acceleration area 4 , such that suction air is sucked in from the outside through the injection openings or suction openings 11 via the annular gas cooling channels 9 , the course of the ambient air flow is also shown by small arrows ben, in the suction area one of the arrows is designated by 13 .

Dargestellt ist in Fig. 1 noch, daß die Außenwand des den Beschleunigungsbereich umgebenden zylindrischen Teiles 6 zusätzlich mit Kühlrippen 14 ausgestattet sein kann, an de­ nen die angesogene Luft vorbeistreicht und damit die Küh­ lung erhöhen kann.Is shown in Fig. 1 that the outer wall of the acceleration portion surrounding the cylindrical part 6 may also be equipped with cooling fins 14 , the sucked air passes by de NEN and thus the cooling can increase.

In Fig. 2 ist ein abgewandeltes Ausführungsbeispiel darge­ stellt, wobei dort das den Beschleunigungsbereich 4a umge­ bende Bauteil zweischalig ausgebildet ist und dort die Be­ zugszeichen 6a und 6b trägt. Das im wesentlichen zylindri­ sche Element 6a trägt die Ansaugöffnungen 11, während das ebenfalls im wesentlichen zylindrische Element 6b weitere Ansaugöffnungen 11a trägt, derart, daß die Umgebung von Kühlluft zweistufig angesaugt werden kann.In Fig. 2, a modified embodiment is Darge, where there is the acceleration area 4 a surrounding component is double-skinned and there carries the reference numerals 6 a and 6 b. The substantially cylindri cal element 6 a carries the suction openings 11 , while the also substantially cylindrical element 6 b carries further suction openings 11 a, such that the surroundings of cooling air can be sucked in two stages.

Eine etwas andere Gestaltung zeigt diesbezüglich die Fig. 3, bei der das Element 6c einen Ansaugringspalt 11c frei­ läßt, die außerhalb der Kühlkanäle 9c liegenden Ansaugöff­ nungen für Umgebungsluft sind in Fig. 3 mit 11b bezeich­ net.A somewhat different design shows in this respect the Fig. 3, in which the element 6 c a c Ansaugringspalt 11 can be free, the Ansaugöff c lying outside the cooling channels 9 voltages for ambient air are shown in Fig. 3 with 11 b designated net.

In Fig. 4 ist eine andere Art der Konstruktion darge­ stellt, die insbesondere dazu dient, beispielsweise Umge­ bungsluft als Hüllgas der mit 1c bezeichneten Düse zur Ver­ fügung zu stellen, wobei dort ringförmige Kühlkanäle 9d und 9e kaskadenartig hintereinander angeordnet sind und sich jeweils im Durchmesser vergrößern. Der Düsenkörper 6d kann als Einbauteil gestaltet sein, entsprechende, sich an Innenwände anlegende Ringdichtungen sind eingezeichnet und mit 15 bezeichnet. Vor dem mit 5a bezeichneten Düsenmund können noch weitere Elemente etwa nach den Fig. 2 und 3 vorgesehen sein, was in Fig. 4 nicht näher dargestellt ist.In Fig. 4, another type of construction is Darge, which is particularly used, for example, to provide ambient air as the enveloping gas of the nozzle denoted by 1 c to Ver, where there are annular cooling channels 9 d and 9 e cascaded one behind the other and themselves enlarge each in diameter. The nozzle body 6 d can be designed as a built-in part, corresponding ring seals bearing against inner walls are shown and designated by 15 . In front of the nozzle mouth designated 5 a, further elements can be provided, for example according to FIGS . 2 and 3, which is not shown in FIG. 4.

Die Düse 1c kann auch als Kaskadeninjektor eingesetzt wer­ den, in der Weise, daß durch die Ansaugöffnungen 17 oder 17′ unterschiedliche Brenngase zumischbar sind oder aber auch unterschiedliche Brenngase mit Kühlgas, wobei die vor­ dere Ringöffnung 16 auch ersetzbar ist durch eine Mehrzahl am Umfang verteilte Austrittbohrungen 16′.The nozzle 1 c can also be used as a cascade injector, in such a way that different fuel gases can be mixed in through the suction openings 17 or 17 'or else different fuel gases with cooling gas, the front ring opening 16 also being replaceable by a plurality on the circumference distributed outlet bores 16 '.

Die Fig. 5 zeigt bei Anlauf querschnittlich meanderförmig gestaltete Kühlkanäle 9f, wobei bei dieser Konstruktion vergleichsweise kleine Injektionsbohrungen 11f vorgesehen sind und eine vordere ringförmige Austrittsöffnung 16a, mittels der das Kühlgas als Mantelgas zuführbar ist. FIG. 5 shows cooling channels 9 f with cross-sectional meandering design, in this construction comparatively small injection bores 11 f are provided and a front annular outlet opening 16 a, by means of which the cooling gas can be supplied as jacket gas.

Durch Pfeile 17 bzw. 17a in den Fig. 4 bzw. 5 ist darge­ stellt, daß hier auch Kühlgas nicht zwingend von der Umge­ bung zuführbar ist, sondern z. B. als Preßluft aufgegeben werden kann.By arrows 17 and 17 a in FIGS . 4 and 5 Darge represents that here also cooling gas is not mandatory from the environment, but z. B. can be given as compressed air.

Schließlich zeigen die Fig. 6 und 7 Gestaltungsmöglichkei­ ten der Düsen 1e und 1f, bei denen im Bereich des Düsenkör­ pers 2 bzw. 2f die Umgebungsluftkühlung vorgesehen ist, während Teile des Beschleunigungsbereiches 4e bzw. 4f bei­ spielsweise eine Wasserkühlung aufweisen, was mit deren Kühlkanäle hier mit 17 bzw. 17a und 18 bezeichnet sind.Finally, FIGS. 6 and 7 show design options of the nozzles 1 e and 1 f, in which the ambient air cooling is provided in the area of the nozzle body 2 or 2 f, while parts of the acceleration range 4 e and 4 f have, for example, water cooling what are designated with their cooling channels here with 17 or 17 a and 18 .

Natürlich ist das beschriebene Ausführungsbeispiel der Er­ findung noch in vielfacher Hinsicht abzuändern, ohne den Grundgedanken zu verlassen. So sei insbesondere darauf hin­ gewiesen, daß die Erfindung nicht auf die dargestellten vereinfacht wiedergegebenen Düsenformen beschränkt ist. Die Art der Konstruktion ist dort nur angedeutet. Je nach Einsatz kann auch ein Wechsel zwischen Gas- und Flüssig­ keitskühlung vorgenommen werden und dgl. mehr.Of course, the described embodiment is the Er change in many ways without the To leave basic ideas. So be especially careful pointed out that the invention is not illustrated simplified nozzle shapes is limited. The type of construction is only hinted at there. Depending on A switch between gas and liquid can also be used cooling can be made and the like. More.

Claims (12)

1. Düse für eine Vorrichtung zum Hochgeschwindigkeitsflammen­ spritzen von metallischen, metallisch-carbidischen und/ oder oxidkeramischen Werkstoffen, wobei die Düse mit einer Spritzmedienzufuhr, einer Gasgemischzufuhr mit Brennkammer und einem gekühlten Beschleunigungsbereich ausgerüstet ist, dadurch gekennzeichnet, daß wenigstens für einen Teil der Kühlung des Beschleuni­ gungsbereiches (4) Gaskühlkanäle (9) und/oder -ringräume für Umgebungsluft als Kühlgas mit Injektionsöffnungen (11) zum Ansaugen des Kühlgases in das Innere der Düse (1) vor­ gesehen sind.1. Nozzle for a device for high-speed flame spraying of metallic, metallic-carbide and / or oxide-ceramic materials, the nozzle being equipped with a spray medium supply, a gas mixture supply with combustion chamber and a cooled acceleration area, characterized in that at least for part of the cooling of the Accelerating range ( 4 ) gas cooling channels ( 9 ) and / or annular spaces for ambient air as cooling gas with injection openings ( 11 ) for sucking the cooling gas into the interior of the nozzle ( 1 ) are seen before. 2. Vorrichtung nach Anspruch 1, dadurch gekennzeichnet, daß im Strömungshereich (9) des Kühlgases Kühlrippen (14) vorgesehen sind.2. Device according to claim 1, characterized in that cooling fins ( 14 ) are provided in the flow area ( 9 ) of the cooling gas. 3. Vorrichtung nach Anspruch 1 oder 2, dadurch gekennzeichnet, daß die zum Inneren der Düse (1a) weisenden Ansaug- bzw. Injektionsöffnungen (11, 11a) für Kühlgase in unterschiedli­ chen Düsenebenen vorgesehen sind. 3. Apparatus according to claim 1 or 2, characterized in that the suction or injection openings ( 11 , 11 a) facing the interior of the nozzle ( 1 a) are provided for cooling gases in various nozzle levels. 4. Vorrichtung nach einem der vorangehenden Ansprüche, dadurch gekennzeichnet, daß die Gaskühlkanäle querschnittlich (9f) etwa meanderför­ mig ausgebildet sind.4. Device according to one of the preceding claims, characterized in that the gas cooling channels are cross-sectionally ( 9 f) approximately meanderför mig. 5. Vorrichtung nach einem der vorangehenden Ansprüche, dadurch gekennzeichnet, daß im Düsenmundbereich (5) eine Ringöffnung (16) zum Aus­ tritt von als Mantel ausgebildetem Kühlgas vorgesehen ist.5. Device according to one of the preceding claims, characterized in that in the nozzle mouth region ( 5 ) an annular opening ( 16 ) for the passage of cooling gas formed as a jacket is provided. 6. Vorrichtung nach einem der vorangehenden Ansprüche, dadurch gekennzeichnet, daß ein Teilbereich der gekühlten Beschleunigungsdüsen­ strecke (4e, 4f) mit einer Flüssigkeitskühlung (17, 18) aus­ gebildet ist.6. Device according to one of the preceding claims, characterized in that a portion of the cooled accelerating nozzle section ( 4 e, 4 f) with a liquid cooling ( 17 , 18 ) is formed. 7. Vorrichtung nach Anspruch 1, dadurch gekennzeichnet, daß zur Kühlung kaskadenartig sich zur Spitze hin erwei­ ternde Ringkanäle (9d, 9e) mit getrennten Gaszuführungen vorgesehen sind.7. The device according to claim 1, characterized in that for cooling cascade extending to the tip outward ring channels ( 9 d, 9 e) are provided with separate gas supplies. 8. Vorrichtung nach einem der vorangehenden Ansprüche, dadurch gekennzeichnet, daß die Düse als Kaskadeninjektor (Fig. 4) ausgebildet ist mit einer Mehrzahl von Zuführungen für Brenngas, Kühlgas und/oder Brenngase unterschiedlicher Zusammensetzungen, wo­ bei im Düsenmundbereich (5a) am Umfang verteilt Austritts­ bohrungen (16′) oder eine Ringöffnung (16) vorgesehen sind.8. Device according to one of the preceding claims, characterized in that the nozzle is designed as a cascade injector ( Fig. 4) with a plurality of feeds for fuel gas, cooling gas and / or fuel gases of different compositions, where in the nozzle mouth area ( 5 a) on the circumference Distributed outlet holes ( 16 ') or an annular opening ( 16 ) are provided. 9. Verfahren zum Hochgeschwindigkeitsflammenspritzen unter Einsatz von gekühlten Beschleunigungsbereichen von Spritz­ düsen, dadurch gekennzeichnet, daß zur Optimierung der Temperatur und/oder Geschwindig­ keit der Spritzflamme zur Kühlung wenigstens eines Teiles des Beschleunigungsbereiches Umgebungsluft der Düse einge­ setzt und dem Flammspritzbereich zugeführt wird.9. Process for high speed flame spraying under Use of Spritz's cooled acceleration ranges nozzles, characterized, that to optimize temperature and / or speed speed of the spray flame for cooling at least one part of the acceleration range ambient air of the nozzle sets and is fed to the flame spray area. 10. Verfahren nach Anspruch 9, dadurch gekennzeichnet, daß die Umgebungsluft über Injektionsöffnungen unmittelbar in das Innere der Düse eingesogen wird.10. The method according to claim 9, characterized, that the ambient air directly through injection openings is sucked into the interior of the nozzle. 11. Verfahren nach Anspruch 9 oder 10, dadurch gekennzeichnet, daß wenigstens ein Teil der Kühlgase über Ringöffnungen im Düsenmundbereich als Mantelgas aufgegeben wird.11. The method according to claim 9 or 10, characterized, that at least part of the cooling gases through ring openings in the Nozzle mouth area is given up as jacket gas. 12. Verfahren nach Anspruch 9 oder einem der folgenden, dadurch gekennzeichnet, daß zusätzlich Druckluft als Kühlluft eingesetzt wird.12. The method according to claim 9 or one of the following, characterized, that additional compressed air is used as cooling air.
DE4041623A 1990-12-22 1990-12-22 NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYING Withdrawn DE4041623A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
DE4041623A DE4041623A1 (en) 1990-12-22 1990-12-22 NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYING
EP91121679A EP0492384B1 (en) 1990-12-22 1991-12-18 Nozzle for device and method for high-speed flame spraying
DE59105625T DE59105625D1 (en) 1990-12-22 1991-12-18 Nozzle for an apparatus and method for high speed flame spraying.
AT91121679T ATE123238T1 (en) 1990-12-22 1991-12-18 NOZZLE FOR A DEVICE AND METHOD FOR HIGH-VELOCITY FLAME SPRAYING.

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
DE4041623A DE4041623A1 (en) 1990-12-22 1990-12-22 NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYING

Publications (1)

Publication Number Publication Date
DE4041623A1 true DE4041623A1 (en) 1992-06-25

Family

ID=6421326

Family Applications (2)

Application Number Title Priority Date Filing Date
DE4041623A Withdrawn DE4041623A1 (en) 1990-12-22 1990-12-22 NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYING
DE59105625T Expired - Fee Related DE59105625D1 (en) 1990-12-22 1991-12-18 Nozzle for an apparatus and method for high speed flame spraying.

Family Applications After (1)

Application Number Title Priority Date Filing Date
DE59105625T Expired - Fee Related DE59105625D1 (en) 1990-12-22 1991-12-18 Nozzle for an apparatus and method for high speed flame spraying.

Country Status (3)

Country Link
EP (1) EP0492384B1 (en)
AT (1) ATE123238T1 (en)
DE (2) DE4041623A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090246398A1 (en) * 2006-08-14 2009-10-01 Nakayama Steel Works ,Ltd. Method and apparatus for forming amorphous coating film

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5467926A (en) * 1994-02-10 1995-11-21 Solar Turbines Incorporated Injector having low tip temperature
JP3823591B2 (en) * 1999-03-25 2006-09-20 三菱電機株式会社 Vaporizing apparatus for CVD raw material and CVD apparatus using the same
FR2928278A1 (en) * 2008-03-04 2009-09-11 Dominique Bayle Powder coating product flame-spraying device for use in e.g. building site, has trolley to support powder-coated reservoir with powder suction unit and pistol, where mixture of powder with compressed air is realized at level of suction unit
US8857733B1 (en) * 2009-01-14 2014-10-14 Resodyn Corporation Flameless thermal spray system using flame heat source
US20110229649A1 (en) * 2010-03-22 2011-09-22 Baranovski Viatcheslav E Supersonic material flame spray method and apparatus
DE102011052120A1 (en) 2011-07-25 2013-01-31 Eckart Gmbh Use of specially coated, powdery coating materials and coating methods using such coating materials
US20140230692A1 (en) 2011-07-25 2014-08-21 Eckart Gmbh Methods for Substrate Coating and Use of Additive-Containing Powdered Coating Materials in Such Methods
DE102011052119A1 (en) 2011-07-25 2013-01-31 Eckart Gmbh Coating method of particle-containing powdery coating material used for automobile component, involves performing flame spraying, high-speed flame spraying, thermal plasma spraying and/or non-thermal plasma spraying method
DE102011052121A1 (en) 2011-07-25 2013-01-31 Eckart Gmbh Coating process using special powder coating materials and use of such coating materials
EP2959992A1 (en) 2014-06-26 2015-12-30 Eckart GmbH Method for producing a particulate-containing aerosol
CN115161584B (en) * 2022-07-01 2023-04-28 国家电投集团江西水电检修安装工程有限公司 Flame thermal spraying method and cavitation-resistant turbine runner blade

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB733401A (en) * 1950-09-20 1955-07-13 Rheem Mfg Co Improvements in flame spray apparatus, particularly for spraying with a fusible material
CA1141650A (en) * 1980-07-10 1983-02-22 Leonard M. Barisoff Blowpipe type of burner

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090246398A1 (en) * 2006-08-14 2009-10-01 Nakayama Steel Works ,Ltd. Method and apparatus for forming amorphous coating film

Also Published As

Publication number Publication date
DE59105625D1 (en) 1995-07-06
EP0492384A1 (en) 1992-07-01
EP0492384B1 (en) 1995-05-31
ATE123238T1 (en) 1995-06-15

Similar Documents

Publication Publication Date Title
EP0741627B1 (en) Nozzle assembly for laser beam cutting
EP0433790B1 (en) Burner
DE2143012C3 (en) Burner arrangement in a gas turbine combustor
DE1725022C3 (en) Flame spray gun
DE3722446C2 (en)
DE2060401A1 (en) Fuel injector for a gas turbine jet engine
DE4041623A1 (en) NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYING
EP0598189A1 (en) Pulverizer for an oil burner
EP0740063A1 (en) Injector of coaxial configuration for a rocket combustion chamber
DE3903887A1 (en) DEVICE FOR FLAME SPRAYING POWDERED MATERIALS BY MEANS OF AUTOGENIC FLAME
EP0661447A1 (en) Injection nozzle
DE3321697C2 (en)
EP0175875A1 (en) Oil or gas burner for hot gas generation
DE2808051A1 (en) COMBUSTION CHAMBER FOR A GAS TURBINE OR DGL.
DE1198130B (en) Burner for ring-shaped combustion chambers
DE102014010439A1 (en) Cold spraying device
EP2531320B1 (en) Nozzle for a liquid-cooled plasma cutting torch with grooves
DE2345838A1 (en) BURNER
DE1258194B (en) Liquid injection device for a rocket combustion chamber
DE4205744C2 (en) Internal combustion engine fuel injector
DE1902637B2 (en) OXYGEN BLOWLING LANE FOR CONVERTER ROTATING IN AN INCLUDED POSITION
DE2138746A1 (en) Liquid fuel burners
DE60114317T2 (en) Liquid cooled lance with coherent jet
CH665139A5 (en) GAS BURNER FOR WIRE METAL SPRAYING.
DE1551771C3 (en) Combustion device with a combustion chamber for internal combustion of a fuel gas-air mixture

Legal Events

Date Code Title Description
8139 Disposal/non-payment of the annual fee