DE102006032678A1 - Heating device for a mirror glass - Google Patents

Heating device for a mirror glass Download PDF

Info

Publication number
DE102006032678A1
DE102006032678A1 DE102006032678A DE102006032678A DE102006032678A1 DE 102006032678 A1 DE102006032678 A1 DE 102006032678A1 DE 102006032678 A DE102006032678 A DE 102006032678A DE 102006032678 A DE102006032678 A DE 102006032678A DE 102006032678 A1 DE102006032678 A1 DE 102006032678A1
Authority
DE
Germany
Prior art keywords
intermediate layer
heating device
mirror glass
mirror
conductor track
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
DE102006032678A
Other languages
German (de)
Inventor
Helmut Piringer
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bayerische Motoren Werke AG
Original Assignee
Bayerische Motoren Werke AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Bayerische Motoren Werke AG filed Critical Bayerische Motoren Werke AG
Priority to DE102006032678A priority Critical patent/DE102006032678A1/en
Priority to PCT/EP2007/005855 priority patent/WO2008006483A1/en
Publication of DE102006032678A1 publication Critical patent/DE102006032678A1/en
Withdrawn legal-status Critical Current

Links

Classifications

    • H—ELECTRICITY
    • H05—ELECTRIC TECHNIQUES NOT OTHERWISE PROVIDED FOR
    • H05B—ELECTRIC HEATING; ELECTRIC LIGHT SOURCES NOT OTHERWISE PROVIDED FOR; CIRCUIT ARRANGEMENTS FOR ELECTRIC LIGHT SOURCES, IN GENERAL
    • H05B3/00—Ohmic-resistance heating
    • H05B3/84—Heating arrangements specially adapted for transparent or reflecting areas, e.g. for demisting or de-icing windows, mirrors or vehicle windshields
    • H05B3/845—Heating arrangements specially adapted for transparent or reflecting areas, e.g. for demisting or de-icing windows, mirrors or vehicle windshields specially adapted for reflecting surfaces, e.g. bathroom - or rearview mirrors
    • B—PERFORMING OPERATIONS; TRANSPORTING
    • B60—VEHICLES IN GENERAL
    • B60R—VEHICLES, VEHICLE FITTINGS, OR VEHICLE PARTS, NOT OTHERWISE PROVIDED FOR
    • B60R1/00—Optical viewing arrangements; Real-time viewing arrangements for drivers or passengers using optical image capturing systems, e.g. cameras or video systems specially adapted for use in or on vehicles
    • B60R1/02—Rear-view mirror arrangements
    • B60R1/06—Rear-view mirror arrangements mounted on vehicle exterior
    • B60R1/0602—Rear-view mirror arrangements mounted on vehicle exterior comprising means for cleaning or deicing
    • C—CHEMISTRY; METALLURGY
    • C23—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
    • C23C—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
    • C23C24/00—Coating starting from inorganic powder
    • C23C24/02—Coating starting from inorganic powder by application of pressure only
    • C23C24/04—Impact or kinetic deposition of particles
    • C—CHEMISTRY; METALLURGY
    • C23—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
    • C23C—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
    • C23C4/00—Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge
    • C23C4/04—Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge characterised by the coating material
    • C—CHEMISTRY; METALLURGY
    • C23—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
    • C23C—COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
    • C23C4/00—Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge
    • C23C4/12—Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge characterised by the method of spraying
    • C23C4/131—Wire arc spraying

Landscapes

  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Mechanical Engineering (AREA)
  • Physics & Mathematics (AREA)
  • Plasma & Fusion (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Materials Engineering (AREA)
  • Metallurgy (AREA)
  • Organic Chemistry (AREA)
  • Multimedia (AREA)
  • Rear-View Mirror Devices That Are Mounted On The Exterior Of The Vehicle (AREA)

Abstract

Ein Spiegel, insbesondere ein Außenspiegel für ein Kraftfahrzeug, weist eine Trägerplatte (1) auf, die durch ein Spritzgießverfahren direkt mit der Rückseite (7) einer Zwischenschicht (3) hinterspritzt ist. Hierzu besteht die Zwischenschicht (3) aus einem hinterspritzfähigen Vliesmaterial. Auf die Vorderseite (8) der Zwischenschicht (3) ist eine Heizeinrichtung in Form einer Leiterbahn (2) aus einem Widerstandswerkstoff durch ein thermisches Spritzverfahren nach DIN EN 657 aufgebracht.A mirror, in particular an outside mirror for a motor vehicle, has a carrier plate (1), which is injection-injected directly behind the rear side (7) of an intermediate layer (3) by an injection molding process. For this purpose, the intermediate layer (3) consists of a back-sprayable nonwoven material. On the front side (8) of the intermediate layer (3), a heating device in the form of a conductor track (2) made of a resistance material is applied by a thermal spraying method according to DIN EN 657.

Description

Die Erfindung betrifft eine Heizeinrichtung für ein Spiegelglas eines Spiegels, insbesondere eines Außenspiegels für ein Kraftfahrzeug, nach dem Oberbegriff des Anspruchs 1 sowie ein Verfahren zur Herstellung einer Trägerplatte für ein Spiegelglas.The The invention relates to a heating device for a mirror glass of a mirror, in particular an exterior mirror for a Motor vehicle, according to the preamble of claim 1 and a method for producing a carrier plate for a Mirror glass.

Aus der EP 0 732 865 B1 ist eine Heizeinrichtung bekannt, die von Karbonfasern gebildet wird, die stromleitend über ein Bindemittel miteinander verbunden sind. Über eine Haftschicht ist ein Spiegelglas auf eine Trägerplatte für das Spiegelglas aufgebracht.From the EP 0 732 865 B1 For example, a heating device is known that is formed by carbon fibers that are conductively connected to one another via a binder. An adhesive layer is used to apply a mirror glass to a support plate for the mirror glass.

Ferner ist es bekannt, rückseitig auf das Spiegelglas eines Spiegels direkt durch ein Siebdruckverfahren oder dergleichen eine Heizung aufzubringen. Wie aus der FR 2 628 041 A1 hervorgeht, ist die Reflexionsschicht jedoch dann außenseitig auf dem Spiegelglas angebracht, mit erhöhter Gefahr von Beschädigungen der Reflexionsschicht. Außerdem soll bei dem bekannten Verfahren die leitfähige Paste bei einer Temperatur von etwa 670° eingebrannt werden, woraus Probleme bei der Einhaltung der Biegegenauigkeit bei sphärischen und asphärischen Spiegelgläsern resultieren können.Further, it is known to apply a heater directly to the mirror glass of a mirror directly by a screen printing method or the like. Like from the FR 2 628 041 A1 shows, however, the reflective layer is then mounted on the outside of the mirror glass, with increased risk of damage to the reflective layer. In addition, the conductive paste is to be baked at a temperature of about 670 ° in the known method, resulting in problems in compliance with the bending accuracy can result in spherical and aspherical mirror glasses.

Daneben ist es beispielsweise aus der DE 10 2004 002 979 A1 bekannt, die rückseitige Reflexionsschicht an einem Spiegelglas direkt als Heizschicht auszubilden.In addition, it is for example from the DE 10 2004 002 979 A1 known to form the back reflection layer on a mirror glass directly as a heating layer.

Dabei ist es jedoch problematisch, den Stromfluss in der dünnen Reflexionsschicht gleichmäßig zu verteilen sowie die Kontaktierung vorzunehmen.there However, it is problematic, the current flow in the thin reflection layer evenly distributed as well as make the contact.

Die DE 42 23 590 A1 zeigt einen Spiegel, bei dem auf der Vorderseite des Spiegelglases eine durchsichtige Heizungseinrichtung als ITO-Schicht angebracht ist, die von einer Schutzschicht abgedeckt wird, die beispielsweise durch Sputtern oder im Plasmaauftrag angebracht wird. Bei dieser Anordnung bestehen die bekannten Probleme in der Kontaktierung dünner Schichten. Außerdem ist die ITO-Schicht sehr empfindlich gegen Beschädigungen, die zu lokalen Überhitzungen (hot spots) führen können.The DE 42 23 590 A1 shows a mirror in which on the front of the mirror glass, a transparent heating device is attached as an ITO layer, which is covered by a protective layer, which is attached for example by sputtering or plasma deposition. In this arrangement, the known problems in the contacting of thin layers. In addition, the ITO layer is very sensitive to damage, which can lead to local overheating (hot spots).

Ferner beschreibt die FR 2 618 396 A1 eine Trägerfolie für ein Spiegelglas, mit einer durch Siebdruck aufgebrachten Heizeinrichtung. An der dem Spiegelglas zugewandten Vorderseite der Heizeinrichtung wird über ein Doppelklebeband eine sichere Verbindung zwischen Spiegelglas und Trägerfolie hergestellt. Außerdem wird hierdurch die Heizeinrichtung abgedichtet.Furthermore, the describes FR 2 618 396 A1 a carrier film for a mirror glass, with a screen-applied by heating means. On the front side of the heating device facing the mirror glass, a secure connection between the mirror glass and the carrier film is established via a double-sided adhesive tape. In addition, this will seal the heater.

Weiter ist es allgemein bekannt, eine Widerstandsheizung für ein Spiegelglas in Form einer kaschierten Kupferfolie im Fotoätzverfahren herzustellen und die Kupferfolie anschließend mit einem Doppelklebeband auf der Trägerplatte zu befestigen.Further It is well known, a resistance heater for a mirror glass in the form of a laminated copper foil in the photoetching produce and then the copper foil with a double-sided adhesive tape to fix the carrier plate.

Aufgabe der Erfindung ist es, eine Heizeinrichtung für ein Spiegelglas eines Spiegels, insbesondere eines Außenspiegels eines Kraftfahrzeuges, bereitzustellen, die kostengünstig herstellbar und in einfacher Weise mit der Trägerplatte des Spiegelglases verbindbar ist.task the invention is a heating device for a mirror glass of a mirror, in particular an exterior mirror a motor vehicle to provide, which can be produced inexpensively and in a simple manner with the support plate of the mirror glass is connectable.

Diese Aufgabe wird durch eine Heizeinrichtung mit den Merkmalen des Anspruchs 1 gelöst. Anspruch 8 beschreibt einen Spiegel mit einer erfindungsgemäßen Trägerplatte. Anspruch 9 betrifft ein Verfahren zur Herstellung einer Trägerplatte für ein Spiegelglas.These The object is achieved by a heating device having the features of the claim 1 solved. Claim 8 describes a mirror with a carrier plate according to the invention. Claim 9 relates to a method for producing a carrier plate for a Mirror glass.

Kerngedanke der Erfindung nach Anspruch 1 bzw. 9 ist es, eine Zwischenschicht aus einem hinterspritzfähigen Vliesmaterial vorzusehen, auf deren Vorderseite durch ein thermisches Spritzverfahren nach DIN EN 657 eine Heizeinrichtung aufgebracht ist. Die Zwischenschicht kann ihrerseits in einfacher und kostengünstiger Weise direkt mit der Trägerplatte verbunden werden, indem das Kunststoffmaterial der Trägerplatte auf die Rückseite der Zwischenschicht aufgespritzt wird. Somit erfolgt die Verbindung der Zwischenschicht mit der Trägerplatte nicht in einem eigenen Arbeitsgang, sondern unmittelbar bei der Herstellung der Trägerplatte selbst.core idea The invention according to claim 1 or 9 is an intermediate layer from a back sprayable Nonwoven material provided on the front by a thermal Spray method according to DIN EN 657 applied a heater is. The interlayer, in turn, can be simpler and less expensive Way directly with the carrier plate be joined by the plastic material of the carrier plate on the back the intermediate layer is sprayed on. Thus, the connection is made the intermediate layer with the carrier plate not in a separate operation, but directly at the Production of the carrier plate itself.

Unter den Begriff "thermisches Spritzverfahren" fallen gemäß DIN EN 657 alle Verfahren, bei denen Spritzzusätze innerhalb oder außerhalb einer Spritzpistole zugeführt und bis zum plastischen oder geschmolzenen Zustand aufgeheizt und dann auf die vorbereitete Oberfläche geschleudert werden, wobei die Oberfläche nicht aufgeschmolzen wird. Die Partikel, die mittels Druckluft, Heizgas, Kaltgas, Lichtbogen, Plasma etc. mit hoher kinetischer Energie auf die zu beschichtende Oberfläche geschleudert werden, verklammern sich bei ihrem Auftreffen mechanisch in der Oberfläche. Die nachfolgend weiter auf die Oberfläche zugeführten Partikel verkrallen sich wiederum in der zuvor aufgebrachten Partikelschicht. So entsteht eine Schicht aus Widerstandswerkstoff, die in inniger Verbindung mit der Zwischenschicht steht.According to DIN EN 657, the term "thermal spraying process" covers all processes in which spray additives are supplied inside or outside a spray gun and heated to the plastic or molten state and then thrown onto the prepared surface, wherein the surface is not melted. The particles, which are thrown onto the surface to be coated by means of compressed air, heating gas, cold gas, arc, plasma, etc., with high kinetic energy, cling mechanically to the surface as they impact. The particles further supplied to the surface below again dig into the previously applied particle layer. The result is a layer of resistance material, which is in intimate connection with the intermediate layer.

Der Widerstandswerkstoff wird hierbei in Draht-, Pulver- oder Granulatform in einem speziell konstruierten "Brenner" (in Art einer Spritzpistole) zugeführt, wobei der Werkstoff geschmolzen und anschließend die schmelzflüssigen Partikel durch einen der in der Tabelle 1 der DIN EN 657 genannten Energieträger mit hoher kinetischer Energie auf die zu beschichtende Oberfläche geschleudert werden.Of the Resistance material is here in wire, powder or granular form in a specially designed "burner" (in the manner of a spray gun) supplied the material being melted and then the molten particles by one of the energy carriers listed in Table 1 of DIN EN 657 high kinetic energy is thrown onto the surface to be coated become.

Im Unterschied zu der bekannten, Herstellung einer Widerstandsheizung aus einer kaschierten Kupferfolie im Photoätzverfahren, die anschließend mit einem Doppelklebeband auf der Trägerplatte befestigt wird, entfällt bei einer Zwischenschicht gemäß der Erfindung der Arbeitsgang des Verklebens der "Heizfolie" mit der Trägerschicht. Vielmehr wird die Zwischenschicht mit der zuvor auf ihrer Vorderseite aufgebrachten Heizeinrichtung an ihrer Rückseite direkt mit dem Kunststoffmaterial der Trägerplatte hinterspritzt. Damit reduziert sich der Montageaufwand. Auch wird eine Erhöhung der Funktionssicherheit der Heizeinrichtung erreicht. Im Unterschied zu dem bekannten Aufkleben der "Heizfolie" auf die Trägerplatte kann die Herstellung automatisiert werden.in the Difference to the known, producing a resistance heater from a laminated copper foil in the photo-etching, which then with a double-sided tape on the backing plate is attached, deleted in an intermediate layer according to the invention the operation of bonding the "heating foil" with the carrier layer. Rather, the Interlayer with the previously applied on its front Heating device on its back back-injected directly with the plastic material of the carrier plate. In order to reduces assembly costs. Also, an increase in the Functional reliability of the heater achieved. In contrast to the known sticking the "heating foil" on the support plate Manufacturing can be automated.

Als Vliesmaterial für die Zwischenschicht eignen sich alle Materialien, die mit einem Kunststoffmaterial hinterspritzbar sind, also mit dem Kunststoffmaterial in der Spritzgießform eine innige Verbindung eingehen. In besonderer Weise ist hierfür ein Mineralfaservlies, insbesondere ein Glasfaservlies, geeignet.When Nonwoven material for the intermediate layer are all materials that with a Plastic material are hinterspritzbar, so with the plastic material in the injection mold make an intimate connection. In a special way, this is a mineral fiber fleece, in particular a glass fiber fleece, suitable.

Grundsätzlich eignen sich zur Herstellung erfindungsgemäßer Heizeinrichtungen alle in der Gliederung der thermischen Spritzverfahren der DIN EN 657 in Anhang A angeführten Verfahren. Als besonders geeignetes Herstellverfahren wird jedoch das Lichtbogenspritzverfahren vorgeschlagen. Mit dem Lichtbogenspritzverfahren wird eine solide Verbindung des Widerstandswerkstoffes mit dem Vliesmaterial erreicht, bei gleichzeitig vergleichsweise niedrigen Kosten für das Auftragen des Widerstandswerkstoffes. Die beim Lichtbogenspritzverfahren entstehende Energie, mit der die Partikel auf die Zwischenschicht aufgebracht werden, ist für die Verbindung des Widerstandswerkstoffes mit der Zwischenschicht vollkommen ausreichend. Somit kann auf die Anwendung teuerer Verfahren, wie beispielsweise des Hochgeschwindigkeitsdrahtflammspritzens, das mit höheren kinetischen Energien arbeitet, verzichtet werden.Basically suitable all for the production of heating devices according to the invention in the outline of the thermal spraying method of DIN EN 657 listed in Annex A. Method. However, a particularly suitable production method is the arc spraying proposed. With the arc spraying process becomes a solid connection of the resistance material with the nonwoven material achieved, at the same time comparatively low cost for the application of the resistance material. The resulting from the arc spraying process Energy with which the particles are applied to the intermediate layer be, is for the connection of the resistance material with the intermediate layer perfectly adequate. Thus, the application of expensive procedures, such as high speed wire flame spraying, with higher kinetic energies works, be waived.

Beim Lichtbogenspritzverfahren wird ein Lichtbogen zwischen zwei drahtförmigen Spritzzusätzen gleicher oder unterschiedlicher Zusammensetzung benutzt, um die Drahtspitze abzuschmelzen. Mit einem oder mehreren Gasstrahlen, meist Druckluft, wird das geschmolzene Material zerstäubt und auf die vorbereitete Oberfläche der Zwischenschicht geschleudert.At the Arc spraying is an arc between two wire-shaped spray additives same or different composition used to the wire tip melt down. With one or more gas jets, mostly compressed air, the molten material is atomized and placed on the prepared surface of the Interlayer spun.

Zur Verbesserung der Eigenschaften der aufgetragenen Widerstandsbahn kann das Schutzgaslichtbogenspritzverfahren angewandt werden. Bei diesem Verfahren wird eine geringere Porosität und eine verminderte Oxidation in der Schicht des aufgetragenen Widerstandswerkstoffes erreicht. Durch einen Zweitgasstrom in einem Schutzkörper oder durch einen Schutzgasmantel um den Lichtbogen und den Spritzstrahl herum wird ein Eindringen von Luft in den heißen Gas- und Partikelstrom verhindert. Zur Erhöhung der Dichte des Widerstandswerkstoffes kann zusätzlich die Geschwindigkeit des Spritzstrahls erhöht werden. Hierdurch wird die Kontaktzeit der Partikel des Widerstandswerkstoffes mit dem Zerstäuber- und Schutzgas reduziert.to Improvement of the properties of the applied resistance path For example, the inert gas arc spraying method can be used. at This method has a lower porosity and a reduced oxidation reached in the layer of the applied resistance material. By a second gas flow in a protective body or by a protective gas jacket around the arc and the spray jet will penetrate of air in the hot Gas and particle flow prevented. To increase the density of the resistance material can additionally the speed of the spray jet can be increased. This will change the contact time the particle of the resistance material with the atomizer and Shielding gas reduced.

Als Widerstandswerkstoff können Eisenmetalle, Nichteisenmetalle, leitfähige Kunststoffe, Cermets (gesinterte Keramikmetalle) etc. verarbeitet werden. Auch spezielle Legierungen mit entsprechend ausgewähltem spezifischem ohmschem Widerstand können verarbeitet werden.When Resistance material can Ferrous metals, non-ferrous metals, conductive plastics, cermets (sintered Ceramic metals) etc. are processed. Also special alloys with appropriately selected specific ohmic resistance can be processed.

Der Auftrag des Widerstandwerkstoffs kann kontinuierlich entlang des gewünschten Verlaufs der Leiterbahn erfolgen. In einer bevorzugten Ausführung der Erfindung wird zur Beschleunigung des Materialauftrags eine Maske verwendet, die diejenigen Bereiche der Zwischenschicht abdeckt, auf die kein Widerstandswerkstoff aufgetragen werden soll, so dass der Auftrag des Widerstandswerkstoffs flächig erfolgen kann. Die Freiräume der Maske entsprechen hierbei dem Verlauf der Leiterbahn. Die Maske wird bevorzugt mit einem Antihaftmittel beschichtet. Das hiermit erreichte saubere Ablösen der Maske von der Zwischenschicht gewährleistet scharfrandige Begrenzungen der Leiterbahn. Außerdem kann die Maske leicht gereinigt und somit mehrfach verwendet werden.Of the Order of the resistance material can be continuously along the desired Course of the track done. In a preferred embodiment of Invention is to accelerate the application of material a mask used, which covers those areas of the intermediate layer, on which no resistance material is to be applied, so that the order of the resistance material can be made flat. The open spaces of Mask correspond to the course of the conductor track. The mask is preferably coated with an antiblocking agent. This hereby achieved clean detachment The mask of the interlayer ensures sharply defined boundaries the conductor track. Furthermore The mask can be easily cleaned and thus used several times.

Neben dem erfindungsgemäßen Aufbringen des Widerstandswerkstoffes der Leiterbahn auf die Zwischenschicht kann auch die Peripherie der Heizeinrichtung durch ein thermisches Spritzverfahren nach DIN EN 657 auf die Zwischenschicht aufgespritzt werden. Hierbei kann es sich beispielsweise um die Stromzuführung für die Leiterbahn handeln, die von einem hoch leitenden Werkstoff gebildet wird. In analoger Weise können auch isolierende Werkstoffe mit einem thermischen Spritzverfahren nach DIN EN 657 auf die Zwischenschicht aufgebracht werden.In addition to the inventive application of the resistance material of the conductor track on the intermediate layer and the periphery of the heater can be sprayed by a thermal spray process according to DIN EN 657 to the intermediate layer. This may be, for example, the Stromzufüh act for the track, which is formed by a highly conductive material. In an analogous manner, insulating materials can also be applied to the intermediate layer by means of a thermal spraying process according to DIN EN 657.

Wie aus Anspruch 8 hervorgeht, erfolgt die elektrische Isolierung der Heizeinrichtung gegenüber der Reflexionsschicht des Spiegelglases durch einen Kleber oder einen Isolierlack. Dem Kleber bzw. Isolierlack kommt hierbei eine doppelte Funktion zu, nämlich einerseits die elektrische Isolierung und andererseits die Verbindung des Spiegelglases mit der Zwischenschicht und damit mit der Trägerplatte. Über den Kleber bzw. den Isolierlack wird die gegenüber mechanischen Beanspruchun gen und Umwelteinflüssen empfindliche Reflexionsschicht des Spiegelglases geschützt.As From claim 8, the electrical insulation of the Heating device opposite the reflection layer of the mirror glass by an adhesive or an insulating varnish. The adhesive or insulating comes here a double function to, namely on the one hand the electrical insulation and on the other hand the connection the mirror glass with the intermediate layer and thus with the support plate. On the Glue or the insulating varnish is the conditions against mechanical conditions and environmental influences sensitive reflection layer of the mirror glass protected.

Gemäß Anspruch 9 wird die Trägerplatte durch ein Spritzgießverfahren hergestellt, mit einem thermoplastischen oder duroplastischen Kunststoff. Hierbei wird die auf ihrer Vorderseite bereits mit der Leiterbahn versehene Zwischenschicht so in ein Spritzgießwerkzeug eingelegt, dass die Rückseite der Zwischenschicht direkt mit dem Kunststoffmaterial hinterspritzt werden kann.According to claim 9 becomes the carrier plate by an injection molding process manufactured, with a thermoplastic or thermosetting plastic. Here, the already provided on its front side with the conductor track Interlayer so inserted in an injection mold that the back the intermediate layer directly behind the plastic material injected can be.

Die Verbindung zwischen den Endabschnitten der Leiterbahn und elektrischen Kontakten zum Anschluss der Versorgungsspannung für die Heizeinrichtung erfolgt bevorzugt durch ein Lötverfahren, vor dem Einlegen der Zwischenschicht in das Spritzgießwerkzeug.The Connection between the end sections of the track and electrical Contacts for connecting the supply voltage for the heating device is preferably done by a soldering process, before inserting the intermediate layer in the injection mold.

Der Begriff "Spiegelglas" wird in Zusammenhang mit der vorliegenden Erfindung nicht nur für mineralisches Glas verwendet, sondern auch für alle denkbaren anderen durchsichtigen Substrate, beispielsweise aus thermoplastischen oder duroplastischen Werkstoffen.Of the Term "mirror glass" is related used with the present invention not only for mineral glass, for .... As well all conceivable other transparent substrates, for example thermoplastic or thermosetting materials.

Alle Angaben zur DIN EN 657 beziehen sich auf die Ausgabe Juni 2005.All Information on DIN EN 657 relates to the issue of June 2005.

Vorteilhafte Ausgestaltungen der Erfindung sind Gegenstand der Unteransprüche.advantageous Embodiments of the invention are the subject of the dependent claims.

Ein mögliches Ausführungsbeispiel der Erfindung ist in der Zeichnung dargestellt und wird nachfolgend näher erläutert. Es zeigt:One potential embodiment The invention is illustrated in the drawing and will be described below explained in more detail. It shows:

1 eine erfindungsgemäße Trägerplatte mit einer eine Heizeinrichtung tragenden Zwischenschicht in der Draufsicht, 1 a carrier plate according to the invention with a heater carrying intermediate layer in plan view,

2 eine Schnittdarstellung entlang der Schnittverlaufslinie A-A aus 1 und 2 a sectional view along the section line AA from 1 and

3 eine grafische Übersicht der thermischen Spritzverfahren nach DIN EN 657. 3 a graphic overview of the thermal spraying process according to DIN EN 657.

Eine Trägerplatte 1 für einen nicht näher dargestellten Spiegel, insbesondere einen Außenspiegel für ein Kraftfahrzeug, weist an der einem nicht dargestellten Spiegelglas zugewandten Vorderseite eine Zwischenschicht 3 auf. Die Zwischenschicht 3 ist Teil einer Heizeinrichtung und ist an ihrer Vorderseite 8 mit einer mäanderförmigen Leiterbahn 2 versehen. Die Enden 6 der Leiterbahn 2 sind an einer Seite der Zwischenschicht 3 herausgeführt und mit abgewinkelten Kontakten 4 verlötet.A carrier plate 1 for a mirror, not shown in detail, in particular an exterior mirror for a motor vehicle, has an intermediate layer on the side facing a mirror glass, not shown front 3 on. The intermediate layer 3 is part of a heater and is on its front 8th with a meandering track 2 Mistake. The ends 6 the conductor track 2 are on one side of the interlayer 3 led out and with angled contacts 4 soldered.

Die Trägerplatte 1 besteht aus einem Kunststoffmaterial und ist im Spritzgießverfahren hergestellt. Stege 5 an der Rückseite der Trägerplatte 1 erhöhen die mechanische Steifigkeit der Trägerplatte 1. Als Material für die Trägerplatte 1 eignen sich alle Arten von Kunststoffen, die im Spritzgießverfahren verarbeitet werden können.The carrier plate 1 consists of a plastic material and is manufactured by injection molding. Stege 5 at the back of the carrier plate 1 increase the mechanical rigidity of the carrier plate 1 , As material for the carrier plate 1 All types of plastics that can be processed by injection molding are suitable.

Die Zwischenschicht 3 besteht aus einem hinterspritzfähigen Vliesmaterial, bevorzugt einem Glasfaservlies, das in die Spritzgießform so eingelegt wird, dass die Rückseite 7 der Zwischenschicht 3 direkt mit dem Kunststoffmaterial der Trägerplatte 1 hinterspritzt wird.The intermediate layer 3 consists of a hinterspritzfähige nonwoven material, preferably a glass fiber fleece, which is inserted into the injection mold so that the back 7 the intermediate layer 3 directly with the plastic material of the carrier plate 1 is injected behind.

Zur Verdeutlichung des Aufbaus von Trägerplatte 1 und Zwischenschicht 3 ist in der Schnittdarstellung der 2 die Zwischenschicht 3 mit Abstand zur Trägerplatte 1 dargestellt. Tatsächlich wird das Material der Trägerplatte 1 jedoch unmittelbar auf die Rückseite 7 der Zwischenschicht 3 aufgespritzt, so dass Trägerplatte 1 und Zwischenschicht 3 stoffschlüssig miteinander verbunden sind.To clarify the structure of carrier plate 1 and intermediate layer 3 is in the sectional view of 2 the intermediate layer 3 at a distance from the carrier plate 1 shown. In fact, the material of the carrier plate 1 however, directly on the back 7 the intermediate layer 3 sprayed on, leaving carrier plate 1 and intermediate layer 3 are cohesively connected to each other.

Die Leiterbahn 2 ist mäanderförmig in einer Vielzahl von Schleifen an der Vorderseite 8 der Zwischenschicht 3 aufgespritzt. Bei der Auswahl des Widerstandswerkstoffs spielt unter anderem die zur Verfügung stehende Fläche der Trägerplatte 1 eine Rolle. Die nachfolgende Tabelle gibt eine Auswahl möglicher Widerstandswerkstoffe, deren spezifischen elektrischen Widerstand sowie die erforderliche Gesamtlänge der Leiterbahn 2 an. Ausgegangen wird hierbei beispielsweise von einer Querschnittsfläche der Leiterbahn 2 von 0,2 mm2 und einem gewünschten Widerstand von 6 Ohm, um bei einer Bordnetzspannung von 12 Volt einen Heizstrom von 2 Ampere und damit eine elektrische Leistung von 24 Watt zu erreichen. Legierungs-Bezeichnung Kurzform nach DIN Werkstoffnummer nach DIN Spez. elektr. Widerstand [Ω·mm2·m–1] Länge der Leiterbahn [m] ISAOHM® NiCr20AlSi 2.4872 1.32 0,91 ISA-CHROM®60 NiCr6015 2.4867 1.11 1,08 ISA-CHROM®80 NiCr8020 2.4869 1.08 1,11 ISA-CHROM®30 NiCr3020 1.4860 1.04 1,15 ISOTAN® CuNi44 2.0842 0.49 2,45 ISA-NICKEL® NiCu30Fe 2.4360 0.45 2,67 MANGANIN® CuMn12Ni 2.1362 0.43 2,79 NICKELIN-W CuNi30Mn 2.0890 0.40 3,00 RESISTHERM® NiFe30 0.33 3,64 ISAZIN® CuNi23Mn 2.0881 0.30 4,00 ZERANIN®30 CuMn7Sn 0.29 4,14 The conductor track 2 is meandering in a variety of loops at the front 8th the intermediate layer 3 sprayed. When choosing the resistance material, among other things, the available ste hende surface of the support plate 1 a role. The following table gives a selection of possible resistance materials, their specific electrical resistance and the required total length of the conductor track 2 at. For example, the starting point is a cross-sectional area of the conductor track 2 of 0.2 mm 2 and a desired resistance of 6 ohms to achieve a heating current of 2 amperes and thus an electrical power of 24 watts at a vehicle electrical system voltage of 12 volts. Alloy designation Short form according to DIN Material number according to DIN Special electr. Resistance [Ω · mm 2 · m -1 ] Length of track [m] Isaohm ® NiCr20AlSi 2.4872 1:32 0.91 ISA-CHROM ® 60 NiCr6015 2.4867 1.11 1.08 ISA-CHROM ® 80 NiCr8020 2.4869 1:08 1.11 ISA CHROME ® 30 NiCr3020 1.4860 1:04 1.15 ISOTAN ® CuNi44 2.0842 12:49 2.45 ISA-NICKEL ® NiCu30Fe 2.4360 12:45 2.67 MANGANIN ® CuMn12Ni 2.1362 12:43 2.79 Nickeline-W CuNi30Mn 2.0890 12:40 3.00 RESISTHERM ® NiFe30 12:33 3.64 ISAZIN ® CuNi23Mn 2.0881 12:30 4.00 ZERANIN ® 30 CuMn7Sn 12:29 4.14

Die Heizeinrichtung (Leiterbahn 2) und ihre Heizleistung sind so zu bemessen, dass ein schnelles und gleichmäßiges Abtauen des Spiegels von Beschlag und/oder Eis erreicht wird.The heating device (trace 2 ) and their heating power are to be designed so that a quick and uniform defrosting of the level of fog and / or ice is achieved.

Abweichend vom dargestellten Ausführungsbeispiel können auch zwei oder mehrere getrennte Heizkreise mit elektrisch voneinander getrennten Leiterbahnen 2 und Kontakten 4 vorgesehen sein.Deviating from the illustrated embodiment, two or more separate heating circuits with electrically separate interconnects 2 and contacts 4 be provided.

3 zeigt eine Übersicht der thermischen Spritzverfahren nach DIN EN 657 gemäß Anhang A der DIN EN 657, eingeteilt nach den verwendeten Energieträgern. Grundsätzlich eignen sich alle in der Übersicht angeführten thermischen Spritzverfahren zum Auftragen des Widerstandswerkstoffs auf die Zwischenschicht 3. Wie praktische Versuche ergeben haben, liefert das Lichtbogenspritzen eine ausreichend solide Verbindung zwischen Leiterbahn 2 und Zwischenschicht 3, bei gleichzeitig geringer Porosität des Widerstandswerkstoffes. Damit steht mit dem Lichtbogenspritzen ein sehr wirtschaftliches Verfahren zum Auftrag des Widerstandswerkstoffes auf die Zwischenschicht 3 zur Verfügung. 3 shows an overview of the thermal spraying method according to DIN EN 657 according to Annex A of DIN EN 657, divided according to the energy sources used. In principle, all of the thermal spraying methods cited in the overview are suitable for applying the resistance material to the intermediate layer 3 , As practical tests have shown, the arc spraying provides a sufficiently solid connection between conductor track 2 and intermediate layer 3 , at the same time low porosity of the resistance material. Thus, with the arc spraying is a very economical process for applying the resistance material to the intermediate layer 3 to disposal.

Claims (10)

Heizeinrichtung für ein Spiegelglas eines Spiegels, die zwischen dem Spiegelglas und einer Trägerplatte zur Aufnahme des Spiegelglases angeordnet ist, dadurch gekennzeichnet, dass die Heizeinrichtung eine Zwischenschicht (3) aus einem hinterspritzfähigen Vliesmaterial aufweist, auf die wenigstens eine Leiterbahn (2) aus einem Widerstandswerkstoff durch ein thermisches Spritzverfahren nach DIN EN 657 aufgebracht ist.Heating device for a mirror glass of a mirror, which is arranged between the mirror glass and a support plate for receiving the mirror glass, characterized in that the heating device is an intermediate layer ( 3 ) of a hinterspritzfähige nonwoven material, on the at least one conductor track ( 2 ) is applied from a resistance material by a thermal spraying method according to DIN EN 657. Heizeinrichtung nach Anspruch 1, dadurch gekennzeichnet, dass die Zwischenschicht (3) von einem Mineralfaservlies, vorzugsweise von einem Glasfaservlies, gebildet wird.Heating device according to claim 1, characterized in that the intermediate layer ( 3 ) is formed by a mineral fiber fleece, preferably a glass fiber fleece. Heizeinrichtung nach Anspruch 1 oder 2, dadurch gekennzeichnet, dass das thermische Spritzverfahren ein Lichtbogenspritzverfahren ist.Heating device according to claim 1 or 2, characterized that the thermal spraying process is an arc spraying process is. Heizeinrichtung nach einem der vorgenannten Ansprüche, dadurch gekennzeichnet, dass der Widerstandswerkstoff von einem Eisenmetall, einem Nichteisenmetall, einem leitfähigen Kunststoff oder einem Keramikmetall gebildet wird.Heating device according to one of the preceding claims, characterized characterized in that the resistance material is made of a ferrous metal, a non-ferrous metal, a conductive plastic or a Ceramic metal is formed. Heizeinrichtung nach einem der vorgenannten Ansprüche, dadurch gekennzeichnet, dass die Zwischenschicht (3) vor dem Auftrag des Widerstandswerkstoffs mit einer Maske abgedeckt ist, durch die die Bereiche, in denen kein Widerstandswerkstoff aufgetragen werden soll, abgedeckt sind.Heating device according to one of the preceding claims, characterized in that the intermediate layer ( 3 ) is covered with a mask before application of the resistor material, through which the areas in which no resistance material is to be applied, are covered. Heizeinrichtung nach einem der vorgenannten Ansprüche, dadurch gekennzeichnet, dass die Leiterbahn (2) mäanderförmig verläuft.Heating device according to one of the preceding claims, characterized in that the conductor track ( 2 ) meanders. Heizeinrichtung nach einem der vorangegangenen Ansprüche, dadurch gekennzeichnet, dass die Trägerplatte (1) aus einem Kunststoffmaterial besteht und im Spritzgießverfahren hergestellt ist.Heating device according to one of the preceding claims, characterized in that the carrier plate ( 1 ) consists of a plastic material and is produced by injection molding. Spiegel mit einer Heizeinrichtung nach einem der vorgenannten Ansprüche, mit einem Spiegelglas mit einer rückseitigen Reflexionsschicht, dadurch gekennzeichnet, dass das Spiegelglas durch ein Klebeverfahren oder einen Isolierlack auf die Zwischenschicht (3) aufgebracht ist.Mirror with a heating device according to one of the preceding claims, with a mirror glass with a rear reflection layer, characterized in that the mirror glass by an adhesive method or an insulating varnish on the intermediate layer ( 3 ) is applied. Verfahren zur Herstellung einer Trägerplatte für ein Spiegelglas, mit einer Heizeinrichtung für das Spiegelglas, gekennzeichnet durch die folgenden Schritte: – Aufbringen wenigstens einer Leiterbahn (2) aus einem Widerstandswerkstoff durch ein thermisches Spritzverfahren nach DIN EN 657 auf die Vorderseite (8) einer Zwischenschicht (3) aus einem hinterspritzfähigen Vliesmaterial, – Einlegen der Zwischenschicht (3) in ein Spritzgießwerkzeug und – Hinterspritzen der Rückseite (7) der Zwischenschicht (3) mit einem Kunststoffmaterial, das die Trägerplatte (1) bildet.Method for producing a carrier plate for a mirror glass, comprising a heating device for the mirror glass, characterized by the following steps: - applying at least one conductor track ( 2 ) of a resistance material by a thermal spraying process according to DIN EN 657 on the front ( 8th ) an intermediate layer ( 3 ) from a back-sprayable nonwoven material, - inserting the intermediate layer ( 3 ) in an injection mold and - back injection of the back ( 7 ) of the intermediate layer ( 3 ) with a plastic material, the support plate ( 1 ). Verfahren nach Anspruch 9, dadurch gekennzeichnet, dass nach dem Aufbringen der Leiterbahn (2) und vor dem Einlegen der Zwischenschicht (3) in das Spritzgießwerkzeug die Endabschnitte (6) der Leiterbahn (2) durch ein Lötverfahren elektrisch leitend mit Kontakten (4) verbunden werden, die zur Stromversorgung der Leiterbahn (2) dienen.A method according to claim 9, characterized in that after the application of the conductor track ( 2 ) and before inserting the intermediate layer ( 3 ) in the injection mold the end sections ( 6 ) the conductor track ( 2 ) by a soldering electrically conductive with contacts ( 4 ) connected to the power supply of the track ( 2 ) serve.
DE102006032678A 2006-07-13 2006-07-13 Heating device for a mirror glass Withdrawn DE102006032678A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
DE102006032678A DE102006032678A1 (en) 2006-07-13 2006-07-13 Heating device for a mirror glass
PCT/EP2007/005855 WO2008006483A1 (en) 2006-07-13 2007-07-03 Heating device for a mirror glass

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
DE102006032678A DE102006032678A1 (en) 2006-07-13 2006-07-13 Heating device for a mirror glass

Publications (1)

Publication Number Publication Date
DE102006032678A1 true DE102006032678A1 (en) 2008-01-17

Family

ID=38477258

Family Applications (1)

Application Number Title Priority Date Filing Date
DE102006032678A Withdrawn DE102006032678A1 (en) 2006-07-13 2006-07-13 Heating device for a mirror glass

Country Status (2)

Country Link
DE (1) DE102006032678A1 (en)
WO (1) WO2008006483A1 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102012212798A1 (en) 2011-12-22 2013-06-27 Robert Bosch Gmbh Heating element and method for its production and use of the heating element
DE102012108592C5 (en) * 2012-09-14 2019-02-14 SMR Patents S.à.r.l. Rear view mirror unit
EP3950259A1 (en) * 2020-08-07 2022-02-09 K.L. Kaschier- und Laminier GmbH Method for producing a lens hood

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102008036152B3 (en) * 2008-08-01 2010-04-15 Textilforschungsinstitut Thüringen-Vogtland e.V. Selective partial coating of sheet materials, e.g. to make conductive patterns on textiles, involves applying a mask of intumescent material, coating the entire surface by thermal spraying and then removing the mask
DE102009022238A1 (en) 2009-05-20 2010-11-25 Kraussmaffei Technologies Gmbh Process for the production of plastic molded parts with an integrated conductor track

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3197335A (en) * 1962-04-09 1965-07-27 Stanley W Leszynski Surface-mounted electrical resistance structure and method for producing same
US3425864A (en) * 1965-07-21 1969-02-04 Templeton Coal Co Method for making electric resistance heaters
DE4426188A1 (en) * 1994-07-23 1996-01-25 Mekra Rangau Plastics Outside mirrors for motor vehicles
DE19509153A1 (en) * 1995-03-14 1996-09-19 Bayerische Motoren Werke Ag Shaped body with heating device, in particular exterior rear view mirror of a motor vehicle
DE19848860A1 (en) * 1998-10-23 1999-12-09 Roland Stoeckl Vehicle external rear view mirror
DE10160451A1 (en) * 2001-12-05 2003-06-26 Schott Glas Method and device for producing an electrical conductor track on a substrate
DE10320379A1 (en) * 2003-05-06 2004-12-02 Leoni Ag A method for manufacturing heating elements in many different forms has conductive material flame sprayed on to a suitably shaped substrate material with an insulating layer

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3109228A (en) * 1959-08-10 1963-11-05 Thermway Ind Inc Manufacture of electric radiant heating panels
DE3042419A1 (en) * 1980-11-11 1982-08-05 Fritz Eichenauer GmbH & Co KG, 6744 Kandel Heating device for motor vehicle mirror - with PTC heating elements on rear of adhesive copper foil
DE9410175U1 (en) * 1993-06-25 1994-09-29 Macher, David, Voitsberg Heated mirror
EP1346607B1 (en) * 2000-11-29 2012-07-25 Thermoceramix, LLC Resistive heaters and uses thereof

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3197335A (en) * 1962-04-09 1965-07-27 Stanley W Leszynski Surface-mounted electrical resistance structure and method for producing same
US3425864A (en) * 1965-07-21 1969-02-04 Templeton Coal Co Method for making electric resistance heaters
DE4426188A1 (en) * 1994-07-23 1996-01-25 Mekra Rangau Plastics Outside mirrors for motor vehicles
DE19509153A1 (en) * 1995-03-14 1996-09-19 Bayerische Motoren Werke Ag Shaped body with heating device, in particular exterior rear view mirror of a motor vehicle
DE19848860A1 (en) * 1998-10-23 1999-12-09 Roland Stoeckl Vehicle external rear view mirror
DE10160451A1 (en) * 2001-12-05 2003-06-26 Schott Glas Method and device for producing an electrical conductor track on a substrate
DE10320379A1 (en) * 2003-05-06 2004-12-02 Leoni Ag A method for manufacturing heating elements in many different forms has conductive material flame sprayed on to a suitably shaped substrate material with an insulating layer

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102012212798A1 (en) 2011-12-22 2013-06-27 Robert Bosch Gmbh Heating element and method for its production and use of the heating element
WO2013092964A2 (en) 2011-12-22 2013-06-27 Robert Bosch Gmbh Heating element, and method for producing said heating element, and use of the heating element
WO2013092964A3 (en) * 2011-12-22 2013-12-05 Robert Bosch Gmbh Heating element, and method for producing said heating element, and use of the heating element
DE102012108592C5 (en) * 2012-09-14 2019-02-14 SMR Patents S.à.r.l. Rear view mirror unit
EP3950259A1 (en) * 2020-08-07 2022-02-09 K.L. Kaschier- und Laminier GmbH Method for producing a lens hood

Also Published As

Publication number Publication date
WO2008006483A1 (en) 2008-01-17

Similar Documents

Publication Publication Date Title
EP2393337B1 (en) Heating device
EP1051362B1 (en) Heatable mirror, method for producing a heat conductive layer, and the use thereof
DE102006032678A1 (en) Heating device for a mirror glass
DE3107943C2 (en)
DE102006030454A1 (en) Support plate for mirror glass, has heating device, where heating device is formed from conductive strip of resistive material and is applied by thermal spraying process
EP1973384B1 (en) Reflective sheet with a plastic substrate, a method for the production thereof as well as an outside mirror with such a reflective sheet
DE102006027085B3 (en) Procedure for connecting components from same/different materials, comprises bringing recess into the component, injecting finely-grained powdered weld filler into highly accelerated cold gas jet and filling the recess with the weld filler
DE102011107134B4 (en) Mirror glass for an automotive exterior rearview mirror assembly and method of making same
DE69733806T2 (en) METHOD FOR ATTACHING AN ELECTRIC CONTACT ON A CERAMIC LAYER AND A RESISTANCE ELEMENT CREATED THEREFOR
DE4426188A1 (en) Outside mirrors for motor vehicles
WO2016071534A1 (en) Method for producing a contact region for a layer of an electrical heating device and apparatus for an electrical heating device for a motor vehicle
DE102007037483A1 (en) Electronic component i.e. multiple switch, for e.g. vehicle, has circuit carrier with recess, and switching units arranged on outer surface of carrier, where carrier is made from plastic e.g. semi-crystalline, partially aromatic polyamide
DE1958496A1 (en) Hardened glass windows
DE20302566U1 (en) Soldering tip has heat conductive body with non-wettable layer and outer tinned layer with adhesive layer between
DE102017209297A1 (en) Method for producing an electrical conductor track on a plastic carrier and sensor module comprising a plastic carrier with a conductor track produced in this way
DE2745666A1 (en) GLARE-FREE REAR-VIEW MIRROR FOR VEHICLES, IN PARTICULAR MOTOR VEHICLES, AND THE PROCESS FOR ITS MANUFACTURING
WO2005060802A1 (en) Ceramic cooking pot, especially a fondue pot
EP2314130B1 (en) Electric heating element for technical purposes
EP2478753B1 (en) Method for producing a ceramic component, ceramic component
DE102016225246B4 (en) Method of manufacturing an electronic component and electronic component
DE2546443B2 (en) Composite microcircuit and process for its manufacture
DE102019214550B4 (en) Method of making an electrical heating element
DE102016219224A1 (en) Method and resistance soldering device for soldering a power connection element on a vehicle window
DE1271812B (en) Capless electrical resistance and process for its manufacture
AT398675B (en) Partial and selective electroplating of metal on printed circuit - by covering required area with conductive liquid or paste, which is peeled off or removed chemically after plating, esp. with noble metal

Legal Events

Date Code Title Description
OM8 Search report available as to paragraph 43 lit. 1 sentence 1 patent law
R119 Application deemed withdrawn, or ip right lapsed, due to non-payment of renewal fee

Effective date: 20130201