CN114561375A - Protease mutant BLAPR2 with improved heat stability and coding gene and application thereof - Google Patents
Protease mutant BLAPR2 with improved heat stability and coding gene and application thereof Download PDFInfo
- Publication number
- CN114561375A CN114561375A CN202210237403.2A CN202210237403A CN114561375A CN 114561375 A CN114561375 A CN 114561375A CN 202210237403 A CN202210237403 A CN 202210237403A CN 114561375 A CN114561375 A CN 114561375A
- Authority
- CN
- China
- Prior art keywords
- ala
- val
- gly
- ser
- lys
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108091005804 Peptidases Proteins 0.000 title claims abstract description 70
- 239000004365 Protease Substances 0.000 title claims abstract description 65
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 title claims abstract description 61
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 31
- 238000000034 method Methods 0.000 claims abstract description 7
- 238000012216 screening Methods 0.000 claims abstract description 7
- 238000000855 fermentation Methods 0.000 claims description 23
- 230000004151 fermentation Effects 0.000 claims description 23
- 241000194108 Bacillus licheniformis Species 0.000 claims description 22
- 235000019764 Soybean Meal Nutrition 0.000 claims description 13
- 239000004455 soybean meal Substances 0.000 claims description 13
- 241000894006 Bacteria Species 0.000 claims description 11
- 244000063299 Bacillus subtilis Species 0.000 claims description 9
- 235000014469 Bacillus subtilis Nutrition 0.000 claims description 9
- 239000013598 vector Substances 0.000 claims description 7
- 238000002360 preparation method Methods 0.000 claims description 6
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 claims description 4
- 239000004382 Amylase Substances 0.000 claims description 3
- 102000013142 Amylases Human genes 0.000 claims description 3
- 108010065511 Amylases Proteins 0.000 claims description 3
- 240000008042 Zea mays Species 0.000 claims description 3
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 claims description 3
- 235000002017 Zea mays subsp mays Nutrition 0.000 claims description 3
- 235000019418 amylase Nutrition 0.000 claims description 3
- 235000005822 corn Nutrition 0.000 claims description 3
- 239000003599 detergent Substances 0.000 claims description 3
- 235000013312 flour Nutrition 0.000 claims description 3
- 238000004519 manufacturing process Methods 0.000 claims description 3
- 239000002773 nucleotide Substances 0.000 claims description 3
- 125000003729 nucleotide group Chemical group 0.000 claims description 3
- 230000001131 transforming effect Effects 0.000 claims description 3
- 239000003674 animal food additive Substances 0.000 claims description 2
- 239000013604 expression vector Substances 0.000 claims description 2
- 239000002778 food additive Substances 0.000 claims description 2
- 235000013373 food additive Nutrition 0.000 claims description 2
- 239000003550 marker Substances 0.000 claims description 2
- 238000003259 recombinant expression Methods 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- 230000004907 flux Effects 0.000 abstract 1
- 102000004190 Enzymes Human genes 0.000 description 20
- 108090000790 Enzymes Proteins 0.000 description 20
- 230000000694 effects Effects 0.000 description 18
- UIGMAMGZOJVTDN-WHFBIAKZSA-N Ser-Gly-Ser Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O UIGMAMGZOJVTDN-WHFBIAKZSA-N 0.000 description 15
- 230000035772 mutation Effects 0.000 description 13
- CCQOOWAONKGYKQ-BYPYZUCNSA-N Gly-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)CN CCQOOWAONKGYKQ-BYPYZUCNSA-N 0.000 description 10
- KFQDSSNYWKZFOO-LSJOCFKGSA-N His-Val-Ala Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O KFQDSSNYWKZFOO-LSJOCFKGSA-N 0.000 description 10
- 108010050848 glycylleucine Proteins 0.000 description 10
- 108010047495 alanylglycine Proteins 0.000 description 9
- 239000000243 solution Substances 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 7
- 238000006243 chemical reaction Methods 0.000 description 7
- 239000007788 liquid Substances 0.000 description 7
- 150000001413 amino acids Chemical group 0.000 description 6
- 239000002609 medium Substances 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- ZIBWKCRKNFYTPT-ZKWXMUAHSA-N Ala-Asn-Val Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O ZIBWKCRKNFYTPT-ZKWXMUAHSA-N 0.000 description 5
- CZPAHAKGPDUIPJ-CIUDSAMLSA-N Ala-Gln-Pro Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(O)=O CZPAHAKGPDUIPJ-CIUDSAMLSA-N 0.000 description 5
- SFNFGFDRYJKZKN-XQXXSGGOSA-N Ala-Gln-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C)N)O SFNFGFDRYJKZKN-XQXXSGGOSA-N 0.000 description 5
- HXNNRBHASOSVPG-GUBZILKMSA-N Ala-Glu-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O HXNNRBHASOSVPG-GUBZILKMSA-N 0.000 description 5
- NHLAEBFGWPXFGI-WHFBIAKZSA-N Ala-Gly-Asn Chemical compound C[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)N)C(=O)O)N NHLAEBFGWPXFGI-WHFBIAKZSA-N 0.000 description 5
- BEMGNWZECGIJOI-WDSKDSINSA-N Ala-Gly-Glu Chemical compound [H]N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O BEMGNWZECGIJOI-WDSKDSINSA-N 0.000 description 5
- OBVSBEYOMDWLRJ-BFHQHQDPSA-N Ala-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N OBVSBEYOMDWLRJ-BFHQHQDPSA-N 0.000 description 5
- AJBVYEYZVYPFCF-CIUDSAMLSA-N Ala-Lys-Asn Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O AJBVYEYZVYPFCF-CIUDSAMLSA-N 0.000 description 5
- KQESEZXHYOUIIM-CQDKDKBSSA-N Ala-Lys-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O KQESEZXHYOUIIM-CQDKDKBSSA-N 0.000 description 5
- DCVYRWFAMZFSDA-ZLUOBGJFSA-N Ala-Ser-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O DCVYRWFAMZFSDA-ZLUOBGJFSA-N 0.000 description 5
- NHWYNIZWLJYZAG-XVYDVKMFSA-N Ala-Ser-His Chemical compound C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N NHWYNIZWLJYZAG-XVYDVKMFSA-N 0.000 description 5
- NZGRHTKZFSVPAN-BIIVOSGPSA-N Ala-Ser-Pro Chemical compound C[C@@H](C(=O)N[C@@H](CO)C(=O)N1CCC[C@@H]1C(=O)O)N NZGRHTKZFSVPAN-BIIVOSGPSA-N 0.000 description 5
- KUFVXLQLDHJVOG-SHGPDSBTSA-N Ala-Thr-Thr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](C)N)O KUFVXLQLDHJVOG-SHGPDSBTSA-N 0.000 description 5
- COXMUHNBYCVVRG-DCAQKATOSA-N Arg-Leu-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O COXMUHNBYCVVRG-DCAQKATOSA-N 0.000 description 5
- VDCIPFYVCICPEC-FXQIFTODSA-N Asn-Arg-Ala Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O VDCIPFYVCICPEC-FXQIFTODSA-N 0.000 description 5
- OWUCNXMFJRFOFI-BQBZGAKWSA-N Asn-Gly-Met Chemical compound [H]N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CCSC)C(O)=O OWUCNXMFJRFOFI-BQBZGAKWSA-N 0.000 description 5
- WQAOZCVOOYUWKG-LSJOCFKGSA-N Asn-Val-Val Chemical compound CC(C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)O)NC(=O)[C@H](CC(=O)N)N WQAOZCVOOYUWKG-LSJOCFKGSA-N 0.000 description 5
- JUWZKMBALYLZCK-WHFBIAKZSA-N Asp-Gly-Asn Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O JUWZKMBALYLZCK-WHFBIAKZSA-N 0.000 description 5
- MYLZFUMPZCPJCJ-NHCYSSNCSA-N Asp-Lys-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O MYLZFUMPZCPJCJ-NHCYSSNCSA-N 0.000 description 5
- KESWRFKUZRUTAH-FXQIFTODSA-N Asp-Pro-Asp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(O)=O KESWRFKUZRUTAH-FXQIFTODSA-N 0.000 description 5
- XXAMCEGRCZQGEM-ZLUOBGJFSA-N Asp-Ser-Asn Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O XXAMCEGRCZQGEM-ZLUOBGJFSA-N 0.000 description 5
- JSHWXQIZOCVWIA-ZKWXMUAHSA-N Asp-Ser-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O JSHWXQIZOCVWIA-ZKWXMUAHSA-N 0.000 description 5
- OTKUAVXGMREHRX-CFMVVWHZSA-N Asp-Tyr-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 OTKUAVXGMREHRX-CFMVVWHZSA-N 0.000 description 5
- NNQHEEQNPQYPGL-FXQIFTODSA-N Gln-Ala-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(O)=O NNQHEEQNPQYPGL-FXQIFTODSA-N 0.000 description 5
- OACPJRQRAHMQEQ-NHCYSSNCSA-N Gln-Val-Arg Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O OACPJRQRAHMQEQ-NHCYSSNCSA-N 0.000 description 5
- NKLRYVLERDYDBI-FXQIFTODSA-N Glu-Glu-Asp Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O NKLRYVLERDYDBI-FXQIFTODSA-N 0.000 description 5
- NTNUEBVGKMVANB-NHCYSSNCSA-N Glu-Val-Met Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCSC)C(O)=O NTNUEBVGKMVANB-NHCYSSNCSA-N 0.000 description 5
- PYTZFYUXZZHOAD-WHFBIAKZSA-N Gly-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)CN PYTZFYUXZZHOAD-WHFBIAKZSA-N 0.000 description 5
- JRDYDYXZKFNNRQ-XPUUQOCRSA-N Gly-Ala-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)CN JRDYDYXZKFNNRQ-XPUUQOCRSA-N 0.000 description 5
- ADZGCWWDPFDHCY-ZETCQYMHSA-N Gly-His-Gly Chemical compound OC(=O)CNC(=O)[C@@H](NC(=O)CN)CC1=CN=CN1 ADZGCWWDPFDHCY-ZETCQYMHSA-N 0.000 description 5
- YHYDTTUSJXGTQK-UWVGGRQHSA-N Gly-Met-Leu Chemical compound CSCC[C@H](NC(=O)CN)C(=O)N[C@@H](CC(C)C)C(O)=O YHYDTTUSJXGTQK-UWVGGRQHSA-N 0.000 description 5
- YLEIWGJJBFBFHC-KBPBESRZSA-N Gly-Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CC1=CC=CC=C1 YLEIWGJJBFBFHC-KBPBESRZSA-N 0.000 description 5
- WCORRBXVISTKQL-WHFBIAKZSA-N Gly-Ser-Ser Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O WCORRBXVISTKQL-WHFBIAKZSA-N 0.000 description 5
- VSLXGYMEHVAJBH-DLOVCJGASA-N His-Ala-Leu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O VSLXGYMEHVAJBH-DLOVCJGASA-N 0.000 description 5
- MKWSZEHGHSLNPF-NAKRPEOUSA-N Ile-Ala-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)O)N MKWSZEHGHSLNPF-NAKRPEOUSA-N 0.000 description 5
- LEHPJMKVGFPSSP-ZQINRCPSSA-N Ile-Glu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)[C@@H](C)CC)C(O)=O)=CNC2=C1 LEHPJMKVGFPSSP-ZQINRCPSSA-N 0.000 description 5
- UAQSZXGJGLHMNV-XEGUGMAKSA-N Ile-Gly-Tyr Chemical compound CC[C@H](C)[C@@H](C(=O)NCC(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)N UAQSZXGJGLHMNV-XEGUGMAKSA-N 0.000 description 5
- UIEZQYNXCYHMQS-BJDJZHNGSA-N Ile-Lys-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)O)N UIEZQYNXCYHMQS-BJDJZHNGSA-N 0.000 description 5
- ADDYYRVQQZFIMW-MNXVOIDGSA-N Ile-Lys-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N ADDYYRVQQZFIMW-MNXVOIDGSA-N 0.000 description 5
- IVXJIMGDOYRLQU-XUXIUFHCSA-N Ile-Pro-Leu Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(O)=O IVXJIMGDOYRLQU-XUXIUFHCSA-N 0.000 description 5
- OIARJGNVARWKFP-YUMQZZPRSA-N Leu-Asn-Gly Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O OIARJGNVARWKFP-YUMQZZPRSA-N 0.000 description 5
- CLVUXCBGKUECIT-HJGDQZAQSA-N Leu-Asp-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CLVUXCBGKUECIT-HJGDQZAQSA-N 0.000 description 5
- KUIDCYNIEJBZBU-AJNGGQMLSA-N Leu-Ile-Leu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(O)=O KUIDCYNIEJBZBU-AJNGGQMLSA-N 0.000 description 5
- HVHRPWQEQHIQJF-AVGNSLFASA-N Leu-Lys-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O HVHRPWQEQHIQJF-AVGNSLFASA-N 0.000 description 5
- WGCKDDHUFPQSMZ-ZPFDUUQYSA-N Lys-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CCCCN WGCKDDHUFPQSMZ-ZPFDUUQYSA-N 0.000 description 5
- GJJQCBVRWDGLMQ-GUBZILKMSA-N Lys-Glu-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O GJJQCBVRWDGLMQ-GUBZILKMSA-N 0.000 description 5
- YDDDRTIPNTWGIG-SRVKXCTJSA-N Lys-Lys-Ser Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O YDDDRTIPNTWGIG-SRVKXCTJSA-N 0.000 description 5
- SBQDRNOLGSYHQA-YUMQZZPRSA-N Lys-Ser-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SBQDRNOLGSYHQA-YUMQZZPRSA-N 0.000 description 5
- VWPJQIHBBOJWDN-DCAQKATOSA-N Lys-Val-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O VWPJQIHBBOJWDN-DCAQKATOSA-N 0.000 description 5
- WYEXWKAWMNJKPN-UBHSHLNASA-N Met-Ala-Phe Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](CCSC)N WYEXWKAWMNJKPN-UBHSHLNASA-N 0.000 description 5
- OXIWIYOJVNOKOV-SRVKXCTJSA-N Met-Met-Arg Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@H](C(O)=O)CCCNC(N)=N OXIWIYOJVNOKOV-SRVKXCTJSA-N 0.000 description 5
- HLZORBMOISUNIV-DCAQKATOSA-N Met-Ser-Leu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC(C)C HLZORBMOISUNIV-DCAQKATOSA-N 0.000 description 5
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 5
- 108010079364 N-glycylalanine Proteins 0.000 description 5
- AOKZOUGUMLBPSS-PMVMPFDFSA-N Phe-Trp-Leu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(O)=O AOKZOUGUMLBPSS-PMVMPFDFSA-N 0.000 description 5
- KIQUCMUULDXTAZ-HJOGWXRNSA-N Phe-Tyr-Tyr Chemical compound N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O KIQUCMUULDXTAZ-HJOGWXRNSA-N 0.000 description 5
- AMBLXEMWFARNNQ-DCAQKATOSA-N Pro-Asn-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@@H]1CCCN1 AMBLXEMWFARNNQ-DCAQKATOSA-N 0.000 description 5
- KPDRZQUWJKTMBP-DCAQKATOSA-N Pro-Asp-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1 KPDRZQUWJKTMBP-DCAQKATOSA-N 0.000 description 5
- CLNJSLSHKJECME-BQBZGAKWSA-N Pro-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H]1CCCN1 CLNJSLSHKJECME-BQBZGAKWSA-N 0.000 description 5
- WVXQQUWOKUZIEG-VEVYYDQMSA-N Pro-Thr-Asn Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(O)=O WVXQQUWOKUZIEG-VEVYYDQMSA-N 0.000 description 5
- YQHZVYJAGWMHES-ZLUOBGJFSA-N Ser-Ala-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YQHZVYJAGWMHES-ZLUOBGJFSA-N 0.000 description 5
- MMAPOBOTRUVNKJ-ZLUOBGJFSA-N Ser-Asp-Ser Chemical compound C([C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CO)N)C(=O)O MMAPOBOTRUVNKJ-ZLUOBGJFSA-N 0.000 description 5
- BPMRXBZYPGYPJN-WHFBIAKZSA-N Ser-Gly-Asn Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O BPMRXBZYPGYPJN-WHFBIAKZSA-N 0.000 description 5
- YMTLKLXDFCSCNX-BYPYZUCNSA-N Ser-Gly-Gly Chemical compound OC[C@H](N)C(=O)NCC(=O)NCC(O)=O YMTLKLXDFCSCNX-BYPYZUCNSA-N 0.000 description 5
- IOVHBRCQOGWAQH-ZKWXMUAHSA-N Ser-Gly-Ile Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(O)=O IOVHBRCQOGWAQH-ZKWXMUAHSA-N 0.000 description 5
- JWOBLHJRDADHLN-KKUMJFAQSA-N Ser-Leu-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O JWOBLHJRDADHLN-KKUMJFAQSA-N 0.000 description 5
- SRKMDKACHDVPMD-SRVKXCTJSA-N Ser-Lys-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)N SRKMDKACHDVPMD-SRVKXCTJSA-N 0.000 description 5
- MQUZANJDFOQOBX-SRVKXCTJSA-N Ser-Phe-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O MQUZANJDFOQOBX-SRVKXCTJSA-N 0.000 description 5
- QMCDMHWAKMUGJE-IHRRRGAJSA-N Ser-Phe-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(O)=O QMCDMHWAKMUGJE-IHRRRGAJSA-N 0.000 description 5
- SRSPTFBENMJHMR-WHFBIAKZSA-N Ser-Ser-Gly Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SRSPTFBENMJHMR-WHFBIAKZSA-N 0.000 description 5
- XJDMUQCLVSCRSJ-VZFHVOOUSA-N Ser-Thr-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O XJDMUQCLVSCRSJ-VZFHVOOUSA-N 0.000 description 5
- ZKOKTQPHFMRSJP-YJRXYDGGSA-N Ser-Thr-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O ZKOKTQPHFMRSJP-YJRXYDGGSA-N 0.000 description 5
- JZRYFUGREMECBH-XPUUQOCRSA-N Ser-Val-Gly Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O JZRYFUGREMECBH-XPUUQOCRSA-N 0.000 description 5
- LGIMRDKGABDMBN-DCAQKATOSA-N Ser-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N LGIMRDKGABDMBN-DCAQKATOSA-N 0.000 description 5
- GFDUZZACIWNMPE-KZVJFYERSA-N Thr-Ala-Met Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(O)=O GFDUZZACIWNMPE-KZVJFYERSA-N 0.000 description 5
- KEGBFULVYKYJRD-LFSVMHDDSA-N Thr-Ala-Phe Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 KEGBFULVYKYJRD-LFSVMHDDSA-N 0.000 description 5
- PQLXHSACXPGWPD-GSSVUCPTSA-N Thr-Asn-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O PQLXHSACXPGWPD-GSSVUCPTSA-N 0.000 description 5
- YUPVPKZBKCLFLT-QTKMDUPCSA-N Thr-His-Val Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](C(C)C)C(=O)O)N)O YUPVPKZBKCLFLT-QTKMDUPCSA-N 0.000 description 5
- XZUBGOYOGDRYFC-XGEHTFHBSA-N Thr-Ser-Met Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(O)=O XZUBGOYOGDRYFC-XGEHTFHBSA-N 0.000 description 5
- LXXCHJKHJYRMIY-FQPOAREZSA-N Thr-Tyr-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O LXXCHJKHJYRMIY-FQPOAREZSA-N 0.000 description 5
- JAWUQFCGNVEDRN-MEYUZBJRSA-N Thr-Tyr-Leu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC(C)C)C(=O)O)N)O JAWUQFCGNVEDRN-MEYUZBJRSA-N 0.000 description 5
- ZNFPUOSTMUMUDR-JRQIVUDYSA-N Tyr-Asn-Thr Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O ZNFPUOSTMUMUDR-JRQIVUDYSA-N 0.000 description 5
- 108010064997 VPY tripeptide Proteins 0.000 description 5
- LABUITCFCAABSV-BPNCWPANSA-N Val-Ala-Tyr Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 LABUITCFCAABSV-BPNCWPANSA-N 0.000 description 5
- LABUITCFCAABSV-UHFFFAOYSA-N Val-Ala-Tyr Natural products CC(C)C(N)C(=O)NC(C)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 LABUITCFCAABSV-UHFFFAOYSA-N 0.000 description 5
- ZXAGTABZUOMUDO-GVXVVHGQSA-N Val-Glu-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N ZXAGTABZUOMUDO-GVXVVHGQSA-N 0.000 description 5
- MDYSKHBSPXUOPV-JSGCOSHPSA-N Val-Gly-Phe Chemical compound CC(C)[C@@H](C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N MDYSKHBSPXUOPV-JSGCOSHPSA-N 0.000 description 5
- BZMIYHIJVVJPCK-QSFUFRPTSA-N Val-Ile-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](C(C)C)N BZMIYHIJVVJPCK-QSFUFRPTSA-N 0.000 description 5
- FEXILLGKGGTLRI-NHCYSSNCSA-N Val-Leu-Asn Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](C(C)C)N FEXILLGKGGTLRI-NHCYSSNCSA-N 0.000 description 5
- XXWBHOWRARMUOC-NHCYSSNCSA-N Val-Lys-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N)C(=O)O)N XXWBHOWRARMUOC-NHCYSSNCSA-N 0.000 description 5
- YKNOJPJWNVHORX-UNQGMJICSA-N Val-Phe-Thr Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)O)C(O)=O)CC1=CC=CC=C1 YKNOJPJWNVHORX-UNQGMJICSA-N 0.000 description 5
- QWCZXKIFPWPQHR-JYJNAYRXSA-N Val-Pro-Tyr Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 QWCZXKIFPWPQHR-JYJNAYRXSA-N 0.000 description 5
- UGFMVXRXULGLNO-XPUUQOCRSA-N Val-Ser-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O UGFMVXRXULGLNO-XPUUQOCRSA-N 0.000 description 5
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 5
- 108010070944 alanylhistidine Proteins 0.000 description 5
- 108010062796 arginyllysine Proteins 0.000 description 5
- 108010049041 glutamylalanine Proteins 0.000 description 5
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 5
- 108010027668 glycyl-alanyl-valine Proteins 0.000 description 5
- 108010033719 glycyl-histidyl-glycine Proteins 0.000 description 5
- 108010089804 glycyl-threonine Proteins 0.000 description 5
- 108010015792 glycyllysine Proteins 0.000 description 5
- 108010037850 glycylvaline Proteins 0.000 description 5
- 108010085325 histidylproline Proteins 0.000 description 5
- 108010044311 leucyl-glycyl-glycine Proteins 0.000 description 5
- 108010003700 lysyl aspartic acid Proteins 0.000 description 5
- 108010064235 lysylglycine Proteins 0.000 description 5
- 108010051242 phenylalanylserine Proteins 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 102000004169 proteins and genes Human genes 0.000 description 5
- 108010061238 threonyl-glycine Proteins 0.000 description 5
- 108010020532 tyrosyl-proline Proteins 0.000 description 5
- 108010073969 valyllysine Proteins 0.000 description 5
- YQEHNIKPAOPBNH-DCAQKATOSA-N Cys-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CS)N YQEHNIKPAOPBNH-DCAQKATOSA-N 0.000 description 4
- VIIBEIQMLJEUJG-LAEOZQHASA-N Gly-Ile-Gln Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(O)=O VIIBEIQMLJEUJG-LAEOZQHASA-N 0.000 description 4
- IZVICCORZOSGPT-JSGCOSHPSA-N Gly-Val-Tyr Chemical compound [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O IZVICCORZOSGPT-JSGCOSHPSA-N 0.000 description 4
- PLOUVAYOMTYJRG-JXUBOQSCSA-N Lys-Thr-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O PLOUVAYOMTYJRG-JXUBOQSCSA-N 0.000 description 4
- 102000035195 Peptidases Human genes 0.000 description 4
- 229960000723 ampicillin Drugs 0.000 description 4
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 4
- 238000010353 genetic engineering Methods 0.000 description 4
- 229930027917 kanamycin Natural products 0.000 description 4
- 229960000318 kanamycin Drugs 0.000 description 4
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 4
- 229930182823 kanamycin A Natural products 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 238000006731 degradation reaction Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 235000013305 food Nutrition 0.000 description 3
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 238000009004 PCR Kit Methods 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 239000007853 buffer solution Substances 0.000 description 2
- 230000000593 degrading effect Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 238000010438 heat treatment Methods 0.000 description 2
- 239000012474 protein marker Substances 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 102220482199 tRNA pseudouridine synthase A_K49E_mutation Human genes 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- XCIGOVDXZULBBV-DCAQKATOSA-N Ala-Val-Lys Chemical compound CC(C)[C@H](NC(=O)[C@H](C)N)C(=O)N[C@@H](CCCCN)C(O)=O XCIGOVDXZULBBV-DCAQKATOSA-N 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 241000672609 Escherichia coli BL21 Species 0.000 description 1
- HZISRJBYZAODRV-XQXXSGGOSA-N Glu-Thr-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O HZISRJBYZAODRV-XQXXSGGOSA-N 0.000 description 1
- QRWPTXLWHHTOCO-DZKIICNBSA-N Glu-Val-Tyr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O QRWPTXLWHHTOCO-DZKIICNBSA-N 0.000 description 1
- MQVNVZUEPUIAFA-WDSKDSINSA-N Gly-Cys-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)CN MQVNVZUEPUIAFA-WDSKDSINSA-N 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- YZCKVEUIGOORGS-IGMARMGPSA-N Protium Chemical compound [1H] YZCKVEUIGOORGS-IGMARMGPSA-N 0.000 description 1
- 108010005233 alanylglutamic acid Proteins 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000004043 dyeing Methods 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 239000003292 glue Substances 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 230000036438 mutation frequency Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 230000009145 protein modification Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000004064 recycling Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 239000012137 tryptone Substances 0.000 description 1
- 238000009423 ventilation Methods 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/52—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea
- C12N9/54—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea bacteria being Bacillus
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/189—Enzymes
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L29/00—Foods or foodstuffs containing additives; Preparation or treatment thereof
- A23L29/06—Enzymes
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/16—Organic compounds
- C11D3/38—Products with no well-defined composition, e.g. natural products
- C11D3/386—Preparations containing enzymes, e.g. protease or amylase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms, e.g. protozoa; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/20—Bacteria; Culture media therefor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
- C12N15/75—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for Bacillus
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02P—CLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
- Y02P60/00—Technologies relating to agriculture, livestock or agroalimentary industries
- Y02P60/80—Food processing, e.g. use of renewable energies or variable speed drives in handling, conveying or stacking
- Y02P60/87—Re-use of by-products of food processing for fodder production
Abstract
The invention provides a protease mutant BLAPR2 with improved thermal stability, and a coding gene and application thereof, and the invention uses an error-prone PCR method toBacillus licheniformisThe protease mutant BLAPR2 is obtained by mutating the protease gene and then screening the protease gene with high flux, compared with the unmutated protease, the thermal stability of the protease mutant obtained by the invention is obviously improved, and the protease mutant has good market application prospect and industrial value.
Description
Technical Field
The invention belongs to the field of genetic engineering and enzyme engineering, and particularly relates to a protease mutant BLAPR2 with improved thermal stability, and a coding gene and application thereof.
Background
Proteases are enzymes which catalyze the hydrolysis of peptide bonds in proteins, are widely present in animals, plants and microorganisms, have many different physiological functions, and are the first and most mature ones for the development of enzymology. The application of protease in various fields, such as food industry, brewing, detergent industry, feed industry, tanning industry, silk industry, pharmaceutical industry and the like, is more closely related to our life, and the environment puts higher demands on the yield and the characteristic improvement of protease.
At present, most of proteases on the market only have less than 20% of residual enzyme activity after being treated at 70 ℃, and the overall temperature resistance is poor, so that the wide use of the proteases is limited. For example, in the production of feed, the enzyme preparation is mixed with feed and then granulated at high temperature, during which the enzyme is easily inactivated. It is therefore of great importance to improve the thermostability of the protease.
The error-prone PCR technology is that when a target fragment is amplified by adopting DNA polymerase to carry out PCR reaction, the mutation frequency in the amplification process is increased by adjusting the reaction conditions, so that mutation is randomly introduced into a target gene at a certain frequency to construct a mutant library, and thus, a required forward mutant is screened. The error-prone PCR technique can be well applied to molecular modification of proteins.
Disclosure of Invention
The invention provides a protease mutant BLAPR2 with improved thermal stability, and a coding gene and application thereof, which are obtained by constructing a mutant library and performing directional screeningBacillus licheniformis And the protease gene from WX-02 is improved, and a mutant with improved heat stability is obtained by screening, so that the application effect of the mutant in the fields of feed, food or washing is improved.
In order to achieve the purpose of the invention, the invention is realized by adopting the following technical scheme:
the invention provides a protease mutant BLAPR2 with improved thermal stability, and the amino acid sequence of the protease mutant BLAPR2 is shown in SEQ ID NO: 5, the nucleotide sequence of the coding gene is shown as SEQ ID NO: and 6.
The invention also provides a recombinant expression vector containing the protease mutant coding gene.
The invention provides a genetic engineering bacterium containing a protease mutant coding gene, wherein the genetic engineering bacterium is bacillus subtilis and bacillus licheniformis.
The invention provides a preparation method of the protease mutant, which comprises the following steps:
1) constructing recombinant gene engineering bacteria: connecting the coding gene of the protease mutant to a pUB110 vector, transforming the recombinant vector into bacillus subtilis, and screening positive clones by using a resistance marker;
2) shaking flask fermentation of recombinant genetic engineering bacteria: inoculating the positive clone which is verified to be correct into a shake flask for fermentation, carrying out shake culture, and fermenting to generate a protease mutant;
3) amplifying and fermenting the recombinant strain: inoculating the gene engineering strain expressing the protease mutant into a fermentation tank, thereby producing the protease mutant BLAPR2 through fermentation.
Further: the fermentation medium in the step (3) comprises the following components: 5-10% of soybean meal, 1-5% of corn flour, 1-1.0% of PPG-200000.1, 0.1-1.0% of protease, 0.1-1.0% of amylase and 0.2-0.5% of disodium hydrogen phosphate by mass ratio.
The invention provides application of the protease mutant in preparation of feed additives, food additives and detergents.
Compared with the prior art, the invention has the advantages and the technical effects that: the invention is provided withBacillus licheniformis Based on the protease gene derived from WX-02, single-site mutant BLAPR1 containing A196C, double-site mutants BLAPR2 and BLAPR3 containing I140C/A196C and K49E/A196C respectively, and triple-site mutant BLAPR4 containing S191C/A196C/G308E are provided.
The improved mutant of the invention, namely the BLAPR1, BLAPR2, BLAPR3 and BLAPR4, has 30.2 percent, 64.0 percent, 45.9 percent and 39.0 percent of improved thermal stability when treated for 3 minutes at 75 ℃ compared with the original protease respectively. The thermal stability is obviously improved.
Therefore, the heat stability of the protease mutant obtained by the technical scheme of the invention is greatly improved compared with that of a wild type, so that the protease mutant has good application potential in the fields of feed, food or washing and the like. Has good market application prospect.
Drawings
FIG. 1 shows the fermentation data of the protease of the present invention in a 30L fermenter.
FIG. 2 shows the comparison of the heat resistance of the protease mutants of the present invention in a water bath at 75 ℃ for 3 min.
FIG. 3 shows the effect of the protease mutants of the present invention on the degradation of soybean meal resistant protein (1, 19 are protein markers; 2, 8, 12, 18 are soybean meal without enzyme addition; 3-7 are, respectively, 200U/g of BLAPR0, BLAPR1, BLAPR2, BLAPR3 and BLAPR 4; 9-13 are, respectively, 400U/g of BLAPR0, BLAPR1, BLAPR2, BLAPR3 and BLAPR 4; and 13-17 are, respectively, 600U/g of BLAPR0, BLAPR1, BLAPR2, BLAPR3 and BLAPR 4).
Detailed Description
In order to facilitate understanding of the invention, the invention will be described in more complete detail with reference to the drawings and examples, but the scope of the invention is not limited to the following examples.
The molecular biological experiments, which are not specifically described in the following examples, can be performed by referring to the specific methods listed in molecular cloning, A laboratory Manual (third edition) J. SammBruker, or according to the kit and product instructions. Reagents and biomaterials used in specific examples are commercially available without specific recitation.
1 strains and vectors
Bacillus subtilis WB600, plasmid pUB110, Escherichia coli BL21, plasmid pET-21a (+) were purchased from Invitrogen.
2 reagents and culture media
Plasmid extraction kit, fragment purification recovery kit, restriction enzyme and the like are purchased from precious bioengineering (Dalian) Co., Ltd; the GeneMorph II random mutation PCR kit was purchased from Stratagene; ampicillin, IPTG, etc. were purchased from Biotechnology engineering (Shanghai) Co., Ltd; protein Marker: blue Plus II Protein Marker (14-120 kDa) was purchased from GenBank technologies, Inc. of Beijing. LB culture medium: 1% tryptone, 0.5% yeast extract, 1% NaCl.
Example 1: error-prone PCR construction of protease mutant library
Reference toBacillus licheniformis The amino acid sequence (SEQ ID NO: 1) and DNA sequence (SEQ ID NO: 2) of the WX-02-derived protease were designed as primers, Xba I restriction sites were designed at the 5 'end, and BamH I restriction sites were designed at the 3' end.
SEQ ID NO:1
MMRKKSFWLGMLTAFMLVFTMAFSDSASAAQPAKNVEKDYIVGFKSGVKTASVKKDIIKESGGKVDKQFRIINAAKAKLDKEALKEVKNDPDVAYVEEDHVAHALAQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
SEQ ID NO:2
ATGATGAGGAAGAAATCATTTTGGTTAGGGATGCTGACGGCGTTTATGTTAGTGTTTACG
ATGGCGTTTTCAGATAGCGCTTCTGCTGCACAACCTGCGAAAAATGTTGAAAAAGATTAT
ATCGTGGGGTTTAAATCTGGAGTTAAAACGGCGTCTGTGAAAAAAGATATTATTAAAGAA
TCAGGCGGCAAAGTCGATAAACAGTTTCGGATTATCAATGCTGCGAAAGCGAAACTTGAT
AAAGAAGCATTGAAAGAAGTCAAAAATGATCCGGATGTTGCTTACGTCGAAGAAGATCAT
GTCGCACATGCACTTGCTCAGACGGTGCCGTATGGCATCCCTCTTATCAAAGCAGATAAA
GTCCAAGCACAAGGCTTTAAAGGCGCTAATGTCAAAGTCGCGGTCCTTGATACGGGAATC
CAAGCAAGTCATCCGGATCTTAATGTGGTTGGGGGTGCGTCATTTGTCGCGGGAGAAGCA
TATAATACAGATGGCAACGGTCATGGAACACATGTTGCGGGAACGGTCGCAGCGTTAGAT
AATACGACGGGTGTGCTTGGTGTTGCACCGTCTGTCTCACTGTATGCGGTGAAAGTCCTT
AATTCTAGCGGATCTGGATCTTATTCAGGAATTGTGTCTGGAATCGAATGGGCTACAACG
AATGGCATGGATGTCATCAATATGAGCCTGGGAGGCGCGAGCGGCTCTACAGCTATGAAA
CAAGCAGTCGATAATGCGTATGCGCGCGGTGTTGTGGTGGTCGCAGCTGCGGGCAATTCA
GGCTCATCTGGCAATACGAATACGATCGGCTATCCGGCTAAATATGATTCAGTCATTGCT
GTGGGCGCGGTCGATTCTAATTCTAATCGTGCTTCTTTTAGCTCAGTGGGCGCAGAACTT
GAAGTGATGGCACCGGGCGCTGGAGTGTATAGCACCTATCCGACAAATACCTATGCTACA
CTGAATGGCACGTCTATGGCTTCACCTCATGTTGCAGGCGCCGCCGCTCTTATCCTGAGC
AAACATCCTAATTTGAGCGCGAGCCAGGTTCGTAATAGACTTTCTTCAACAGCGACGTAT
TTGGGCTCTAGCTTTTATTATGGCAAAGGACTGATCAATGTCGAAGCAGCTGCACAGTAA
Using GeneMorph II random mutation PCR kit, the PCR primers shown in SEQ ID NO: 2 as template, and carrying out random mutation by using the following primer sequences:
BLAPR-F:GCTCTAGAATGATGAGGAAGAAATC(SEQ ID NO:11);
BLAPR-R:CGCGGATCCTTACTGTGCAGCTGCTTCGA(SEQ ID NO:12)。
and carrying out double enzyme digestion on the amplified random mutation PCR product by using Xba I and BamH I, purifying and recycling the product, connecting the product to a pET-21a (+) vector, transforming escherichia coli BL21-DE3, and screening positive clones by using an ampicillin-resistant LB plate to obtain pET-BLAPREX. The synthesized original gene was ligated to pET-21a (+) vector and transformed into E.coli BL21-DE3 to obtain pET-BLAPR0 in the same manner.
The selected single colonies were inoculated into a 96-well deep-well plate. Each plate was inoculated with 2 single colonies expressing BLAPR0 as controls. 300uL of LB liquid medium (containing 100. mu.g/mL ampicillin) was placed in each well, shake-cultured at 37 ℃ and 200rpm for 4 hours, 50uL of the bacterial solution was transferred to a new 96-well plate for stock preservation, 200uL of LB-Amp medium containing IPTG was added to the remaining bacterial solution on the plate so that the final concentration of IPTG was 1mM and the final concentration of ampicillin was 100. mu.g/mL, and shake-cultured at 37 ℃ and 200rpm for 10 hours to induce expression of protease.
And (3) repeatedly freezing and thawing the induced bacterial liquid for crushing, centrifuging the crushed cell sap, taking the supernatant, carrying out heat treatment (75 ℃ water bath for 3min), and then detecting the residual activity of the protease. And sequencing the mutant gene with the residual enzyme activity higher than that of the control.
The mutant A196C (named as BLAPR1) with improved heat resistance and taking the BLAPR0 as a starting template is screened, and the amino acid sequence is shown as SEQ ID NO: 3, and the coded nucleotide sequence is shown as SEQ ID NO: 4, respectively.
SEQ ID NO:3
MMRKKSFWLGMLTAFMLVFTMAFSDSASAAQPAKNVEKDYIVGFKSGVKTASVKKDIIKESGGKVDKQFRIINAAKAKLDKEALKEVKNDPDVAYVEEDHVAHALAQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYCVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
SEQ ID NO:4
ATGATGAGGAAGAAATCATTTTGGTTAGGGATGCTGACGGCGTTTATGTTAGTGTTTACG
ATGGCGTTTTCAGATAGCGCTTCTGCTGCACAACCTGCGAAAAATGTTGAAAAAGATTAT
ATCGTGGGGTTTAAATCTGGAGTTAAAACGGCGTCTGTGAAAAAAGATATTATTAAAGAA
TCAGGCGGCAAAGTCGATAAACAGTTTCGGATTATCAATGCTGCGAAAGCGAAACTTGAT
AAAGAAGCATTGAAAGAAGTCAAAAATGATCCGGATGTTGCTTACGTCGAAGAAGATCAT
GTCGCACATGCACTTGCTCAGACGGTGCCGTATGGCATCCCTCTTATCAAAGCAGATAAA
GTCCAAGCACAAGGCTTTAAAGGCGCTAATGTCAAAGTCGCGGTCCTTGATACGGGAATC
CAAGCAAGTCATCCGGATCTTAATGTGGTTGGGGGTGCGTCATTTGTCGCGGGAGAAGCA
TATAATACAGATGGCAACGGTCATGGAACACATGTTGCGGGAACGGTCGCAGCGTTAGAT
AATACGACGGGTGTGCTTGGTGTTGCACCGTCTGTCTCACTGTATTGCGTGAAAGTCCTT
AATTCTAGCGGATCTGGATCTTATTCAGGAATTGTGTCTGGAATCGAATGGGCTACAACG
AATGGCATGGATGTCATCAATATGAGCCTGGGAGGCGCGAGCGGCTCTACAGCTATGAAA
CAAGCAGTCGATAATGCGTATGCGCGCGGTGTTGTGGTGGTCGCAGCTGCGGGCAATTCA
GGCTCATCTGGCAATACGAATACGATCGGCTATCCGGCTAAATATGATTCAGTCATTGCT
GTGGGCGCGGTCGATTCTAATTCTAATCGTGCTTCTTTTAGCTCAGTGGGCGCAGAACTT
GAAGTGATGGCACCGGGCGCTGGAGTGTATAGCACCTATCCGACAAATACCTATGCTACA
CTGAATGGCACGTCTATGGCTTCACCTCATGTTGCAGGCGCCGCCGCTCTTATCCTGAGC
AAACATCCTAATTTGAGCGCGAGCCAGGTTCGTAATAGACTTTCTTCAACAGCGACGTAT
TTGGGCTCTAGCTTTTATTATGGCAAAGGACTGATCAATGTCGAAGCAGCTGCACAGTAA
Example 2: second round error-prone PCR construction of mutant library of protease BLAPR1
The protease gene BLAPR1 screened in the example 1 is used as a template, and the second round of random mutation, the construction process of a mutation library, the use of material reagents, the operation conditions and the like are the same as those in the example 1; and (3) performing mutant culture and screening by taking the BLAPR1 as a control, detecting the residual activity of the protease mutant after heat treatment (water bath at 75 ℃ for 3min), and sequencing the mutant gene with the residual activity higher than that of the BLAPR 1.
The following mutants with improved thermostability were finally screened:
the mutation mode of the BLAPR2 is I140C/A196C, and the amino acid sequence is shown as SEQ ID No: 5, the gene sequence is shown as SEQ ID No: 6 is shown in the specification;
the mutation mode of the BLAPR3 is K49E/A196C, and the amino acid sequence is shown as SEQ ID No: 7, and the gene sequence is shown as SEQ ID No: 8 is shown in the specification;
the mutation mode of the BLAPR4 is S191C/A196C/G308E, and the amino acid sequence is shown as SEQ ID No: 9, and the gene sequence is shown as SEQ ID No: shown at 10.
SEQ ID No:5
MMRKKSFWLGMLTAFMLVFTMAFSDSASAAQPAKNVEKDYIVGFKSGVKTASVKKDIIKESGGKVDKQFRIINAAKAKLDKEALKEVKNDPDVAYVEEDHVAHALAQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGCQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYCVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
SEQ ID No:6
ATGATGAGGAAGAAATCATTTTGGTTAGGGATGCTGACGGCGTTTATGTTAGTGTTTACG
ATGGCGTTTTCAGATAGCGCTTCTGCTGCACAACCTGCGAAAAATGTTGAAAAAGATTAT
ATCGTGGGGTTTAAATCTGGAGTTAAAACGGCGTCTGTGAAAAAAGATATTATTAAAGAA
TCAGGCGGCAAAGTCGATAAACAGTTTCGGATTATCAATGCTGCGAAAGCGAAACTTGAT
AAAGAAGCATTGAAAGAAGTCAAAAATGATCCGGATGTTGCTTACGTCGAAGAAGATCAT
GTCGCACATGCACTTGCTCAGACGGTGCCGTATGGCATCCCTCTTATCAAAGCAGATAAA
GTCCAAGCACAAGGCTTTAAAGGCGCTAATGTCAAAGTCGCGGTCCTTGATACGGGATGC
CAAGCAAGTCATCCGGATCTTAATGTGGTTGGGGGTGCGTCATTTGTCGCGGGAGAAGCA
TATAATACAGATGGCAACGGTCATGGAACACATGTTGCGGGAACGGTCGCAGCGTTAGAT
AATACGACGGGTGTGCTTGGTGTTGCACCGTCTGTCTCACTGTATTGCGTGAAAGTCCTT
AATTCTAGCGGATCTGGATCTTATTCAGGAATTGTGTCTGGAATCGAATGGGCTACAACG
AATGGCATGGATGTCATCAATATGAGCCTGGGAGGCGCGAGCGGCTCTACAGCTATGAAA
CAAGCAGTCGATAATGCGTATGCGCGCGGTGTTGTGGTGGTCGCAGCTGCGGGCAATTCA
GGCTCATCTGGCAATACGAATACGATCGGCTATCCGGCTAAATATGATTCAGTCATTGCT
GTGGGCGCGGTCGATTCTAATTCTAATCGTGCTTCTTTTAGCTCAGTGGGCGCAGAACTT
GAAGTGATGGCACCGGGCGCTGGAGTGTATAGCACCTATCCGACAAATACCTATGCTACA
CTGAATGGCACGTCTATGGCTTCACCTCATGTTGCAGGCGCCGCCGCTCTTATCCTGAGC
AAACATCCTAATTTGAGCGCGAGCCAGGTTCGTAATAGACTTTCTTCAACAGCGACGTAT
TTGGGCTCTAGCTTTTATTATGGCAAAGGACTGATCAATGTCGAAGCAGCTGCACAGTAA
SEQ ID No:7
MMRKKSFWLGMLTAFMLVFTMAFSDSASAAQPAKNVEKDYIVGFKSGVETASVKKDIIKESGGKVDKQFRIINAAKAKLDKEALKEVKNDPDVAYVEEDHVAHALAQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYCVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
SEQ ID No:8
ATGATGAGGAAGAAATCATTTTGGTTAGGGATGCTGACGGCGTTTATGTTAGTGTTTACG
ATGGCGTTTTCAGATAGCGCTTCTGCTGCACAACCTGCGAAAAATGTTGAAAAAGATTAT
ATCGTGGGGTTTAAATCTGGAGTTGAAACGGCGTCTGTGAAAAAAGATATTATTAAAGAA
TCAGGCGGCAAAGTCGATAAACAGTTTCGGATTATCAATGCTGCGAAAGCGAAACTTGAT
AAAGAAGCATTGAAAGAAGTCAAAAATGATCCGGATGTTGCTTACGTCGAAGAAGATCAT
GTCGCACATGCACTTGCTCAGACGGTGCCGTATGGCATCCCTCTTATCAAAGCAGATAAA
GTCCAAGCACAAGGCTTTAAAGGCGCTAATGTCAAAGTCGCGGTCCTTGATACGGGAATC
CAAGCAAGTCATCCGGATCTTAATGTGGTTGGGGGTGCGTCATTTGTCGCGGGAGAAGCA
TATAATACAGATGGCAACGGTCATGGAACACATGTTGCGGGAACGGTCGCAGCGTTAGAT
AATACGACGGGTGTGCTTGGTGTTGCACCGTCTGTCTCACTGTATTGCGTGAAAGTCCTT
AATTCTAGCGGATCTGGATCTTATTCAGGAATTGTGTCTGGAATCGAATGGGCTACAACG
AATGGCATGGATGTCATCAATATGAGCCTGGGAGGCGCGAGCGGCTCTACAGCTATGAAA
CAAGCAGTCGATAATGCGTATGCGCGCGGTGTTGTGGTGGTCGCAGCTGCGGGCAATTCA
GGCTCATCTGGCAATACGAATACGATCGGCTATCCGGCTAAATATGATTCAGTCATTGCT
GTGGGCGCGGTCGATTCTAATTCTAATCGTGCTTCTTTTAGCTCAGTGGGCGCAGAACTT
GAAGTGATGGCACCGGGCGCTGGAGTGTATAGCACCTATCCGACAAATACCTATGCTACA
CTGAATGGCACGTCTATGGCTTCACCTCATGTTGCAGGCGCCGCCGCTCTTATCCTGAGC
AAACATCCTAATTTGAGCGCGAGCCAGGTTCGTAATAGACTTTCTTCAACAGCGACGTAT
TTGGGCTCTAGCTTTTATTATGGCAAAGGACTGATCAATGTCGAAGCAGCTGCACAGTAA
SEQ ID No:9
MMRKKSFWLGMLTAFMLVFTMAFSDSASAAQPAKNVEKDYIVGFKSGVKTASVKKDIIKESGGKVDKQFRIINAAKAKLDKEALKEVKNDPDVAYVEEDHVAHALAQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPCVSLYCVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAEVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
SEQ ID No:10
ATGATGAGGAAGAAATCATTTTGGTTAGGGATGCTGACGGCGTTTATGTTAGTGTTTACG
ATGGCGTTTTCAGATAGCGCTTCTGCTGCACAACCTGCGAAAAATGTTGAAAAAGATTAT
ATCGTGGGGTTTAAATCTGGAGTTAAAACGGCGTCTGTGAAAAAAGATATTATTAAAGAA
TCAGGCGGCAAAGTCGATAAACAGTTTCGGATTATCAATGCTGCGAAAGCGAAACTTGAT
AAAGAAGCATTGAAAGAAGTCAAAAATGATCCGGATGTTGCTTACGTCGAAGAAGATCAT
GTCGCACATGCACTTGCTCAGACGGTGCCGTATGGCATCCCTCTTATCAAAGCAGATAAA
GTCCAAGCACAAGGCTTTAAAGGCGCTAATGTCAAAGTCGCGGTCCTTGATACGGGAATC
CAAGCAAGTCATCCGGATCTTAATGTGGTTGGGGGTGCGTCATTTGTCGCGGGAGAAGCA
TATAATACAGATGGCAACGGTCATGGAACACATGTTGCGGGAACGGTCGCAGCGTTAGAT
AATACGACGGGTGTGCTTGGTGTTGCACCGTGCGTCTCACTGTATTGCGTGAAAGTCCTT
AATTCTAGCGGATCTGGATCTTATTCAGGAATTGTGTCTGGAATCGAATGGGCTACAACG
AATGGCATGGATGTCATCAATATGAGCCTGGGAGGCGCGAGCGGCTCTACAGCTATGAAA
CAAGCAGTCGATAATGCGTATGCGCGCGGTGTTGTGGTGGTCGCAGCTGCGGGCAATTCA
GGCTCATCTGGCAATACGAATACGATCGGCTATCCGGCTAAATATGATTCAGTCATTGCT
GTGGGCGCGGTCGATTCTAATTCTAATCGTGCTTCTTTTAGCTCAGTGGGCGCAGAACTT
GAAGTGATGGCACCGGGCGCTGAAGTGTATAGCACCTATCCGACAAATACCTATGCTACA
CTGAATGGCACGTCTATGGCTTCACCTCATGTTGCAGGCGCCGCCGCTCTTATCCTGAGC
AAACATCCTAATTTGAGCGCGAGCCAGGTTCGTAATAGACTTTCTTCAACAGCGACGTAT
TTGGGCTCTAGCTTTTATTATGGCAAAGGACTGATCAATGTCGAAGCAGCTGCACAGTAA
Example 3: expression verification of protease mutant with improved thermal stability in bacillus subtilis
The excellent mutants are respectively cloned into Xba I and BamH I sites of a plasmid pUB110, and the recombinant plasmid is transformed into Bacillus subtilis WB600 by referring to a Bacillus subtilis transformation formula created by Spizizen to obtain recombinant bacteria. According to a fermentation medium: 50-80g/L of soybean meal, 60-100g/L of corn starch, 2-4g/L of disodium hydrogen phosphate and 1-2g/L of sodium carbonate, wherein the pH is natural, after shaking fermentation is carried out for 78 hours, a culture solution is centrifuged to obtain a supernatant, the average enzyme activity of the supernatant of each mutant fermentation liquid is measured, a transformant with the highest enzyme activity in each mutant is taken for fermentation, and after the transformant is treated in a water bath at 75 ℃ for 3 minutes, the enzyme activity retention rate is compared, and the result is shown in figure 2. The thermal stability of the mutated proteases BLAPR1, BLAPR2, BLAPR3 and BLAPR4 after treatment at 75 ℃ for 3 minutes is improved by 30.2%, 64.0%, 45.9% and 39.0% respectively compared with the original protease.
The results show that the mutation of Ala at position 196 of BLAPR0 to Cys can improve the heat resistance of the enzyme while keeping the original enzyme activity. On the basis, mutation of Ile at position 140 into Cys or mutation of Lys at position 49 into Glu; or a mutant obtained by mutating Ser at the 191 th position to Cys and simultaneously mutating Gly at the 308 th position to Glu, and the heat resistance is further improved.
Example 4: protease mutants were fermented and prepared in a 30L fermentor
Genetically engineered bacteria expressing the protease mutants BLAPR0, BLAPR1, BLAPR2, BLAPR3 and BLAPR4 in the above examples were streaked on LB plates containing kanamycin resistance (20. mu.g/mL final concentration), cultured at 37 ℃ until single colonies grew out, and the single colonies growing well were selected and streaked on LB plates containing kanamycin resistance (20. mu.g/mL final concentration), and the colonies of recombinant Bacillus subtilis thus activated three generations were inoculated in 50mL of LB medium containing kanamycin resistance (20. mu.g/mL final concentration), and cultured at 37 ℃ and 200rpm for 24 hours. 2% of the inoculum size was inoculated into 1L LB medium containing 20. mu.g/mL kanamycin to a final concentration, 37 ℃, 200rpm culture to OD600 of about 5, used as seed liquid inoculation fermentation tank.
The fermentation production process comprises the following steps: 5-10% of soybean meal, 1-5% of corn flour, 1-1.0% of PPG-200000.1, 0.1-1.0% of protease, 0.1-1.0% of amylase, 0.2-0.5% of disodium hydrogen phosphate (12 water), natural pH, 37 ℃, stirring speed of 600rpm, ventilation volume of 1.5 (v/v), and dissolved oxygen controlled at more than 20%. The pH value is natural in the fermentation process, the enzyme activity is measured after fermentation is carried out for 24 hours, and after the fermentation is finished (generally 48 hours), the fermentation liquor is processed by a plate-and-frame filter to obtain crude enzyme liquid, and the crude enzyme liquid is sprayed and dried by a spray tower to form a powder preparation for application test.
Example 5: degradation experiment of protease mutant on resistance protein
(1) Resistant proteolysis reaction of soybean meal
Soybean meal substrate: taking 2g of crushed soybean meal sieved by a 60-mesh sieve, and adding 20mL of buffer solution (pH 8.00.02M Tris-HCl buffer solution) to prepare suspension;
experimental groups: and (3) centrifuging fermentation liquor of protease mutant BLAPR0, BLAPR1, BLAPR2, BLAPR3 and BLAPR4 genetically engineered bacteria to obtain fermentation liquor supernatant. Accurately measuring enzyme activity, and adding according to the same enzyme activity (200U/g, 400U/g and 600U/g);
control group: no enzyme is added, and the treatment process is consistent with that of the test group;
reaction conditions are as follows: uniformly mixing the enzyme solution and the substrate, and carrying out enzymolysis reaction for 2 hours at 37 ℃ and 120rpm/min on a water bath shaker;
after the reaction is finished, 0.5mL of the soybean meal enzymolysis liquid is added with 4.5mL of ELISA extracting solution, and the mixture is extracted for 16h at 25 ℃ and 200 rpm/min.
(2) SDS-PAGE examination of antigen protein removal
And (2) taking 100 mu L of the sample subjected to reaction and extraction in the step (1), adding 100 mu L of Loading Buffer, boiling for 10min, and taking 20 mu L of the sample for Loading.
Electrophoresis conditions: the voltage is 80-90mv and the current is about 30mA when the gel is concentrated; when separating the gel, the voltage is 110-120mv, and the current is about 40 mA. The sample is stopped at a position 1cm away from the edge of the gel. Stripping the glue, dyeing for 2h, and decolorizing for 24h, wherein the decolorizing solution is replaced.
The test results are shown in fig. 3: under the same conditions and with the same addition amount of enzyme activity units, the degradation effects of the protease mutants such as BLAPR0, BLAPR1, BLAPR2, BLAPR3 and BLAPR4 on the soybean meal are basically consistent; when the addition amount of the protease mutant is 400U/g, the effect of degrading the soybean meal is remarkable, and only a shallow belt with about 50KD (beta subunit) is left; when the addition amount of the protease mutant is 600U/g, the soybean meal can be completely degraded.
The experiment shows that the protease mutants of BLAPR1, BLAPR2, BLAPR3 and BLAPR4 maintain the original property of efficiently degrading resistant protein, and meanwhile, the heat stability of the protease mutants is obviously improved, so that the protease mutants of BLAPR1, BLAPR2, BLAPR3 and BLAPR4 have good application potential.
The above examples are only intended to illustrate the technical solution of the present invention, but not to limit it; although the present invention has been described in detail with reference to the foregoing embodiments, it will be apparent to those skilled in the art that various changes may be made and equivalents may be substituted for elements thereof; and such modifications or substitutions do not depart from the spirit and scope of the corresponding technical solutions.
Sequence listing
<110> Qingdao Shangde Biotechnology Co., Ltd
QINGDAO RED CHERRY BIOTECHNOLOGY Co.,Ltd.
<120> protease mutant BLAPR2 with improved heat stability, and coding gene and application thereof
<160> 12
<170> SIPOSequenceListing 1.0
<210> 1
<211> 379
<212> PRT
<213> Bacillus licheniformis (Bacillus licheniformis)
<400> 1
Met Met Arg Lys Lys Ser Phe Trp Leu Gly Met Leu Thr Ala Phe Met
1 5 10 15
Leu Val Phe Thr Met Ala Phe Ser Asp Ser Ala Ser Ala Ala Gln Pro
20 25 30
Ala Lys Asn Val Glu Lys Asp Tyr Ile Val Gly Phe Lys Ser Gly Val
35 40 45
Lys Thr Ala Ser Val Lys Lys Asp Ile Ile Lys Glu Ser Gly Gly Lys
50 55 60
Val Asp Lys Gln Phe Arg Ile Ile Asn Ala Ala Lys Ala Lys Leu Asp
65 70 75 80
Lys Glu Ala Leu Lys Glu Val Lys Asn Asp Pro Asp Val Ala Tyr Val
85 90 95
Glu Glu Asp His Val Ala His Ala Leu Ala Gln Thr Val Pro Tyr Gly
100 105 110
Ile Pro Leu Ile Lys Ala Asp Lys Val Gln Ala Gln Gly Phe Lys Gly
115 120 125
Ala Asn Val Lys Val Ala Val Leu Asp Thr Gly Ile Gln Ala Ser His
130 135 140
Pro Asp Leu Asn Val Val Gly Gly Ala Ser Phe Val Ala Gly Glu Ala
145 150 155 160
Tyr Asn Thr Asp Gly Asn Gly His Gly Thr His Val Ala Gly Thr Val
165 170 175
Ala Ala Leu Asp Asn Thr Thr Gly Val Leu Gly Val Ala Pro Ser Val
180 185 190
Ser Leu Tyr Ala Val Lys Val Leu Asn Ser Ser Gly Ser Gly Ser Tyr
195 200 205
Ser Gly Ile Val Ser Gly Ile Glu Trp Ala Thr Thr Asn Gly Met Asp
210 215 220
Val Ile Asn Met Ser Leu Gly Gly Ala Ser Gly Ser Thr Ala Met Lys
225 230 235 240
Gln Ala Val Asp Asn Ala Tyr Ala Arg Gly Val Val Val Val Ala Ala
245 250 255
Ala Gly Asn Ser Gly Ser Ser Gly Asn Thr Asn Thr Ile Gly Tyr Pro
260 265 270
Ala Lys Tyr Asp Ser Val Ile Ala Val Gly Ala Val Asp Ser Asn Ser
275 280 285
Asn Arg Ala Ser Phe Ser Ser Val Gly Ala Glu Leu Glu Val Met Ala
290 295 300
Pro Gly Ala Gly Val Tyr Ser Thr Tyr Pro Thr Asn Thr Tyr Ala Thr
305 310 315 320
Leu Asn Gly Thr Ser Met Ala Ser Pro His Val Ala Gly Ala Ala Ala
325 330 335
Leu Ile Leu Ser Lys His Pro Asn Leu Ser Ala Ser Gln Val Arg Asn
340 345 350
Arg Leu Ser Ser Thr Ala Thr Tyr Leu Gly Ser Ser Phe Tyr Tyr Gly
355 360 365
Lys Gly Leu Ile Asn Val Glu Ala Ala Ala Gln
370 375
<210> 2
<211> 1140
<212> DNA
<213> Bacillus licheniformis (Bacillus licheniformis)
<400> 2
atgatgagga agaaatcatt ttggttaggg atgctgacgg cgtttatgtt agtgtttacg 60
atggcgtttt cagatagcgc ttctgctgca caacctgcga aaaatgttga aaaagattat 120
atcgtggggt ttaaatctgg agttaaaacg gcgtctgtga aaaaagatat tattaaagaa 180
tcaggcggca aagtcgataa acagtttcgg attatcaatg ctgcgaaagc gaaacttgat 240
aaagaagcat tgaaagaagt caaaaatgat ccggatgttg cttacgtcga agaagatcat 300
gtcgcacatg cacttgctca gacggtgccg tatggcatcc ctcttatcaa agcagataaa 360
gtccaagcac aaggctttaa aggcgctaat gtcaaagtcg cggtccttga tacgggaatc 420
caagcaagtc atccggatct taatgtggtt gggggtgcgt catttgtcgc gggagaagca 480
tataatacag atggcaacgg tcatggaaca catgttgcgg gaacggtcgc agcgttagat 540
aatacgacgg gtgtgcttgg tgttgcaccg tctgtctcac tgtatgcggt gaaagtcctt 600
aattctagcg gatctggatc ttattcagga attgtgtctg gaatcgaatg ggctacaacg 660
aatggcatgg atgtcatcaa tatgagcctg ggaggcgcga gcggctctac agctatgaaa 720
caagcagtcg ataatgcgta tgcgcgcggt gttgtggtgg tcgcagctgc gggcaattca 780
ggctcatctg gcaatacgaa tacgatcggc tatccggcta aatatgattc agtcattgct 840
gtgggcgcgg tcgattctaa ttctaatcgt gcttctttta gctcagtggg cgcagaactt 900
gaagtgatgg caccgggcgc tggagtgtat agcacctatc cgacaaatac ctatgctaca 960
ctgaatggca cgtctatggc ttcacctcat gttgcaggcg ccgccgctct tatcctgagc 1020
aaacatccta atttgagcgc gagccaggtt cgtaatagac tttcttcaac agcgacgtat 1080
ttgggctcta gcttttatta tggcaaagga ctgatcaatg tcgaagcagc tgcacagtaa 1140
<210> 3
<211> 379
<212> PRT
<213> Bacillus licheniformis (Bacillus licheniformis)
<400> 3
Met Met Arg Lys Lys Ser Phe Trp Leu Gly Met Leu Thr Ala Phe Met
1 5 10 15
Leu Val Phe Thr Met Ala Phe Ser Asp Ser Ala Ser Ala Ala Gln Pro
20 25 30
Ala Lys Asn Val Glu Lys Asp Tyr Ile Val Gly Phe Lys Ser Gly Val
35 40 45
Lys Thr Ala Ser Val Lys Lys Asp Ile Ile Lys Glu Ser Gly Gly Lys
50 55 60
Val Asp Lys Gln Phe Arg Ile Ile Asn Ala Ala Lys Ala Lys Leu Asp
65 70 75 80
Lys Glu Ala Leu Lys Glu Val Lys Asn Asp Pro Asp Val Ala Tyr Val
85 90 95
Glu Glu Asp His Val Ala His Ala Leu Ala Gln Thr Val Pro Tyr Gly
100 105 110
Ile Pro Leu Ile Lys Ala Asp Lys Val Gln Ala Gln Gly Phe Lys Gly
115 120 125
Ala Asn Val Lys Val Ala Val Leu Asp Thr Gly Ile Gln Ala Ser His
130 135 140
Pro Asp Leu Asn Val Val Gly Gly Ala Ser Phe Val Ala Gly Glu Ala
145 150 155 160
Tyr Asn Thr Asp Gly Asn Gly His Gly Thr His Val Ala Gly Thr Val
165 170 175
Ala Ala Leu Asp Asn Thr Thr Gly Val Leu Gly Val Ala Pro Ser Val
180 185 190
Ser Leu Tyr Cys Val Lys Val Leu Asn Ser Ser Gly Ser Gly Ser Tyr
195 200 205
Ser Gly Ile Val Ser Gly Ile Glu Trp Ala Thr Thr Asn Gly Met Asp
210 215 220
Val Ile Asn Met Ser Leu Gly Gly Ala Ser Gly Ser Thr Ala Met Lys
225 230 235 240
Gln Ala Val Asp Asn Ala Tyr Ala Arg Gly Val Val Val Val Ala Ala
245 250 255
Ala Gly Asn Ser Gly Ser Ser Gly Asn Thr Asn Thr Ile Gly Tyr Pro
260 265 270
Ala Lys Tyr Asp Ser Val Ile Ala Val Gly Ala Val Asp Ser Asn Ser
275 280 285
Asn Arg Ala Ser Phe Ser Ser Val Gly Ala Glu Leu Glu Val Met Ala
290 295 300
Pro Gly Ala Gly Val Tyr Ser Thr Tyr Pro Thr Asn Thr Tyr Ala Thr
305 310 315 320
Leu Asn Gly Thr Ser Met Ala Ser Pro His Val Ala Gly Ala Ala Ala
325 330 335
Leu Ile Leu Ser Lys His Pro Asn Leu Ser Ala Ser Gln Val Arg Asn
340 345 350
Arg Leu Ser Ser Thr Ala Thr Tyr Leu Gly Ser Ser Phe Tyr Tyr Gly
355 360 365
Lys Gly Leu Ile Asn Val Glu Ala Ala Ala Gln
370 375
<210> 4
<211> 1140
<212> DNA
<213> Bacillus licheniformis (Bacillus licheniformis)
<400> 4
atgatgagga agaaatcatt ttggttaggg atgctgacgg cgtttatgtt agtgtttacg 60
atggcgtttt cagatagcgc ttctgctgca caacctgcga aaaatgttga aaaagattat 120
atcgtggggt ttaaatctgg agttaaaacg gcgtctgtga aaaaagatat tattaaagaa 180
tcaggcggca aagtcgataa acagtttcgg attatcaatg ctgcgaaagc gaaacttgat 240
aaagaagcat tgaaagaagt caaaaatgat ccggatgttg cttacgtcga agaagatcat 300
gtcgcacatg cacttgctca gacggtgccg tatggcatcc ctcttatcaa agcagataaa 360
gtccaagcac aaggctttaa aggcgctaat gtcaaagtcg cggtccttga tacgggaatc 420
caagcaagtc atccggatct taatgtggtt gggggtgcgt catttgtcgc gggagaagca 480
tataatacag atggcaacgg tcatggaaca catgttgcgg gaacggtcgc agcgttagat 540
aatacgacgg gtgtgcttgg tgttgcaccg tctgtctcac tgtattgcgt gaaagtcctt 600
aattctagcg gatctggatc ttattcagga attgtgtctg gaatcgaatg ggctacaacg 660
aatggcatgg atgtcatcaa tatgagcctg ggaggcgcga gcggctctac agctatgaaa 720
caagcagtcg ataatgcgta tgcgcgcggt gttgtggtgg tcgcagctgc gggcaattca 780
ggctcatctg gcaatacgaa tacgatcggc tatccggcta aatatgattc agtcattgct 840
gtgggcgcgg tcgattctaa ttctaatcgt gcttctttta gctcagtggg cgcagaactt 900
gaagtgatgg caccgggcgc tggagtgtat agcacctatc cgacaaatac ctatgctaca 960
ctgaatggca cgtctatggc ttcacctcat gttgcaggcg ccgccgctct tatcctgagc 1020
aaacatccta atttgagcgc gagccaggtt cgtaatagac tttcttcaac agcgacgtat 1080
ttgggctcta gcttttatta tggcaaagga ctgatcaatg tcgaagcagc tgcacagtaa 1140
<210> 5
<211> 379
<212> PRT
<213> Bacillus licheniformis (Bacillus licheniformis)
<400> 5
Met Met Arg Lys Lys Ser Phe Trp Leu Gly Met Leu Thr Ala Phe Met
1 5 10 15
Leu Val Phe Thr Met Ala Phe Ser Asp Ser Ala Ser Ala Ala Gln Pro
20 25 30
Ala Lys Asn Val Glu Lys Asp Tyr Ile Val Gly Phe Lys Ser Gly Val
35 40 45
Lys Thr Ala Ser Val Lys Lys Asp Ile Ile Lys Glu Ser Gly Gly Lys
50 55 60
Val Asp Lys Gln Phe Arg Ile Ile Asn Ala Ala Lys Ala Lys Leu Asp
65 70 75 80
Lys Glu Ala Leu Lys Glu Val Lys Asn Asp Pro Asp Val Ala Tyr Val
85 90 95
Glu Glu Asp His Val Ala His Ala Leu Ala Gln Thr Val Pro Tyr Gly
100 105 110
Ile Pro Leu Ile Lys Ala Asp Lys Val Gln Ala Gln Gly Phe Lys Gly
115 120 125
Ala Asn Val Lys Val Ala Val Leu Asp Thr Gly Cys Gln Ala Ser His
130 135 140
Pro Asp Leu Asn Val Val Gly Gly Ala Ser Phe Val Ala Gly Glu Ala
145 150 155 160
Tyr Asn Thr Asp Gly Asn Gly His Gly Thr His Val Ala Gly Thr Val
165 170 175
Ala Ala Leu Asp Asn Thr Thr Gly Val Leu Gly Val Ala Pro Ser Val
180 185 190
Ser Leu Tyr Cys Val Lys Val Leu Asn Ser Ser Gly Ser Gly Ser Tyr
195 200 205
Ser Gly Ile Val Ser Gly Ile Glu Trp Ala Thr Thr Asn Gly Met Asp
210 215 220
Val Ile Asn Met Ser Leu Gly Gly Ala Ser Gly Ser Thr Ala Met Lys
225 230 235 240
Gln Ala Val Asp Asn Ala Tyr Ala Arg Gly Val Val Val Val Ala Ala
245 250 255
Ala Gly Asn Ser Gly Ser Ser Gly Asn Thr Asn Thr Ile Gly Tyr Pro
260 265 270
Ala Lys Tyr Asp Ser Val Ile Ala Val Gly Ala Val Asp Ser Asn Ser
275 280 285
Asn Arg Ala Ser Phe Ser Ser Val Gly Ala Glu Leu Glu Val Met Ala
290 295 300
Pro Gly Ala Gly Val Tyr Ser Thr Tyr Pro Thr Asn Thr Tyr Ala Thr
305 310 315 320
Leu Asn Gly Thr Ser Met Ala Ser Pro His Val Ala Gly Ala Ala Ala
325 330 335
Leu Ile Leu Ser Lys His Pro Asn Leu Ser Ala Ser Gln Val Arg Asn
340 345 350
Arg Leu Ser Ser Thr Ala Thr Tyr Leu Gly Ser Ser Phe Tyr Tyr Gly
355 360 365
Lys Gly Leu Ile Asn Val Glu Ala Ala Ala Gln
370 375
<210> 6
<211> 1140
<212> DNA
<213> Bacillus licheniformis (Bacillus licheniformis)
<400> 6
atgatgagga agaaatcatt ttggttaggg atgctgacgg cgtttatgtt agtgtttacg 60
atggcgtttt cagatagcgc ttctgctgca caacctgcga aaaatgttga aaaagattat 120
atcgtggggt ttaaatctgg agttaaaacg gcgtctgtga aaaaagatat tattaaagaa 180
tcaggcggca aagtcgataa acagtttcgg attatcaatg ctgcgaaagc gaaacttgat 240
aaagaagcat tgaaagaagt caaaaatgat ccggatgttg cttacgtcga agaagatcat 300
gtcgcacatg cacttgctca gacggtgccg tatggcatcc ctcttatcaa agcagataaa 360
gtccaagcac aaggctttaa aggcgctaat gtcaaagtcg cggtccttga tacgggatgc 420
caagcaagtc atccggatct taatgtggtt gggggtgcgt catttgtcgc gggagaagca 480
tataatacag atggcaacgg tcatggaaca catgttgcgg gaacggtcgc agcgttagat 540
aatacgacgg gtgtgcttgg tgttgcaccg tctgtctcac tgtattgcgt gaaagtcctt 600
aattctagcg gatctggatc ttattcagga attgtgtctg gaatcgaatg ggctacaacg 660
aatggcatgg atgtcatcaa tatgagcctg ggaggcgcga gcggctctac agctatgaaa 720
caagcagtcg ataatgcgta tgcgcgcggt gttgtggtgg tcgcagctgc gggcaattca 780
ggctcatctg gcaatacgaa tacgatcggc tatccggcta aatatgattc agtcattgct 840
gtgggcgcgg tcgattctaa ttctaatcgt gcttctttta gctcagtggg cgcagaactt 900
gaagtgatgg caccgggcgc tggagtgtat agcacctatc cgacaaatac ctatgctaca 960
ctgaatggca cgtctatggc ttcacctcat gttgcaggcg ccgccgctct tatcctgagc 1020
aaacatccta atttgagcgc gagccaggtt cgtaatagac tttcttcaac agcgacgtat 1080
ttgggctcta gcttttatta tggcaaagga ctgatcaatg tcgaagcagc tgcacagtaa 1140
<210> 7
<211> 379
<212> PRT
<213> Bacillus licheniformis (Bacillus licheniformis)
<400> 7
Met Met Arg Lys Lys Ser Phe Trp Leu Gly Met Leu Thr Ala Phe Met
1 5 10 15
Leu Val Phe Thr Met Ala Phe Ser Asp Ser Ala Ser Ala Ala Gln Pro
20 25 30
Ala Lys Asn Val Glu Lys Asp Tyr Ile Val Gly Phe Lys Ser Gly Val
35 40 45
Glu Thr Ala Ser Val Lys Lys Asp Ile Ile Lys Glu Ser Gly Gly Lys
50 55 60
Val Asp Lys Gln Phe Arg Ile Ile Asn Ala Ala Lys Ala Lys Leu Asp
65 70 75 80
Lys Glu Ala Leu Lys Glu Val Lys Asn Asp Pro Asp Val Ala Tyr Val
85 90 95
Glu Glu Asp His Val Ala His Ala Leu Ala Gln Thr Val Pro Tyr Gly
100 105 110
Ile Pro Leu Ile Lys Ala Asp Lys Val Gln Ala Gln Gly Phe Lys Gly
115 120 125
Ala Asn Val Lys Val Ala Val Leu Asp Thr Gly Ile Gln Ala Ser His
130 135 140
Pro Asp Leu Asn Val Val Gly Gly Ala Ser Phe Val Ala Gly Glu Ala
145 150 155 160
Tyr Asn Thr Asp Gly Asn Gly His Gly Thr His Val Ala Gly Thr Val
165 170 175
Ala Ala Leu Asp Asn Thr Thr Gly Val Leu Gly Val Ala Pro Ser Val
180 185 190
Ser Leu Tyr Cys Val Lys Val Leu Asn Ser Ser Gly Ser Gly Ser Tyr
195 200 205
Ser Gly Ile Val Ser Gly Ile Glu Trp Ala Thr Thr Asn Gly Met Asp
210 215 220
Val Ile Asn Met Ser Leu Gly Gly Ala Ser Gly Ser Thr Ala Met Lys
225 230 235 240
Gln Ala Val Asp Asn Ala Tyr Ala Arg Gly Val Val Val Val Ala Ala
245 250 255
Ala Gly Asn Ser Gly Ser Ser Gly Asn Thr Asn Thr Ile Gly Tyr Pro
260 265 270
Ala Lys Tyr Asp Ser Val Ile Ala Val Gly Ala Val Asp Ser Asn Ser
275 280 285
Asn Arg Ala Ser Phe Ser Ser Val Gly Ala Glu Leu Glu Val Met Ala
290 295 300
Pro Gly Ala Gly Val Tyr Ser Thr Tyr Pro Thr Asn Thr Tyr Ala Thr
305 310 315 320
Leu Asn Gly Thr Ser Met Ala Ser Pro His Val Ala Gly Ala Ala Ala
325 330 335
Leu Ile Leu Ser Lys His Pro Asn Leu Ser Ala Ser Gln Val Arg Asn
340 345 350
Arg Leu Ser Ser Thr Ala Thr Tyr Leu Gly Ser Ser Phe Tyr Tyr Gly
355 360 365
Lys Gly Leu Ile Asn Val Glu Ala Ala Ala Gln
370 375
<210> 8
<211> 1140
<212> DNA
<213> Bacillus licheniformis (Bacillus licheniformis)
<400> 8
atgatgagga agaaatcatt ttggttaggg atgctgacgg cgtttatgtt agtgtttacg 60
atggcgtttt cagatagcgc ttctgctgca caacctgcga aaaatgttga aaaagattat 120
atcgtggggt ttaaatctgg agttgaaacg gcgtctgtga aaaaagatat tattaaagaa 180
tcaggcggca aagtcgataa acagtttcgg attatcaatg ctgcgaaagc gaaacttgat 240
aaagaagcat tgaaagaagt caaaaatgat ccggatgttg cttacgtcga agaagatcat 300
gtcgcacatg cacttgctca gacggtgccg tatggcatcc ctcttatcaa agcagataaa 360
gtccaagcac aaggctttaa aggcgctaat gtcaaagtcg cggtccttga tacgggaatc 420
caagcaagtc atccggatct taatgtggtt gggggtgcgt catttgtcgc gggagaagca 480
tataatacag atggcaacgg tcatggaaca catgttgcgg gaacggtcgc agcgttagat 540
aatacgacgg gtgtgcttgg tgttgcaccg tctgtctcac tgtattgcgt gaaagtcctt 600
aattctagcg gatctggatc ttattcagga attgtgtctg gaatcgaatg ggctacaacg 660
aatggcatgg atgtcatcaa tatgagcctg ggaggcgcga gcggctctac agctatgaaa 720
caagcagtcg ataatgcgta tgcgcgcggt gttgtggtgg tcgcagctgc gggcaattca 780
ggctcatctg gcaatacgaa tacgatcggc tatccggcta aatatgattc agtcattgct 840
gtgggcgcgg tcgattctaa ttctaatcgt gcttctttta gctcagtggg cgcagaactt 900
gaagtgatgg caccgggcgc tggagtgtat agcacctatc cgacaaatac ctatgctaca 960
ctgaatggca cgtctatggc ttcacctcat gttgcaggcg ccgccgctct tatcctgagc 1020
aaacatccta atttgagcgc gagccaggtt cgtaatagac tttcttcaac agcgacgtat 1080
ttgggctcta gcttttatta tggcaaagga ctgatcaatg tcgaagcagc tgcacagtaa 1140
<210> 9
<211> 379
<212> PRT
<213> Bacillus licheniformis (Bacillus licheniformis)
<400> 9
Met Met Arg Lys Lys Ser Phe Trp Leu Gly Met Leu Thr Ala Phe Met
1 5 10 15
Leu Val Phe Thr Met Ala Phe Ser Asp Ser Ala Ser Ala Ala Gln Pro
20 25 30
Ala Lys Asn Val Glu Lys Asp Tyr Ile Val Gly Phe Lys Ser Gly Val
35 40 45
Lys Thr Ala Ser Val Lys Lys Asp Ile Ile Lys Glu Ser Gly Gly Lys
50 55 60
Val Asp Lys Gln Phe Arg Ile Ile Asn Ala Ala Lys Ala Lys Leu Asp
65 70 75 80
Lys Glu Ala Leu Lys Glu Val Lys Asn Asp Pro Asp Val Ala Tyr Val
85 90 95
Glu Glu Asp His Val Ala His Ala Leu Ala Gln Thr Val Pro Tyr Gly
100 105 110
Ile Pro Leu Ile Lys Ala Asp Lys Val Gln Ala Gln Gly Phe Lys Gly
115 120 125
Ala Asn Val Lys Val Ala Val Leu Asp Thr Gly Ile Gln Ala Ser His
130 135 140
Pro Asp Leu Asn Val Val Gly Gly Ala Ser Phe Val Ala Gly Glu Ala
145 150 155 160
Tyr Asn Thr Asp Gly Asn Gly His Gly Thr His Val Ala Gly Thr Val
165 170 175
Ala Ala Leu Asp Asn Thr Thr Gly Val Leu Gly Val Ala Pro Cys Val
180 185 190
Ser Leu Tyr Cys Val Lys Val Leu Asn Ser Ser Gly Ser Gly Ser Tyr
195 200 205
Ser Gly Ile Val Ser Gly Ile Glu Trp Ala Thr Thr Asn Gly Met Asp
210 215 220
Val Ile Asn Met Ser Leu Gly Gly Ala Ser Gly Ser Thr Ala Met Lys
225 230 235 240
Gln Ala Val Asp Asn Ala Tyr Ala Arg Gly Val Val Val Val Ala Ala
245 250 255
Ala Gly Asn Ser Gly Ser Ser Gly Asn Thr Asn Thr Ile Gly Tyr Pro
260 265 270
Ala Lys Tyr Asp Ser Val Ile Ala Val Gly Ala Val Asp Ser Asn Ser
275 280 285
Asn Arg Ala Ser Phe Ser Ser Val Gly Ala Glu Leu Glu Val Met Ala
290 295 300
Pro Gly Ala Glu Val Tyr Ser Thr Tyr Pro Thr Asn Thr Tyr Ala Thr
305 310 315 320
Leu Asn Gly Thr Ser Met Ala Ser Pro His Val Ala Gly Ala Ala Ala
325 330 335
Leu Ile Leu Ser Lys His Pro Asn Leu Ser Ala Ser Gln Val Arg Asn
340 345 350
Arg Leu Ser Ser Thr Ala Thr Tyr Leu Gly Ser Ser Phe Tyr Tyr Gly
355 360 365
Lys Gly Leu Ile Asn Val Glu Ala Ala Ala Gln
370 375
<210> 10
<211> 1140
<212> DNA
<213> Bacillus licheniformis (Bacillus licheniformis)
<400> 10
atgatgagga agaaatcatt ttggttaggg atgctgacgg cgtttatgtt agtgtttacg 60
atggcgtttt cagatagcgc ttctgctgca caacctgcga aaaatgttga aaaagattat 120
atcgtggggt ttaaatctgg agttaaaacg gcgtctgtga aaaaagatat tattaaagaa 180
tcaggcggca aagtcgataa acagtttcgg attatcaatg ctgcgaaagc gaaacttgat 240
aaagaagcat tgaaagaagt caaaaatgat ccggatgttg cttacgtcga agaagatcat 300
gtcgcacatg cacttgctca gacggtgccg tatggcatcc ctcttatcaa agcagataaa 360
gtccaagcac aaggctttaa aggcgctaat gtcaaagtcg cggtccttga tacgggaatc 420
caagcaagtc atccggatct taatgtggtt gggggtgcgt catttgtcgc gggagaagca 480
tataatacag atggcaacgg tcatggaaca catgttgcgg gaacggtcgc agcgttagat 540
aatacgacgg gtgtgcttgg tgttgcaccg tgcgtctcac tgtattgcgt gaaagtcctt 600
aattctagcg gatctggatc ttattcagga attgtgtctg gaatcgaatg ggctacaacg 660
aatggcatgg atgtcatcaa tatgagcctg ggaggcgcga gcggctctac agctatgaaa 720
caagcagtcg ataatgcgta tgcgcgcggt gttgtggtgg tcgcagctgc gggcaattca 780
ggctcatctg gcaatacgaa tacgatcggc tatccggcta aatatgattc agtcattgct 840
gtgggcgcgg tcgattctaa ttctaatcgt gcttctttta gctcagtggg cgcagaactt 900
gaagtgatgg caccgggcgc tgaagtgtat agcacctatc cgacaaatac ctatgctaca 960
ctgaatggca cgtctatggc ttcacctcat gttgcaggcg ccgccgctct tatcctgagc 1020
aaacatccta atttgagcgc gagccaggtt cgtaatagac tttcttcaac agcgacgtat 1080
ttgggctcta gcttttatta tggcaaagga ctgatcaatg tcgaagcagc tgcacagtaa 1140
<210> 11
<211> 25
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 11
gctctagaat gatgaggaag aaatc 25
<210> 12
<211> 29
<212> DNA
<213> Artificial Sequence (Artificial Sequence)
<400> 12
cgcggatcct tactgtgcag ctgcttcga 29
Claims (7)
1. A protease mutant BLAPR2 with improved thermostability, having an amino acid sequence as set forth in SEQ ID NO: 5, the nucleotide sequence of the coding gene is shown as SEQ ID NO: and 6.
2. A recombinant expression vector comprising a gene encoding the protease mutant of claim 1.
3. A genetically engineered bacterium comprising a gene encoding the protease mutant of claim 1, wherein the genetically engineered bacterium is Bacillus subtilis or Bacillus licheniformis.
4. The method for producing the protease mutant according to claim 1, comprising the steps of:
1) constructing recombinant gene engineering bacteria: connecting the coding gene of the protease mutant to a pUB110 vector, transforming the recombinant vector into bacillus subtilis, and screening positive clones by using a resistance marker;
2) shaking flask fermentation of recombinant gene engineering bacteria: inoculating the positive clone which is verified to be correct into a shake flask for fermentation, carrying out shake culture, and fermenting to generate a protease mutant;
3) amplifying and fermenting the recombinant strain: inoculating the gene engineering strain expressing the protease mutant into a fermentation tank, thereby producing the protease mutant BLAPR2 through fermentation.
5. The method for preparing the protease mutant according to claim 4, wherein the fermentation medium of step (3) comprises the following components: 5-10% of soybean meal, 1-5% of corn flour, 1-1.0% of PPG-200000.1, 0.1-1.0% of protease, 0.1-1.0% of amylase and 0.2-0.5% of disodium hydrogen phosphate by mass ratio.
6. Use of the protease mutant according to claim 1 for the preparation of feed additives and food additives.
7. Use of the protease mutant according to claim 1 for the preparation of detergents.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202210237403.2A CN114561375B (en) | 2020-04-27 | 2020-04-27 | Protease mutant BLAPR2 with improved thermal stability, and encoding gene and application thereof |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202210237403.2A CN114561375B (en) | 2020-04-27 | 2020-04-27 | Protease mutant BLAPR2 with improved thermal stability, and encoding gene and application thereof |
CN202010342863.2A CN111549018B (en) | 2020-04-27 | 2020-04-27 | Protease mutant with improved thermal stability as well as coding gene and application thereof |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202010342863.2A Division CN111549018B (en) | 2020-04-27 | 2020-04-27 | Protease mutant with improved thermal stability as well as coding gene and application thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN114561375A true CN114561375A (en) | 2022-05-31 |
CN114561375B CN114561375B (en) | 2023-11-14 |
Family
ID=71998466
Family Applications (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202210237401.3A Active CN114591935B (en) | 2020-04-27 | 2020-04-27 | Protease mutant BLAPR3 with improved thermal stability, and encoding gene and application thereof |
CN202010342863.2A Active CN111549018B (en) | 2020-04-27 | 2020-04-27 | Protease mutant with improved thermal stability as well as coding gene and application thereof |
CN202210237404.7A Active CN114517192B (en) | 2020-04-27 | 2020-04-27 | Protease mutant BLAPR1 with improved thermal stability, and encoding gene and application thereof |
CN202210237403.2A Active CN114561375B (en) | 2020-04-27 | 2020-04-27 | Protease mutant BLAPR2 with improved thermal stability, and encoding gene and application thereof |
Family Applications Before (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202210237401.3A Active CN114591935B (en) | 2020-04-27 | 2020-04-27 | Protease mutant BLAPR3 with improved thermal stability, and encoding gene and application thereof |
CN202010342863.2A Active CN111549018B (en) | 2020-04-27 | 2020-04-27 | Protease mutant with improved thermal stability as well as coding gene and application thereof |
CN202210237404.7A Active CN114517192B (en) | 2020-04-27 | 2020-04-27 | Protease mutant BLAPR1 with improved thermal stability, and encoding gene and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (4) | CN114591935B (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2023225459A2 (en) | 2022-05-14 | 2023-11-23 | Novozymes A/S | Compositions and methods for preventing, treating, supressing and/or eliminating phytopathogenic infestations and infections |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN112574978B (en) * | 2021-01-19 | 2021-08-17 | 青岛尚德生物技术有限公司 | Protease mutant capable of improving alcohol-soluble protein degradation capacity and coding gene and application thereof |
CN114107266B (en) * | 2021-11-29 | 2023-11-14 | 青岛尚德生物技术有限公司 | Protease mutant with improved heat resistance, encoding gene and application thereof |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106795507A (en) * | 2014-10-30 | 2017-05-31 | 诺维信公司 | Ease variants and the polynucleotides encoded to it |
CN108359659A (en) * | 2018-02-06 | 2018-08-03 | 横琴仲泰生物医药有限公司 | A kind of alkali protease BmP mutant and its encoding gene that thermal stability is high |
CN108570461A (en) * | 2018-04-17 | 2018-09-25 | 横琴仲泰生物医药有限公司 | A kind of alkali protease BmP mutant and its encoding gene improving Rate activity |
US20200071687A1 (en) * | 2015-07-06 | 2020-03-05 | Uvic Industry Partnerships Inc. | Subtilisin variants and uses thereof |
Family Cites Families (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5340735A (en) * | 1991-05-29 | 1994-08-23 | Cognis, Inc. | Bacillus lentus alkaline protease variants with increased stability |
CA2290074A1 (en) * | 1997-05-12 | 1998-11-19 | Thermogen, Inc. | Method for the stabilization of proteins and the thermostabilized alcohol dehydrogenases produced thereby |
EP3448991A4 (en) * | 2016-04-27 | 2019-12-25 | Bioresource International | Thermostable protease and methods of making and using the same |
CN107828765B (en) * | 2017-11-01 | 2020-05-08 | 江南大学 | Keratinase mutant with improved thermal stability and application thereof |
CN110577939B (en) * | 2018-06-07 | 2021-01-26 | 青岛红樱桃生物技术有限公司 | Glucose oxidase mutant with improved heat resistance as well as coding gene and application thereof |
CN110923221B (en) * | 2019-12-13 | 2021-10-22 | 中国科学院天津工业生物技术研究所 | Alkaline protease high-temperature mutant from bacillus licheniformis |
-
2020
- 2020-04-27 CN CN202210237401.3A patent/CN114591935B/en active Active
- 2020-04-27 CN CN202010342863.2A patent/CN111549018B/en active Active
- 2020-04-27 CN CN202210237404.7A patent/CN114517192B/en active Active
- 2020-04-27 CN CN202210237403.2A patent/CN114561375B/en active Active
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106795507A (en) * | 2014-10-30 | 2017-05-31 | 诺维信公司 | Ease variants and the polynucleotides encoded to it |
US20200071687A1 (en) * | 2015-07-06 | 2020-03-05 | Uvic Industry Partnerships Inc. | Subtilisin variants and uses thereof |
CN108359659A (en) * | 2018-02-06 | 2018-08-03 | 横琴仲泰生物医药有限公司 | A kind of alkali protease BmP mutant and its encoding gene that thermal stability is high |
CN108570461A (en) * | 2018-04-17 | 2018-09-25 | 横琴仲泰生物医药有限公司 | A kind of alkali protease BmP mutant and its encoding gene improving Rate activity |
Non-Patent Citations (2)
Title |
---|
RAMNANI,P ET AL.: "keratinase[Bacillus licheniformis]", GENBANK:AAS86761.1 * |
杨锦DENG: "短小芽孢杆菌碱性蛋白酶基因的随机突变", 应用与环境生物学报, no. 01, pages 98 - 101 * |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2023225459A2 (en) | 2022-05-14 | 2023-11-23 | Novozymes A/S | Compositions and methods for preventing, treating, supressing and/or eliminating phytopathogenic infestations and infections |
Also Published As
Publication number | Publication date |
---|---|
CN114591935B (en) | 2023-06-20 |
CN111549018B (en) | 2022-05-20 |
CN114517192A (en) | 2022-05-20 |
CN114517192B (en) | 2023-06-23 |
CN114561375B (en) | 2023-11-14 |
CN111549018A (en) | 2020-08-18 |
CN114591935A (en) | 2022-06-07 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN111549018B (en) | Protease mutant with improved thermal stability as well as coding gene and application thereof | |
CN112574978B (en) | Protease mutant capable of improving alcohol-soluble protein degradation capacity and coding gene and application thereof | |
WO2022134236A1 (en) | Alkaline protease mutant, gene thereof, engineering bacteria thereof, preparation method therefor and use thereof | |
KR102183558B1 (en) | Gene encoding L-alanyl-L-glutamine biosynthetic enzyme and use thereof | |
CN114480352B (en) | Alkaline protease mutant and application thereof | |
CN114107266B (en) | Protease mutant with improved heat resistance, encoding gene and application thereof | |
CN112522173B (en) | Engineering bacterium for producing heterologous alkaline protease and construction method thereof | |
CN110982807B (en) | High-efficiency stable cellulase mutant | |
CN108004220B (en) | Alkaline protease BmP mutant for improving thermal stability and gene and application thereof | |
CN108441489B (en) | Protein production method and bacillus subtilis for high-yield production of alkaline protease | |
CN111893126A (en) | Alkaline protease gene, alkaline protease, preparation method and application thereof | |
CN114540330A (en) | Alkaline protease mutant AprBpM and application thereof | |
CN113699138A (en) | Alkaline protease gene, hybrid promoter, recombinant expression vector, recombinant expression engineering bacterium, alkaline protease, method and application | |
CN110042092B (en) | Xylanase mutant with improved stability and coding gene and application thereof | |
CN114774396B (en) | Keratinase mutant, compound preparation of keratinase mutant and bile acid and application of compound preparation in additive | |
CN110656100A (en) | Heat-resistant acidic beta-mannase derived from bacillus amyloliquefaciens and coding gene thereof | |
CN115074347A (en) | Feed additive containing keratinase mutant and bile acid and application thereof | |
CN111944790B (en) | Neutral protease gene, neutral protease, preparation method and application thereof | |
CN110878293B (en) | Application of bacillus licheniformis with deletion of yceD gene in production of heterologous protein | |
CN116790564A (en) | Heat-resistant protease mutant and encoding gene and application thereof | |
CN114058606A (en) | Application of bacillus licheniformis with deleted xpt gene in production of heterologous protein | |
CN114350643B (en) | Recombinant strain for producing aminopeptidase and application of recombinant strain in efficient proteolysis | |
CN115851787B (en) | Leucine aminopeptidase producing gene, bacillus subtilis, construction method and application | |
CN117904082A (en) | Protease with improved acid resistance, mutant and application thereof | |
CN115125248B (en) | Combined promoter pctsR-alpha 2 and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
TA01 | Transfer of patent application right | ||
TA01 | Transfer of patent application right |
Effective date of registration: 20230104 Address after: 266000 Qingdao Cross Strait Agricultural Cooperation Pilot Zone, Qingdao, Shandong Province (Dongwangfuzhuang Village, Nancun Town, Pingdu City) Applicant after: QINGDAO GENYUAN BIOLOGICAL TECHNOLOGY GROUP Co.,Ltd. Address before: 266000 No. 777, Huadong Road, high tech Zone, Qingdao, Shandong Province Applicant before: QINGDAO SHANGDE BIOTECHNOLOGY Co.,Ltd. Applicant before: QINGDAO RED CHERRY BIOTECHNOLOGY Co.,Ltd. |
|
GR01 | Patent grant | ||
GR01 | Patent grant |