DE4041623A1 - NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYING - Google Patents
NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYINGInfo
- Publication number
- DE4041623A1 DE4041623A1 DE4041623A DE4041623A DE4041623A1 DE 4041623 A1 DE4041623 A1 DE 4041623A1 DE 4041623 A DE4041623 A DE 4041623A DE 4041623 A DE4041623 A DE 4041623A DE 4041623 A1 DE4041623 A1 DE 4041623A1
- Authority
- DE
- Germany
- Prior art keywords
- cooling
- nozzle
- gas
- area
- ambient air
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B05—SPRAYING OR ATOMISING IN GENERAL; APPLYING FLUENT MATERIALS TO SURFACES, IN GENERAL
- B05B—SPRAYING APPARATUS; ATOMISING APPARATUS; NOZZLES
- B05B7/00—Spraying apparatus for discharge of liquids or other fluent materials from two or more sources, e.g. of liquid and air, of powder and gas
- B05B7/16—Spraying apparatus for discharge of liquids or other fluent materials from two or more sources, e.g. of liquid and air, of powder and gas incorporating means for heating or cooling the material to be sprayed
- B05B7/20—Spraying apparatus for discharge of liquids or other fluent materials from two or more sources, e.g. of liquid and air, of powder and gas incorporating means for heating or cooling the material to be sprayed by flame or combustion
- B05B7/201—Spraying apparatus for discharge of liquids or other fluent materials from two or more sources, e.g. of liquid and air, of powder and gas incorporating means for heating or cooling the material to be sprayed by flame or combustion downstream of the nozzle
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F23—COMBUSTION APPARATUS; COMBUSTION PROCESSES
- F23D—BURNERS
- F23D14/00—Burners for combustion of a gas, e.g. of a gas stored under pressure as a liquid
- F23D14/46—Details, e.g. noise reduction means
- F23D14/72—Safety devices, e.g. operative in case of failure of gas supply
- F23D14/78—Cooling burner parts
Abstract
Description
Die Erfindung richtet sich auf eine Düse für eine Vorrich tung zum Hochgeschwindigkeitsflammenspritzen von metalli schen, metallisch-carabidischen und/oder oxidkeramischen Werkstoffen, wobei die Düse mit einer Spritzmedienzufuhr, einer Gasgemischzufuhr mit Brennkammer und einem gekühlten Beschleunigungsbereich ausgerüstet ist, sowie auf ein ent sprechendes Verfahren.The invention is directed to a nozzle for a Vorrich device for high-speed flame spraying from metalli metallic, carabid and / or oxide ceramic Materials, the nozzle being supplied with a spray medium, a gas mixture supply with combustion chamber and a cooled one Acceleration range is equipped, as well as on an ent speaking procedure.
Düsen zum Hochgeschwindigkeitsflammenspritzen sind in un terschiedlichen Gestaltungen bekannt, wobei den bekannten Düsen gemeinsam ist, daß diese wassergekühlten Beschleuni gungs- bzw. Stabilisierungsbereiche aufweisen. Als Bei spiel für eine Vielzahl derartiger Lösungen seien hier an geben die DE 39 03 887-A1 sowie die europäischen Patentan meldungen EP 00 49 915-A1, EP 01 35 826-A1, EP 02 49 790-A2 und EP 03 61 709-A1. Nachteilig an dieser Lösung ist, daß die vom Kühlwasser aufgenommene Energie dem Prozeß verloren geht. Auch kann das Kühlwasser zu son stigen Zwecken in der Regel nicht eingesetzt werden, d. h. hier wird ein Fluid bewegt, das nur und ausschließlich zur Kühlung herangezogen wird.Nozzles for high speed flame spraying are in un Different designs known, the known Common to nozzles is that these water-cooled accelerations have areas of stabilization. As at play here for a variety of such solutions give DE 39 03 887-A1 and the European patent reports EP 00 49 915-A1, EP 01 35 826-A1, EP 02 49 790-A2 and EP 03 61 709-A1. Disadvantage of this The solution is that the energy absorbed by the cooling water the process is lost. The cooling water can also become too hot other purposes are generally not used, d. H. here a fluid is moved that is only and exclusively for Cooling is used.
Aufgabe der Erfindung ist die Schaffung einer Lösung, mit der die Temperatur der Flamme einstellbar ist, wobei das temperaturregelnde Fluid unmittelbar beim Hochgeschwindig keitsflammenspritzen eingesetzt werden kann.The object of the invention is to provide a solution with which is the temperature of the flame adjustable, the temperature regulating fluid immediately at high speed flame spraying can be used.
Mit einer Düse der eingangs bezeichneten Art wird diese Aufgabe gemäß der Erfindung dadurch gelöst, daß wenigstens für einen Teil der Kühlung des Beschleunigungsbereiches Gaskühlkanäle und/oder Ringräume für Umgebungsluft als Kühlgas mit Injektionsöffnungen zum Ansaugen des Kühlgases in das Innere der Düse vorgesehen sind.With a nozzle of the type described in the beginning Object achieved according to the invention in that at least for part of the cooling of the acceleration area Gas cooling channels and / or annular spaces for ambient air as Cooling gas with injection openings for sucking in the cooling gas are provided in the interior of the nozzle.
Verfahrensmäßig wird diese Aufgabe gemäß der Erfindung da durch gelöst, daß zur Optimierung der Temperatur und/oder Geschwindigkeit der Spritzflamme zur Kühlung wenigstens ei nes Teiles des Beschleunigungsbereiches Umgebungsluft der Düse eingesetzt und dem Flammenspritzbereich zugeführt wird.In terms of method, this object is achieved according to the invention solved by that to optimize the temperature and / or Speed of the spray flame for cooling at least one egg part of the acceleration range ambient air Nozzle inserted and fed to the flame spray area becomes.
Mit der erfindungsgemäßen Verfahrensweise bzw. der erfin dungsgemäßen Düse läßt sich mit einfachen Mitteln eine sehr vielfältige Einflußnahme auf das Flammenspritzen er möglichen. So besteht bei kurzen Düsen die Möglichkeit auf eine Wasserkühlung gänzlich zu verzichten. Die Kühlluft wird von der Düse in das Innere gesaugt und steht daher mit ihrer gesamten Energie unmittelbar dem Flammenspritzen zur Verfügung, d. h. die einzusetzende Energie kann redu ziert werden. Umgekehrt kann bei Aufrechterhaltung der gleichen Energie durch die Kühlung die Geschwindigkeit des Gasstromes durch die angesogene Kühlluft vergrößert wer den.With the procedure according to the invention or the inventions Invention nozzle can be a simple means very diverse influence on flame spraying he possible. So there is the possibility with short nozzles to dispense with water cooling entirely. The cooling air is sucked into the interior of the nozzle and therefore stands with all their energy directly from the flame spray available, d. H. the energy to be used can be reduced be decorated. Conversely, while maintaining the same energy by cooling the speed of the Gas flow through the sucked cooling air increases who the.
Eine andere Möglichkeit besteht mit der erfindungsgemäßen Düse bzw. mit der erfindungsgemäßen Verfahrensweise darin, die Flamme heiß zu belassen durch das Hinzufügen der Umge bungsluft, aber die Strömung zu verlangsamen, wenn sie nicht unmittelbar in das Innere eingesogen oder nur teil weise angesogen wird.Another possibility is with the invention Nozzle or with the procedure according to the invention therein, to keep the flame hot by adding the reverse exercise air, but to slow the flow when it not directly absorbed into the interior or only partially being sucked wisely.
Weitere vorteilhafte Ausgestaltungen sowohl der Düse als auch der erfindungsgemäßen Verfahrensweise ergeben sich aus den Unteransprüchen.Further advantageous configurations of both the nozzle and the procedure according to the invention also results from the subclaims.
Die Düsen können dabei mit Kühlkanälen ausgerüstet sein, in denen zusätzliche Kühlrippen vorgesehen sind. Die Gas führung kann auch so gewählt werden, daß sie von außen nach innen querschnittlich meanderförmig einen vergleichs weise langen Strömungsweg bis in das Innere der Düse zur Verfügung hat, um eine große Menge an Wärme aufzunehmen.The nozzles can be equipped with cooling channels, in which additional cooling fins are provided. The gas leadership can also be chosen so that it from the outside internally cross-sectional meandering a comparison wise long flow path to the inside of the nozzle To absorb a large amount of heat.
Es können mehrere Einströmungsbereiche in das Innere des Strömungskanales der Düse für Kühlluft vorgesehen sein, wo bei es auch möglich ist, Kühlringkanäle vorzusehen, die sich kaskadenartig zur Spitze hin erweitern, allerdings mit getrennten Gaszuführungen versehen sind und die sich bis zur Spitze hin vergrößern, um die Gasvolumina ableiten zu können.There can be several areas of inflow into the interior of the Flow channel of the nozzle for cooling air can be provided where when it is also possible to provide cooling ring channels that expand cascading towards the top, however are provided with separate gas feeds and the Increase to the top to derive gas volumes to be able to.
Zweckmäßig kann es auch sein, wenn ein Teil der Kühlgase als Mantelgase am Ende der Düse aufgegeben wird und nur ein Teil im Bereich der Zünd- bzw. Brennkammer in das Inne re der Düse eingesogen wird.It can also be useful if some of the cooling gases is given up as jacket gases at the end of the nozzle and only a part inside the ignition or combustion chamber the nozzle is sucked in.
Je nach Betriebsart kann es sinnvoll sein, sich nicht nur auf das Ansaugverhalten zu verlassen, sondern gezielt zu sätzlich als Kühlluft Preßluft aufzugeben, wie dies die Er findung ebenfalls vorsieht.Depending on the operating mode, it can be useful not only rely on the suction behavior, but specifically additionally give up compressed air as cooling air, as is the case with the Er provision also provides.
Die Erfindung ist nachstehend anhand der Zeichnung bei spielsweise näher erläutert. Diese zeigt jeweils im Schnitt in den Fig. 1-7 einen Ouerschnitt durch unter schiedliche Düsenformen nach der Erfindung.The invention is explained below with reference to the drawing, for example. These each show in section in FIGS . 1-7 an Ouerschnitt through under different nozzle shapes according to the invention.
In der nachfolgenden Beschreibung der Fig. 1-7 werden al le diejenigen Teile mit den identischen Bezugsziffern ver sehen, die funktionsmäßig gleich sind, ggf. zur besseren Identifizierung ergänzt durch Kleinbuchstaben.In the following description of FIGS. 1-7, all those parts with the identical reference numerals that are functionally the same are seen, possibly supplemented by lower case letters for better identification.
Zunächst sei am Beispiel der Fig. 1 der grundsätzliche Auf bau einer Düse nach der Erfindung beschrieben. Die allge mein mit 1 bezeichnete Düse weist einen Düsenkopf 2 auf, wobei in Strömungsrichtung stromabwärts, d. h. in Fig. 1 nach rechts, dem mit 3 bezeichneten Brennerdüsenmund ein Beschleunigungs- bzw. Bündelungsbereich 4 folgt. Der Be schleunigungsbereich 4 endet am eigentlichen Düsenmund, der im Beispiel nach Fig. 1 mit 5 bezeichnet ist.First, the basic construction of a nozzle according to the invention will be described using the example of FIG. 1. The general my with 1 nozzle has a nozzle head 2 , wherein in the flow direction downstream, ie in Fig. 1 to the right, the burner nozzle mouth designated 3 , an acceleration or bundling area 4 follows. Be the acceleration region 4 ends at the actual nozzle mouth, which is denoted by 5 in the example of FIG. 1.
Der Beschleunigungsbereich 4 ist von einem etwa zylindri schen Bauteil 6 umgeben, das mit seiner in Fig. 1 kegel stumpfförmig ausgebildeten Innenbohrung teilweise den Dü senkopf 2 umgibt und außen von zwei Überwurfhülsen 7 bzw. 8 derart umgeben ist, daß sich, wie dargestellt, ein Strö mungskanal bildet. Am äußeren inneren, mit 10 bezeichneten Ende der Düse 2, sind am Umfang verteilt Ansaugbohrungen 11 vorgesehen.The acceleration range 4 is surrounded by an approximately cylindrical component 6 , which partially surrounds the nozzle head 2 with its frustoconical inner bore in FIG. 1 and is surrounded on the outside by two coupling sleeves 7 and 8 such that, as shown, a Flow channel forms. At the outer inner end, designated 10 , of the nozzle 2 , suction bores 11 are provided distributed around the circumference.
Bei Betrieb der Düse 1 wird eine in Fig. 1 von links nach rechts angenommene Düsenströmung erzeugt, die mit einer Vielzahl von kleinen Pfeilen 12 angedeutet ist. Damit wird in dem Beschleunigungsbereich 4 ein Unterdruck erzeugt, derart, daß über die ringförmigen Gaskühlkanäle 9 von au ßen Umgebungsluft durch die Injektionsöffnungen bzw. An saugöffnungen 11 angesogen wird, der Verlauf der Umgebungs luftströmung ist ebenfalls durch kleine Pfeile wiedergege ben, im Bereich der Ansaugung ist einer der Pfeile mit 13 bezeichnet.When the nozzle 1 is in operation, a nozzle flow assumed from left to right in FIG. 1 is generated, which is indicated by a large number of small arrows 12 . So that a vacuum is generated in the acceleration area 4 , such that suction air is sucked in from the outside through the injection openings or suction openings 11 via the annular gas cooling channels 9 , the course of the ambient air flow is also shown by small arrows ben, in the suction area one of the arrows is designated by 13 .
Dargestellt ist in Fig. 1 noch, daß die Außenwand des den Beschleunigungsbereich umgebenden zylindrischen Teiles 6 zusätzlich mit Kühlrippen 14 ausgestattet sein kann, an de nen die angesogene Luft vorbeistreicht und damit die Küh lung erhöhen kann.Is shown in Fig. 1 that the outer wall of the acceleration portion surrounding the cylindrical part 6 may also be equipped with cooling fins 14 , the sucked air passes by de NEN and thus the cooling can increase.
In Fig. 2 ist ein abgewandeltes Ausführungsbeispiel darge stellt, wobei dort das den Beschleunigungsbereich 4a umge bende Bauteil zweischalig ausgebildet ist und dort die Be zugszeichen 6a und 6b trägt. Das im wesentlichen zylindri sche Element 6a trägt die Ansaugöffnungen 11, während das ebenfalls im wesentlichen zylindrische Element 6b weitere Ansaugöffnungen 11a trägt, derart, daß die Umgebung von Kühlluft zweistufig angesaugt werden kann.In Fig. 2, a modified embodiment is Darge, where there is the acceleration area 4 a surrounding component is double-skinned and there carries the reference numerals 6 a and 6 b. The substantially cylindri cal element 6 a carries the suction openings 11 , while the also substantially cylindrical element 6 b carries further suction openings 11 a, such that the surroundings of cooling air can be sucked in two stages.
Eine etwas andere Gestaltung zeigt diesbezüglich die Fig. 3, bei der das Element 6c einen Ansaugringspalt 11c frei läßt, die außerhalb der Kühlkanäle 9c liegenden Ansaugöff nungen für Umgebungsluft sind in Fig. 3 mit 11b bezeich net.A somewhat different design shows in this respect the Fig. 3, in which the element 6 c a c Ansaugringspalt 11 can be free, the Ansaugöff c lying outside the cooling channels 9 voltages for ambient air are shown in Fig. 3 with 11 b designated net.
In Fig. 4 ist eine andere Art der Konstruktion darge stellt, die insbesondere dazu dient, beispielsweise Umge bungsluft als Hüllgas der mit 1c bezeichneten Düse zur Ver fügung zu stellen, wobei dort ringförmige Kühlkanäle 9d und 9e kaskadenartig hintereinander angeordnet sind und sich jeweils im Durchmesser vergrößern. Der Düsenkörper 6d kann als Einbauteil gestaltet sein, entsprechende, sich an Innenwände anlegende Ringdichtungen sind eingezeichnet und mit 15 bezeichnet. Vor dem mit 5a bezeichneten Düsenmund können noch weitere Elemente etwa nach den Fig. 2 und 3 vorgesehen sein, was in Fig. 4 nicht näher dargestellt ist.In Fig. 4, another type of construction is Darge, which is particularly used, for example, to provide ambient air as the enveloping gas of the nozzle denoted by 1 c to Ver, where there are annular cooling channels 9 d and 9 e cascaded one behind the other and themselves enlarge each in diameter. The nozzle body 6 d can be designed as a built-in part, corresponding ring seals bearing against inner walls are shown and designated by 15 . In front of the nozzle mouth designated 5 a, further elements can be provided, for example according to FIGS . 2 and 3, which is not shown in FIG. 4.
Die Düse 1c kann auch als Kaskadeninjektor eingesetzt wer den, in der Weise, daß durch die Ansaugöffnungen 17 oder 17′ unterschiedliche Brenngase zumischbar sind oder aber auch unterschiedliche Brenngase mit Kühlgas, wobei die vor dere Ringöffnung 16 auch ersetzbar ist durch eine Mehrzahl am Umfang verteilte Austrittbohrungen 16′.The nozzle 1 c can also be used as a cascade injector, in such a way that different fuel gases can be mixed in through the suction openings 17 or 17 'or else different fuel gases with cooling gas, the front ring opening 16 also being replaceable by a plurality on the circumference distributed outlet bores 16 '.
Die Fig. 5 zeigt bei Anlauf querschnittlich meanderförmig gestaltete Kühlkanäle 9f, wobei bei dieser Konstruktion vergleichsweise kleine Injektionsbohrungen 11f vorgesehen sind und eine vordere ringförmige Austrittsöffnung 16a, mittels der das Kühlgas als Mantelgas zuführbar ist. FIG. 5 shows cooling channels 9 f with cross-sectional meandering design, in this construction comparatively small injection bores 11 f are provided and a front annular outlet opening 16 a, by means of which the cooling gas can be supplied as jacket gas.
Durch Pfeile 17 bzw. 17a in den Fig. 4 bzw. 5 ist darge stellt, daß hier auch Kühlgas nicht zwingend von der Umge bung zuführbar ist, sondern z. B. als Preßluft aufgegeben werden kann.By arrows 17 and 17 a in FIGS . 4 and 5 Darge represents that here also cooling gas is not mandatory from the environment, but z. B. can be given as compressed air.
Schließlich zeigen die Fig. 6 und 7 Gestaltungsmöglichkei ten der Düsen 1e und 1f, bei denen im Bereich des Düsenkör pers 2 bzw. 2f die Umgebungsluftkühlung vorgesehen ist, während Teile des Beschleunigungsbereiches 4e bzw. 4f bei spielsweise eine Wasserkühlung aufweisen, was mit deren Kühlkanäle hier mit 17 bzw. 17a und 18 bezeichnet sind.Finally, FIGS. 6 and 7 show design options of the nozzles 1 e and 1 f, in which the ambient air cooling is provided in the area of the nozzle body 2 or 2 f, while parts of the acceleration range 4 e and 4 f have, for example, water cooling what are designated with their cooling channels here with 17 or 17 a and 18 .
Natürlich ist das beschriebene Ausführungsbeispiel der Er findung noch in vielfacher Hinsicht abzuändern, ohne den Grundgedanken zu verlassen. So sei insbesondere darauf hin gewiesen, daß die Erfindung nicht auf die dargestellten vereinfacht wiedergegebenen Düsenformen beschränkt ist. Die Art der Konstruktion ist dort nur angedeutet. Je nach Einsatz kann auch ein Wechsel zwischen Gas- und Flüssig keitskühlung vorgenommen werden und dgl. mehr.Of course, the described embodiment is the Er change in many ways without the To leave basic ideas. So be especially careful pointed out that the invention is not illustrated simplified nozzle shapes is limited. The type of construction is only hinted at there. Depending on A switch between gas and liquid can also be used cooling can be made and the like. More.
Claims (12)
Priority Applications (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE4041623A DE4041623A1 (en) | 1990-12-22 | 1990-12-22 | NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYING |
EP91121679A EP0492384B1 (en) | 1990-12-22 | 1991-12-18 | Nozzle for device and method for high-speed flame spraying |
DE59105625T DE59105625D1 (en) | 1990-12-22 | 1991-12-18 | Nozzle for an apparatus and method for high speed flame spraying. |
AT91121679T ATE123238T1 (en) | 1990-12-22 | 1991-12-18 | NOZZLE FOR A DEVICE AND METHOD FOR HIGH-VELOCITY FLAME SPRAYING. |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE4041623A DE4041623A1 (en) | 1990-12-22 | 1990-12-22 | NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYING |
Publications (1)
Publication Number | Publication Date |
---|---|
DE4041623A1 true DE4041623A1 (en) | 1992-06-25 |
Family
ID=6421326
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
DE4041623A Withdrawn DE4041623A1 (en) | 1990-12-22 | 1990-12-22 | NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYING |
DE59105625T Expired - Fee Related DE59105625D1 (en) | 1990-12-22 | 1991-12-18 | Nozzle for an apparatus and method for high speed flame spraying. |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
DE59105625T Expired - Fee Related DE59105625D1 (en) | 1990-12-22 | 1991-12-18 | Nozzle for an apparatus and method for high speed flame spraying. |
Country Status (3)
Country | Link |
---|---|
EP (1) | EP0492384B1 (en) |
AT (1) | ATE123238T1 (en) |
DE (2) | DE4041623A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20090246398A1 (en) * | 2006-08-14 | 2009-10-01 | Nakayama Steel Works ,Ltd. | Method and apparatus for forming amorphous coating film |
Families Citing this family (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5467926A (en) * | 1994-02-10 | 1995-11-21 | Solar Turbines Incorporated | Injector having low tip temperature |
JP3823591B2 (en) * | 1999-03-25 | 2006-09-20 | 三菱電機株式会社 | Vaporizing apparatus for CVD raw material and CVD apparatus using the same |
FR2928278A1 (en) * | 2008-03-04 | 2009-09-11 | Dominique Bayle | Powder coating product flame-spraying device for use in e.g. building site, has trolley to support powder-coated reservoir with powder suction unit and pistol, where mixture of powder with compressed air is realized at level of suction unit |
US8857733B1 (en) * | 2009-01-14 | 2014-10-14 | Resodyn Corporation | Flameless thermal spray system using flame heat source |
US20110229649A1 (en) * | 2010-03-22 | 2011-09-22 | Baranovski Viatcheslav E | Supersonic material flame spray method and apparatus |
DE102011052120A1 (en) | 2011-07-25 | 2013-01-31 | Eckart Gmbh | Use of specially coated, powdery coating materials and coating methods using such coating materials |
US20140230692A1 (en) | 2011-07-25 | 2014-08-21 | Eckart Gmbh | Methods for Substrate Coating and Use of Additive-Containing Powdered Coating Materials in Such Methods |
DE102011052119A1 (en) | 2011-07-25 | 2013-01-31 | Eckart Gmbh | Coating method of particle-containing powdery coating material used for automobile component, involves performing flame spraying, high-speed flame spraying, thermal plasma spraying and/or non-thermal plasma spraying method |
DE102011052121A1 (en) | 2011-07-25 | 2013-01-31 | Eckart Gmbh | Coating process using special powder coating materials and use of such coating materials |
EP2959992A1 (en) | 2014-06-26 | 2015-12-30 | Eckart GmbH | Method for producing a particulate-containing aerosol |
CN115161584B (en) * | 2022-07-01 | 2023-04-28 | 国家电投集团江西水电检修安装工程有限公司 | Flame thermal spraying method and cavitation-resistant turbine runner blade |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB733401A (en) * | 1950-09-20 | 1955-07-13 | Rheem Mfg Co | Improvements in flame spray apparatus, particularly for spraying with a fusible material |
CA1141650A (en) * | 1980-07-10 | 1983-02-22 | Leonard M. Barisoff | Blowpipe type of burner |
-
1990
- 1990-12-22 DE DE4041623A patent/DE4041623A1/en not_active Withdrawn
-
1991
- 1991-12-18 EP EP91121679A patent/EP0492384B1/en not_active Expired - Lifetime
- 1991-12-18 DE DE59105625T patent/DE59105625D1/en not_active Expired - Fee Related
- 1991-12-18 AT AT91121679T patent/ATE123238T1/en not_active IP Right Cessation
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20090246398A1 (en) * | 2006-08-14 | 2009-10-01 | Nakayama Steel Works ,Ltd. | Method and apparatus for forming amorphous coating film |
Also Published As
Publication number | Publication date |
---|---|
DE59105625D1 (en) | 1995-07-06 |
EP0492384A1 (en) | 1992-07-01 |
EP0492384B1 (en) | 1995-05-31 |
ATE123238T1 (en) | 1995-06-15 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP0741627B1 (en) | Nozzle assembly for laser beam cutting | |
EP0433790B1 (en) | Burner | |
DE2143012C3 (en) | Burner arrangement in a gas turbine combustor | |
DE1725022C3 (en) | Flame spray gun | |
DE3722446C2 (en) | ||
DE2060401A1 (en) | Fuel injector for a gas turbine jet engine | |
DE4041623A1 (en) | NOZZLE FOR A DEVICE AND A METHOD FOR HIGH-SPEED FLAME SPRAYING | |
EP0598189A1 (en) | Pulverizer for an oil burner | |
EP0740063A1 (en) | Injector of coaxial configuration for a rocket combustion chamber | |
DE3903887A1 (en) | DEVICE FOR FLAME SPRAYING POWDERED MATERIALS BY MEANS OF AUTOGENIC FLAME | |
EP0661447A1 (en) | Injection nozzle | |
DE3321697C2 (en) | ||
EP0175875A1 (en) | Oil or gas burner for hot gas generation | |
DE2808051A1 (en) | COMBUSTION CHAMBER FOR A GAS TURBINE OR DGL. | |
DE1198130B (en) | Burner for ring-shaped combustion chambers | |
DE102014010439A1 (en) | Cold spraying device | |
EP2531320B1 (en) | Nozzle for a liquid-cooled plasma cutting torch with grooves | |
DE2345838A1 (en) | BURNER | |
DE1258194B (en) | Liquid injection device for a rocket combustion chamber | |
DE4205744C2 (en) | Internal combustion engine fuel injector | |
DE1902637B2 (en) | OXYGEN BLOWLING LANE FOR CONVERTER ROTATING IN AN INCLUDED POSITION | |
DE2138746A1 (en) | Liquid fuel burners | |
DE60114317T2 (en) | Liquid cooled lance with coherent jet | |
CH665139A5 (en) | GAS BURNER FOR WIRE METAL SPRAYING. | |
DE1551771C3 (en) | Combustion device with a combustion chamber for internal combustion of a fuel gas-air mixture |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
8139 | Disposal/non-payment of the annual fee |