CN113106110A - SiSD1 gene, application thereof in controlling millet plant height character and genotype identification method - Google Patents

Abstract

The invention belongs to the technical field of plant genetic engineering and molecular breeding, and particularly relates to a SiSD1 gene, application thereof in controlling the plant height character of millet and a genotype identification method. The gene SiSD1 related to the height of the millet strain is obtained by first cloning, the nucleotide sequence of the gene SiSD1 is shown as SEQ ID No _1, and the protein sequence is shown as SEQ ID No _ 2. The SiSD1 gene can control the height of millet plants, the millet varieties with the gene show a high stalk character, and the SiSD1 gene is mutated to reduce the height of the millet plants. The invention also provides a simple, rapid and low-cost method for detecting the functional molecular marker of SiSD 1. The SiSD1 gene and the detection method thereof can be used for breeding new varieties of millet with high stalk character, and have important significance for agricultural production.

Description

SiSD1 gene, application thereof in controlling millet plant height character and genotype identification method

Technical Field

The invention belongs to the technical field of plant genetic engineering and molecular breeding, and particularly relates to a SiSD1 gene, application thereof in controlling the plant height character of millet and a genotype identification method.

Background

The dwarf breeding of crops such as wheat and rice is realized in sequence since the 60s in the 20 th century, the crop yield is greatly improved, and the method makes a great contribution to solving the problem of global hunger. Dwarf breeding of wheat is achieved mainly by virtue of two dwarf genes of Rht-B1B and Rht-D1B of agriculture and forestry No. 10, which are homologous genes of Arabidopsis GAI and encode gibberellin signal-transduced DELLA proteins (Peng J, Richards DE, Hartley NM, Murphy GP, Devos KM, Flintham JE, metals J, Fish LJ, Worland AJ, Pelica F, Sudhakar D, Chutou P, Snape JW, Gale MD, Harberd NP. 'Green recovery' genes amino mutant gibberellin responses. Nature,1999, 400(6741): 256-261). Similarly, rice dwarf breeding is achieved by synthesizing a key gene Semi-dwarf 1(SD1) encoding gibberellin biosynthesis key enzyme GA20ox2, which results in significant reduction in rice plant height after loss of function, and most dwarf indica varieties contain the SD1 gene (Sasaki A, Ashikari M, Ueguchi-Tanaka M, Itoh H, Nishimura A, Swapan D, Ishiyama K, Saito T, Kobayashi M, Khush GS, Kitano H, Matsuoka M.Green revation: a mutant gibberella-synthesis gene in rice plant Nature.Nature, 2002, 416(6882): 701-702). At present, the mutant allele of SD1 still remains the main gene for breeding rice semi-dwarf traits (Liu C, Zheng S, Gui J, Fu C, Yu H, Song D, Shen J, Qin P, Liu X, Han B, Yang Y, Li L. short basic intermediates a gibberella 2-oxidase and copolymers to a lodging resistance in rice molecular Plant,2018,11(2): 288-. At present, at least 18 genes of the rice dwarf are located, and the genes are mainly related to biosynthesis and signal transduction of hormones such as gibberellin, brassinolide and strigolactone (http:// www.ricedata.cn/gene/gene _ sd.htm).

Millet (Setaria italica) originates from China and is a main cultivated crop and a nursing crop of Chinese nationality for thousands of years. In recent years, millet is favored with the increasing life of people and the diversification and nutrition of food. The millet variety popularized in production has high plant height, the yield of the millet with high plant height is low, and the development of the millet industry is seriously limited, so that the dwarf breeding of the millet is necessary. As early as 1998, Chenjingui, etc. have studied the reaction of 3 dwarf rice mutants to gibberellin and laid the foundation for the cloning of dwarf rice gene (Chenjingui, Zhangzong, Zhouyuan, Zhouyu Geng. identification of gibberellin reaction sensitive and insensitive millet dwarf mutants, North China agricultural article, 1998,12(1): 46-52). In 2013, Prime, Ministry of crop science, China agricultural academy of sciences, clones a semi-dominant dwarf gene SiDw1 from dwarf mutant 84133, belongs to the DELLA protein gene of GRAS family, and has high homology with GAI/RGA of Arabidopsis, SLRl of rice, D8 of corn and Rht of wheat. Nevertheless, the cloning of the dwarfing gene of millet and the dwarfing molecular breeding are still far behind those of rice and wheat, and the cloning of the millet dwarf gene and the application thereof in the dwarfing breeding of millet have extremely important significance for the healthy development of the millet industry.

The enzyme-digested Amplified Polymorphic Sequences (CAPS) is a simple, economic and reliable co-dominant molecular marker, and the principle is that a certain DNA fragment on the site is Amplified by utilizing a PCR technology; the amplified band was then cleaved with a specific restriction enzyme and subjected to RFLP analysis (Konieczny A, Ausubel FM. adaptor for mapping Arabidopsis tissues using co-dominant PCR-based markers. plant Journal, 1993,4(2): 403-. As with RFLP technology, polymorphisms detected by CAPS technology are actually differences in size of cleaved fragments. As a combination technology of specific primer PCR and restriction enzyme digestion, CAPS marks have the following advantages: first, there are very many combinations of primers and restriction enzymes, which makes the polymorphism higher; secondly, the CAPS marker is a codominant marker, namely, the homozygous genotype and the heterozygous genotype can be distinguished; third, the amount of DNA required is less; fourthly, because the specific primer amplification is carried out, the annealing temperature of the conventional PCR is used, the result is stable and reliable, the repeatability is high, and the data exchange among different laboratories is facilitated; and fifthly, CAPS can be analyzed by agarose gel electrophoresis without isotope labeling, and the method is simple and convenient to operate, high in automation degree, low in cost and convenient to popularize and use in developing countries. Due to the advantages, the CAPS marker is widely applied to theoretical research and molecular marker-assisted selective breeding.

Therefore, it is necessary to develop a genetic marker related to the improvement of the plant type of millet, but no technique for identifying the plant height related genotype of millet is available at present.

Disclosure of Invention

In order to solve the technical problems, the invention provides a SiSD1 gene, application thereof in controlling the height character of millet plants and a genotype identification method.

The first purpose of the invention is to provide a SiSD1 gene related to the high character of a millet plant, wherein the nucleotide sequence of the SiSD1 gene is shown as SEQ ID No _1, and the sequence of the protein coded by the SiSD1 gene is shown as SEQ ID No _ 2.

The second purpose of the invention is to provide the application of the SiSD1 gene in controlling the plant height trait of millet.

Preferably, the SiSD1 gene is used for controlling the height character of millet plants, and the SiSD1 gene is used for breeding plants with long-stalk or short-stalk characters.

Preferably, the SiSD1 gene is used for controlling the plant height trait of millet, and the plants include, but are not limited to, Arabidopsis thaliana, rice and millet.

Preferably, the SiSD1 gene is used for controlling the plant height of the millet, and the SiSD1 target gene is transferred into dwarf millet varieties by using a conventional crossbreeding technology, so that the SiSD1 target gene is over-expressed in plants, high-stalk plants are obtained, and the plant height of the plants is improved;

or editing SiSD1 by using a gene editing method or reducing the expression of SiSD1 gene by using RNAi, and using the SiSD1 gene to breed dwarf millet germplasm;

wherein, the SiSD1 target gene is the sequence shown by SEQ ID No _1 and SEQ ID No _2, or the sequence with more than 90% homology with SEQ ID No _1 or SEQ ID No _ 2.

Preferably, the SiSD1 gene is used for controlling the plant height trait of the millet, and the mutation site of the SiSD1 gene is 2266 th site of the third exon, so that a molecular marker for identifying the plant height of the millet is developed and used for dwarf breeding of the millet.

The third purpose of the invention is to provide a method for identifying the SiSD1 genotype, extracting the genome DNA of the sample to be detected, designing a primer according to the nucleotide sequence shown in SEQ ID No _1 for PCR amplification, if the electrophoresis detects an amplification product band with the same size as the SEQ ID No _1 fragment, and the fragment obtained by carrying out PCR amplification on the genome DNA by using the primers SiSD1NciIF and SiSD1NciIB can be cut into three fragments of 61, 117 and 304bp after NciI enzyme digestion, the sample to be detected is provided with the SiSD1 gene;

wherein, the nucleotide sequences of SiSD1NciIF and SiSD1NciIB are respectively shown in SEQ ID No _5 and SEQ ID No _ 6; the length of the PCR amplified fragment is 482bp, and the nucleotide sequence is shown in SEQ ID No _ 7.

The fourth purpose of the invention is to provide an application of the genotype identification method in plant germplasm resource improvement.

Preferably, in the above applications, the technical means for improving plant germplasm resources includes, but is not limited to, molecular marker assisted breeding.

Compared with the prior art, the invention has the following beneficial effects:

the invention uses a Super-BSA method based on high-throughput sequencing to position the millet semi-dwarf gene SiSD1 and obtain the allelic mutant gene SiSD 1. The gene can control the height character of the millet plants and is used for breeding long-stalk or short-stalk character plants, and the gene SiSD1 and the allele SiSD1 thereof and CAPS molecular marker have important practical significance in the aspects of dwarf breeding and genetic improvement of the millet, and have wide application and market prospect in the agricultural field.

Drawings

FIG. 1 shows the grain phenotype and plant height statistics of dwarf millet variety S2 and tall millet variety in example 1 of the present invention;

a: s2 (left) and wine grains (right) planted in the field; b: s2 and calculating the plant height of the wine grain, wherein 40 plants are calculated for each variety, and the average value is obtained;

FIG. 2 is F of example 2 of the present invention₂A generation hybrid population plant height statistical chart;

FIG. 3 is a Venn diagram of SNP statistics between a high stalk extreme mixed pool and a low stalk extreme mixed pool and parents according to example 4 of the present invention;

FIG. 4 is an InDel statistical Venn diagram of the high stalk extreme mixed pond and the low stalk extreme mixed pond and between parents according to example 5 of the present invention;

FIG. 5 shows the distribution of ED correlation values of SNPs in example 6 of the present invention on chromosomes;

FIG. 6 is the distribution of ED correlation values on chromosomes for InDel in example 7 of the present invention;

FIG. 7 shows SiSD1 gene mutation of dwarf millet variety S2 in example 8 of the present invention;

a: the comparison condition of SiSD1 gene re-sequencing Reads and a reference genome, wherein a middle base G is a base deleted from S2; b: the structure of the SiSD1 allele SiSD1 gene in S2;

FIG. 8 is a schematic diagram of CAPS molecular marker SiSD1NciI amplification sites in example 9 of the present invention.

Detailed Description

In order that those skilled in the art will better understand the technical solutions of the present invention to be implemented, the present invention will be further described with reference to the following specific embodiments and accompanying drawings.

The methods used in the following examples are conventional methods unless otherwise specified, and the primers used are synthesized by Biotechnology engineering (Shanghai) Ltd; the high-efficiency plant genome DNA extraction kit is purchased from Tiangen Biochemical technology (Beijing) Co., Ltd., Cat number DP 350.

Example 1 analysis of plant height of millet dwarf germplasm S2 (existing address: Shanxi university of agriculture in Taigu area of Shanxi province, acquisition time: 2015 years) and high-straw germplasm wine

The dwarf millet germplasm S2 and the tall millet germplasm wine are planted in the coarse cereal team test field (Taigu area in Shanxi province) of Shanxi agriculture university in the season, and the water and fertilizer are normally managed. As shown in FIG. 1A, dwarf millet S2 has a short plant height, while wine millet has a significantly higher plant height than S2. The S2 and the grain plant height were measured, and 40 plants were determined for each variety. S2 has an average plant height of 98.0cm, a minimum plant height of 58.2cm and a maximum plant height of 119.8 cm; the average plant height of the wine grain is 176.80 cm, the minimum plant height is 147.8cm, and the maximum plant height is 200.1cm (figure 1B). The difference between the average plant height of S2 and the average plant height of wine grains is 78.8 cm.

Example 2 construction and plant height analysis of a millet dwarf gene localization population S2X wine grain

Hybridizing the dwarf millet S2 serving as a female parent and the wine grain serving as a male parent to obtain F₂Generation hybrid seeds. 5.5.2017, and F₂The generation hybrid seeds are planted in a coarse cereal team test field of Shanxi agricultural university, and the planting density is about 35cm of row spacing and about 30cm of plant spacing. And (4) normal water and fertilizer management, and measuring the plant height (the height from the base of the plant to the top of the spike) after the plant is matured. 568 strains of F were counted₂The generation plant height is 138.2cm, the lowest plant height is 72.4cm, the highest plant height is 195.3cm, F₂The statistical chart of plant heights of the generation group is shown in figure 2.

Example 3 high throughput sequencing and analysis of two extreme pools and parents

From S2X wine grain F₂In the population, 30 short-stalk plants and 30 long-stalk plants are selected, and healthy single leaves are respectively taken to extract genome DNA. The extraction of the genome DNA adopts an efficient plant genome DNA extraction kit, and the extraction operation is strictly carried out according to the method provided by the kit. Mixing single DNA of 30 short-stalk extreme groups in equal quantity to construct a short-stalk extreme mixing pool; the single DNA of 30 high-stalk extreme groups are mixed in equal amount to construct a high-stalk extreme mixing pool. The genomic DNA of the two pools and the genomic DNA of S2 and wine grains were then used for library construction and genomic sequencing, respectively. The construction and high-throughput sequencing of the library are completed by Beijing Baimaike Biotechnology GmbH, and the construction and sequencing of the library are strictly carried out according to a standard method provided by Illumina: randomly breaking 5 mu g of genome DNA for fragmentation; and (3) recovering DNA fragments with required lengths by electrophoresis, repairing the tail ends, adding a linker to prepare a double-ended sequencing library, and performing high-throughput sequencing by using an Illumina HiSeq sequencing platform.

The original image data file obtained by high-throughput sequencing is converted into an original sequencing sequence (sequential Reads) through Base recognition (Base Calling) analysis, namely Raw Reads. The Raw Reads are filtered to remove impurities, and 16.43G, 17.00G, 18.32G and 18.60G of high-quality bases are obtained from a high-stalk extreme mixed pool, a low-stalk extreme mixed pool, S2 and wine grains respectively, and sequencing depths are 33X, 39X and 40X respectively, and the results are shown in Table 1.

TABLE 1 extreme Mixed pool and parental high throughput sequencing data statistics

Example 4 SNP detection of extremely Mixed pools and parents

Firstly, comparing the re-sequencing data of the dwarf extreme mixing pool, the high stalk extreme mixing pool and parents S2 and the wine valley with a Yugu No. 1 reference genome (https:// phytozome.jgi.doe.gov/pz/portal.html #. infoaliases: Org _ Silica) by using BWA software (Li H, Durbin R.fast and acid short read alignment with Burrows wheel transform. Bioinformatics,2009,25: 1754-; then, according to the positioning result of the Clean Reads on the reference genome, Picard (https:// source. net/projects/Picard /) is used for carrying out the de-duplication, and the influence of PCR duplication is shielded; finally, Single Nucleotide Polymorphism (SNP) detection was performed using the GATK software (McKenna A, Hanna M, Bank E, Sivachenko A, Cibuteskis K, Kernytsky A, Garimella K, Altsuhler D, Gabriel S, Daly M, DePrist MA. the Genome Analysis Toolkit: a MapReduce frame for analyzing the next generation DNA sequencing data. Genome Research,2010,20: 1297-. Further filtering the SNPs to filter out 2390 SNs with multiple genotypesP locus, 33196 SNP loci with read support degree less than 4, 385618 SNP loci with consistent genotypes among mixed pools and 283445 SNP loci with recessive mixed pool genes not from recessive parents. Finally obtaining 890565 high-quality credible SNP sites which are used for the next step of millet S2 x wine millet F₂And (4) performing association analysis on the plant height traits of the population. FIG. 3 is Venn diagram of SNP statistics between high stalk extreme mixed pool and short stalk extreme mixed pool and parents.

Example 5 InDel detection of extreme Mixed cells and parents

And detecting whether InDel exists between the sample and the reference genome according to the positioning result of the clear Reads of the sample on the reference genome. InDel detection of samples was performed using GATK software. 280610 InDel sites are detected among samples, before correlation analysis is carried out by using InDel, the InDel is firstly filtered, the filtering standard is the same as that of SNP analysis, and 157598 high-quality credible InDel sites are finally obtained (figure 4). InDel variation is generally less than SNP variation, but again reflects differences between the sample and reference genomes, and InDel of coding regions causes frameshift mutations, resulting in changes in gene function.

Example 6S 2X wine grain F₂SNP marker ED correlation analysis of hybrid population plant height gene

The correlation of the plant height genes of the S2 Xwine and valley hybrid population is carried out by adopting an Euclidean Distance (ED) algorithm. The ED algorithm is a method for using sequencing data to find a significant difference mark between pools and evaluate a region associated with a trait (Hill JT, Demarest BL, Bisgrove BW, Gorsi B, Su YC, Yost HJ. MMAPPR: mutation mapping analysis pipeline for porous RNA-seq. Genome Research,2013,23(4): 687-97). Theoretically, except for the difference of target character related sites between the constructed high stalk extreme mixed pool and the constructed low stalk extreme mixed pool, other sites tend to be consistent, so the ED value of a non-target site tends to be 0. A larger ED value indicates a larger difference between the two pools. In order to eliminate the background noise, the original ED value is subjected to power processing, the 5 th power of the original ED is taken as a correlation value to achieve the function of eliminating the background noise, and then the ED value is fitted by a DISTANCE method, and the distribution of the correlation values is shown in fig. 5. The abscissa of fig. 5 is a chromosome name, gray dots represent ED values of each SNP site, a solid line with non-coordinate axes is an ED value after fitting, a dotted line represents a significant association threshold, and a higher ED value represents a better association effect of the dot.

Taking mean +3SD of all site fitting values as correlation threshold of analysis, calculating to be 0.36. According to the judgment of the correlation threshold, the plant height related gene is positioned in an interval of Scaffold 539110000-44720000 bp. The total length of the interval is 5.61Mb, and comprises 1022 genes.

Example 7S 2X wine grain F₂InDel marker ED correlation analysis of hybrid population plant height genes

The InDel association analysis used the same analysis method (ED method) as the SNP association analysis, and the distribution of association values is shown in FIG. 6. The abscissa of fig. 6 is the chromosome name, the gray points represent the ED value of each InDel locus, the solid line with non-coordinate axes is the fitted ED value, the dashed line represents the significance correlation threshold, and the higher the ED value, the better the correlation effect of the point.

Taking mean +3SD of all site fitting values as correlation threshold of analysis, calculating to be 0.42. The plant height related gene is positioned in an interval of Scaffold 537980000 and 44630000 bp. The total length of this interval is 6.65Mb, including 1194 genes.

Example 8S 2X analysis of plant height-related genes of the wine grain F2 population

Intersection sets are taken for the corresponding associated regions of the SNP and InDel in the embodiment 6 and the embodiment 7, and finally the related gene of the plant height of the S2 XJiugu F2 population is positioned in a 4.27 Mb region between 40360000-44630000bp on the 5 th chromosome, and the region has 767 genes. In-depth analysis shows that 40 genes in the 767 genes have nonsynonymous mutation among parents, wherein 37 SNP mutations occur, and 6 InDel mutations occur. The dwarf S2 genome Scaffold 543166915 bp of base G is deleted, and 32 sequencing Reads are covered at the position, so that the reliability is very high (FIG. 7A). This deletion of the base resulted in a frameshift mutation and premature termination of the millet Seita.5G404900 gene, with 83 amino acids deleted (FIG. 7B). The Seita.5G404900 gene codes a key enzyme GA20ox2 for gibberellin synthesis, and the functional deficiency can cause the gibberellin biosynthesis to be blocked, so that the plant height of the millet is reduced. Sequence analysis shows that the Seita.5G404900 gene and the rice semi-dwarf gene OsSD1(LOC _ Os01g66100) are homologous genes. Thus, it was named as SiSD1, and the mutant gene (allele) in S2 was named as SiSD 1.

The sequence of the SiSD1 gene has a total length of 2900bp, and comprises a 5 ' UTR region with 155 bases, an open reading frame from 156 th to 2525 th bases at the 5 ' end, and a 3 ' UTR region from 2526 th to 2900 th bases. The 156-th and 808-th bases from the 5 ' end are the first exon of the gene, the 809-th and 903-th bases from the 5 ' end are the first intron, the 904-th and 1225-th bases from the 5 ' end are the second exon, the 1226-th and 2228-th bases from the 5 ' end are the second intron, the 2229-th and 2525-th bases from the 5 ' end are the third exon, and the 2526-th and 2900-th bases from the 5 ' end are the 3 ' noncoding region. The nucleotide sequence of the SiSD1 gene is shown as SEQ ID No _1, and the protein sequence coded by the SiSD1 gene is shown as SEQ ID No _ 2.

The allele SiSD1 of the SiSD1 gene lacks the G base at position 2266 of the third exon (corresponding to the wireframe part of the nucleotide sequence shown in SEQ ID No _ 1), resulting in frame shift mutation and premature termination, the nucleotide sequence of the SiSD1 gene is shown in SEQ ID No _3, and the protein sequence coded by the SiSD1 gene is shown in SEQ ID No _ 4.

Example 9 development and application of CAPS markers of SiSD1 and SiSD1 genes

The invention utilizes CAPS technology to rapidly identify the allele of the millet semi-dwarf gene SiSD1, in particular the SiSD1 gene. Deletion of base G in allele sisd1 resulted in deletion of the NciI cleavage site at that position, so that this mutation could be detected by NciI cleavage. First, PCR primers SiSD1NciIF (SEQ ID No _5) and SiSD1NciIB (SEQ ID No _6) were designed, both located on the second intron and the third exon, respectively (FIG. 8).

Respectively mixing S2, wine grain and S2X wine grain F₁The genomic DNA of the generation was used as a template, and PCR amplification was carried out using primers SiSD1NciIF and SiSD1 NciIB. The PCR amplification system is as follows: 15ng template DNA, 5pmol/L forward primer, 5pmol/L reverse primer, 5. mu.l 2 XTAQQ PCR Stamix, ddH₂O was supplemented to 10. mu.l.The PCR amplification procedure was as follows: pre-denaturation at 95 ℃ for 5 min; denaturation at 95 ℃ for 30s, renaturation at 60s for 45s, extension at 72 ℃ for 30s, and 35 cycles; extending for 5min at 72 ℃; storing at 4 ℃.

Theoretically, the length of the grain PCR amplification fragment is 482bp (SEQ ID No _7), and the molecular marker is marked as SiSD1NciI-1 and is used for identifying varieties of the high-stalk grains; the length of a PCR amplified fragment is 481bp (SEQ ID No _8) due to the deletion of a single base in S2, and the molecular marker is marked as SiSD1NciI-2 and is used for identifying dwarf millet varieties; and S2X wine grain F₁Two fragments of 482 and 481bp should be amplified. However, the two fragments are only 1bp in length and cannot be distinguished by agarose gel electrophoresis. After the PCR fragment is cut by NciI enzyme, the wine grain can be cut into three fragments of 61 bp, 117 bp and 304 bp; s2 can be cut into two fragments of 117 bp and 364bp due to the deletion of the base G (the deletion of a single base G in the sisd1 gene leads to the deletion of the NciI enzyme cutting site at the position); S2X wine grain F₁Four fragments of 61, 117, 304 and 364bp can be cut. Therefore, SiSD1NciI is a codominant molecular marker, which can not only identify whether the SiSD1 gene is mutated, but also detect whether the mutation site is homozygous or heterozygous.

It should be noted that, when the present invention relates to a numerical range, it should be understood that two endpoints of each numerical range and any value between the two endpoints can be selected, and since the steps and methods adopted are the same as those in the embodiment, in order to prevent redundancy, the present invention describes a preferred embodiment. While preferred embodiments of the present invention have been described, additional variations and modifications in those embodiments may occur to those skilled in the art once they learn of the basic inventive concepts. Therefore, it is intended that the appended claims be interpreted as including preferred embodiments and all such alterations and modifications as fall within the scope of the invention.

It will be apparent to those skilled in the art that various changes and modifications may be made in the present invention without departing from the spirit and scope of the invention. Thus, if such modifications and variations of the present invention fall within the scope of the claims of the present invention and their equivalents, the present invention is also intended to include such modifications and variations.

Sequence listing

The nucleotide sequence of the gene of SEQ ID No _1, SiSD1, whose base at position 2266 (boxed) is the base from which the allele SiSD1 is deleted:

ATGGCCTCCCCTGTGGGGCGGGTCCCACATGAGGTAGCAAATGTTTCCTCCTTCCCTTGTTTCTGTCGT TGCTCGCGAACTCCCCCTCCTCCCCTGCTACAAATACCCCCACCGGCCCGGACAGGTCTCCTGCACAC TCGCAGCTCGCACATCTCATGGTGTCCCAAGCACAGCAAGAGCCAGCTCTGCCTCACAGCAGCAGCA CCGCCAAGCGCGCAGCCGCGTCACTCATGGACGCCCGCCCGGCCCAGCCTCTCCTCCTCCGCGCCCC GACTCCCAGCATTGACCTCCCCGCGTCCAAGCCGGACAGGGCCGCCGCGGCGGCCGGCAAGGCCGC CGCCGCCTCCGTGTTCGACCTGCGGCGGGAGCCCAAGATCCCGGCGCCATTCGTGTGGCCGCACGAC GACGCGCGGCCGGCGTCGGCGGCGGAGCTGGACGTGCCGTTGGTGGACGTGGGCGTGCTGCGCAAT GGCGACCGCGCGGGGCTGCGGCGCGCTGCGGCGCAGGTGGCCGCGGCGTGCGCGACGCACGGGTTC TTCCAGGTGTGCGGGCACGGCGTGGGCGCGGACCTGGCGCGCGCGGCGCTGGACGGCGCCAGTGAC TTCTTCCGGCTGCCGCTGGCGGAGAAGCAGCGCGCCCGGCGCGTCCCGGGGACCGTGTCCGGGTACA CGAGCGCGCACGCCGACCGGTTCGCGTCCAAGCTCCCCTGGAAGGAGACCCTCTCCTTCGGGTTCCA CGACGGCGCCGCGTCGCCCGTCGTCGTCGACTACTTCGCCGGCACCCTCGGGCAGGACTTCGAGGCA GTGGGGTAAGTATGTAGGAATGAACTTGGCACGCATTGCATCCACATGGCGTGCTGATCGAACGAGCT GAGCCAACCGGCATGCACACATGGCGTGGCAGGCGGGTGTACCAGAGGTACTGCGAGGAGATGAAG GCTCTGTCGCTGACGATCATGGAGCTCCTGGAGCTGAGCCTGGGCGTGGAGCGCGGCTACTACCGCG ACTTCTTCGAGGACAGCCGCTCCATCATGCGGTGCAACTACTACCCGCCGTGCCCGGAGCCGGAGCG CACGCTGGGCACGGGCCCGCACTGCGACCCCACCGCGCTGACCATCCTCCTCCAGGACGACGTCGGC GGGCTCGAGGTCCTCGTCGACGGCGACTGGCGCCCCGTCCGCCCCGTCCCCGGCGCCATGGTCATCA ACATCGGCGACACCTTCATGGTACGGCCGCCGCTAATCCATCCTTTTGTTGCTCTTATCTCCTCTGGCG AGTGCGAGTAACGAAAGCGCTAGCTCCCCTGCTCCTTGTCCTGCTCTGTTTCCCAAGTCCTAATGGAG CTAACCGGGCAGACTGCAACACGCACGCGTAGGCATGTCACGTAGCCACCACTTGCACTGTGCTGCG CAGCGACGACGCAACGCGGACGTGCGTTCGAGTCGGTTCCATCTCGGCGCCGCTACACGCGGCCGCG GCTCCTAGCCTCCTAGGGCTCCCTGATCCCTATCCCCGAGCCCTTCCGCGGGAAAAGTTCGTTGGCGA CGGCAGAGGAGAGCCGACGGGTCCGTGCCGTTGGAGCGTGGCGGCAGGAGAGGCCGGGAGGGTGT TTTGTTGCGTTGCGCGGCGGCGCGGAGGATGCGATGGCGCGGGCGGGCGGCGCTTTCGGCGGTGGCC CCCGCGACCCACGTGCGCGCGCGGTCTCGTCGCCTTCCCTGTTTTGGTGCCACCTCTCTGTGTCCGGG AATGGGTTGGCTTAGCGGCGACCGAGACCGGGCGGTGGTCTGGCCTGCTCCCGGCGCCCATCCCGCC TGGTCTCTCATCCTGCTCCTCCTATGCGCGAGGGGGCCTGTAGCGGCTGGAGTACAAGCAGATTGGTT GGGTTGGGTTGCTGCTGCTTGGCTGTTGCCCGCCCGCTTTCTAGCCGTTTCCGCTCGCCATCCGGCAC GCGGCGCCCACGCCGGGGCTCCAGCTCGGCCCCTTTGGCCGTGTGGGTGGCAGGCACCCCTGCATCG TCTCGTGCGTCCGGTTTCCGCGCCTGGCCCCCCGCCTTGAGGTTTCCCTGTGCTTTTGACAAGACTTT CGTAGATATATGTGTGTGTATGTGTGTGTGTGCGTGCGCGCGTGTGTGTATATATATATATAAATAAATAA CATCTGTGAATGATGGATTACACGTGTAGCTGACCGGCTGATTGTGTTCGCGTGTGTGTCTTCGATGCA TTGCAGGCTCTGTCCAACGGGCGGTACAAGAGCTGCCTGCACCGGGCGGTGGTGAACCAGCGGCAG GAGCGGCGGTCGCTGGCCTTCTTCCTGTGCCCGCGCGAGGACCGGGTGGTGCGCCCGCCGGCCAGCG GCGCCGTCGGCGAGGCGCCCCGCCGCTACCCGGACTTCACCTGGGCCGACCTCATGCGCTTCACGCA GCGCCACTACCGCGCCGACACCCGCACGCTGGACGCCTTCACACGCTGGCTCTCCCACGGCCCGGCC CAGGACGCGCCAGTGGCGGCGGCGGCTTCCACCTAGCTAGCGGCGCGGATCCGACCGAGCCCATTGA CGACGCCGTCCCTTTCCGCCGCCGCCGGGGCCCGCGCGGGGGTTCACCCCACGTGCGCGCCCAGGTG GGCGAGGTGGCGGCCTCGTGGCCCGCGGGCCCCGCGCCGCCTTCCCATTTTTGGGCGCTGCCGCCCC GCGCGCATGCCGGATGCGTGCGTCCACGGCCTACTGCTGCTACTAGTGTACATATACAAACATACATAT ATACGTAGTATAAATATATAAGCAAGCGGCCCGGTGCCCCTTTTCGTTTTCTTGTTTTGTCGATCACAAT CTCTGGATTCGATGGATGGATAAATGTTTGTACGCATGCATGTAGATGGGCTCATGAAATTTCAGAATC TG

SEQ ID No _2, SiSD1 protein sequence:

MVSQAQQEPALPHSSSTAKRAAASLMDARPAQPLLLRAPTPSIDLPASKPDRAAAAAGKAAAASVFDLRR EPKIPAPFVWPHDDARPASAAELDVPLVDVGVLRNGDRAGLRRAAAQVAAACATHGFFQVCGHGVGAD LARAALDGASDFFRLPLAEKQRARRVPGTVSGYTSAHADRFASKLPWKETLSFGFHDGAASPVVVDYFA GTLGQDFEAVGRVYQRYCEEMKALSLTIMELLELSLGVERGYYRDFFEDSRSIMRCNYYPPCPEPERTLGT GPHCDPTALTILLQDDVGGLEVLVDGDWRPVRPVPGAMVINIGDTFMALSNGRYKSCLHRAVVNQRQER RSLAFFLCPREDRVVRPPASGAVGEAPRRYPDFTWADLMRFTQRHYRADTRTLDAFTRWLSHGPAQDAPV AAAAST

nucleic acid sequence of allele SiSD1 of SEQ ID No _3, millet SiSD1 gene:

ATGGCCTCCCCTGTGGGGCGGGTCCCACATGAGGTAGCAAATGTTTCCTCCTTCCCTTGTTTCTGTCGT TGCTCGCGAACTCCCCCTCCTCCCCTGCTACAAATACCCCCACCGGCCCGGACAGGTCTCCTGCACAC TCGCAGCTCGCACATCTCATGGTGTCCCAAGCACAGCAAGAGCCAGCTCTGCCTCACAGCAGCAGCA CCGCCAAGCGCGCAGCCGCGTCACTCATGGACGCCCGCCCGGCCCAGCCTCTCCTCCTCCGCGCCCC GACTCCCAGCATTGACCTCCCCGCGTCCAAGCCGGACAGGGCCGCCGCGGCGGCCGGCAAGGCCGC CGCCGCCTCCGTGTTCGACCTGCGGCGGGAGCCCAAGATCCCGGCGCCATTCGTGTGGCCGCACGAC GACGCGCGGCCGGCGTCGGCGGCGGAGCTGGACGTGCCGTTGGTGGACGTGGGCGTGCTGCGCAAT GGCGACCGCGCGGGGCTGCGGCGCGCTGCGGCGCAGGTGGCCGCGGCGTGCGCGACGCACGGGTTC TTCCAGGTGTGCGGGCACGGCGTGGGCGCGGACCTGGCGCGCGCGGCGCTGGACGGCGCCAGTGAC TTCTTCCGGCTGCCGCTGGCGGAGAAGCAGCGCGCCCGGCGCGTCCCGGGGACCGTGTCCGGGTACA CGAGCGCGCACGCCGACCGGTTCGCGTCCAAGCTCCCCTGGAAGGAGACCCTCTCCTTCGGGTTCCA CGACGGCGCCGCGTCGCCCGTCGTCGTCGACTACTTCGCCGGCACCCTCGGGCAGGACTTCGAGGCA GTGGGGTAAGTATGTAGGAATGAACTTGGCACGCATTGCATCCACATGGCGTGCTGATCGAACGAGCT GAGCCAACCGGCATGCACACATGGCGTGGCAGGCGGGTGTACCAGAGGTACTGCGAGGAGATGAAG GCTCTGTCGCTGACGATCATGGAGCTCCTGGAGCTGAGCCTGGGCGTGGAGCGCGGCTACTACCGCG ACTTCTTCGAGGACAGCCGCTCCATCATGCGGTGCAACTACTACCCGCCGTGCCCGGAGCCGGAGCG CACGCTGGGCACGGGCCCGCACTGCGACCCCACCGCGCTGACCATCCTCCTCCAGGACGACGTCGGC GGGCTCGAGGTCCTCGTCGACGGCGACTGGCGCCCCGTCCGCCCCGTCCCCGGCGCCATGGTCATCA ACATCGGCGACACCTTCATGGTACGGCCGCCGCTAATCCATCCTTTTGTTGCTCTTATCTCCTCTGGCG AGTGCGAGTAACGAAAGCGCTAGCTCCCCTGCTCCTTGTCCTGCTCTGTTTCCCAAGTCCTAATGGAG CTAACCGGGCAGACTGCAACACGCACGCGTAGGCATGTCACGTAGCCACCACTTGCACTGTGCTGCG CAGCGACGACGCAACGCGGACGTGCGTTCGAGTCGGTTCCATCTCGGCGCCGCTACACGCGGCCGCG GCTCCTAGCCTCCTAGGGCTCCCTGATCCCTATCCCCGAGCCCTTCCGCGGGAAAAGTTCGTTGGCGA CGGCAGAGGAGAGCCGACGGGTCCGTGCCGTTGGAGCGTGGCGGCAGGAGAGGCCGGGAGGGTGT TTTGTTGCGTTGCGCGGCGGCGCGGAGGATGCGATGGCGCGGGCGGGCGGCGCTTTCGGCGGTGGCC CCCGCGACCCACGTGCGCGCGCGGTCTCGTCGCCTTCCCTGTTTTGGTGCCACCTCTCTGTGTCCGGG AATGGGTTGGCTTAGCGGCGACCGAGACCGGGCGGTGGTCTGGCCTGCTCCCGGCGCCCATCCCGCC TGGTCTCTCATCCTGCTCCTCCTATGCGCGAGGGGGCCTGTAGCGGCTGGAGTACAAGCAGATTGGTT GGGTTGGGTTGCTGCTGCTTGGCTGTTGCCCGCCCGCTTTCTAGCCGTTTCCGCTCGCCATCCGGCAC GCGGCGCCCACGCCGGGGCTCCAGCTCGGCCCCTTTGGCCGTGTGGGTGGCAGGCACCCCTGCATCG TCTCGTGCGTCCGGTTTCCGCGCCTGGCCCCCCGCCTTGAGGTTTCCCTGTGCTTTTGACAAGACTTT CGTAGATATATGTGTGTGTATGTGTGTGTGTGCGTGCGCGCGTGTGTGTATATATATATATAAATAAATAA CATCTGTGAATGATGGATTACACGTGTAGCTGACCGGCTGATTGTGTTCGCGTGTGTGTCTTCGATGCA TTGCAGGCTCTGTCCAACGGGCGGTACAAGAGCTGCCTGCACCGGCGGTGGTGAACCAGCGGCAGG AGCGGCGGTCGCTGGCCTTCTTCCTGTGCCCGCGCGAGGACCGGGTGGTGCGCCCGCCGGCCAGCGG CGCCGTCGGCGAGGCGCCCCGCCGCTACCCGGACTTCACCTGGGCCGACCTCATGCGCTTCACGCAG CGCCACTACCGCGCCGACACCCGCACGCTGGACGCCTTCACACGCTGGCTCTCCCACGGCCCGGCCC AGGACGCGCCAGTGGCGGCGGCGGCTTCCACCTAGCTAGCGGCGCGGATCCGACCGAGCCCATTGAC GACGCCGTCCCTTTCCGCCGCCGCCGGGGCCCGCGCGGGGGTTCACCCCACGTGCGCGCCCAGGTGG GCGAGGTGGCGGCCTCGTGGCCCGCGGGCCCCGCGCCGCCTTCCCATTTTTGGGCGCTGCCGCCCCG CGCGCATGCCGGATGCGTGCGTCCACGGCCTACTGCTGCTACTAGTGTACATATACAAACATACATATAT ACGTAGTATAAATATATAAGCAAGCGGCCCGGTGCCCCTTTTCGTTTTCTTGTTTTGTCGATCACAATCT CTGGATTCGATGGATGGATAAATGTTTGTACGCATGCATGTAGATGGGCTCATGAAATTTCAGAATCTG

SEQ ID No _4, sisd1 protein sequence:

MVSQAQQEPALPHSSSTAKRAAASLMDARPAQPLLLRAPTPSIDLPASKPDRAAAAAGKAAAASVFDLRR EPKIPAPFVWPHDDARPASAAELDVPLVDVGVLRNGDRAGLRRAAAQVAAACATHGFFQVCGHGVGAD LARAALDGASDFFRLPLAEKQRARRVPGTVSGYTSAHADRFASKLPWKETLSFGFHDGAASPVVVDYFA GTLGQDFEAVGRVYQRYCEEMKALSLTIMELLELSLGVERGYYRDFFEDSRSIMRCNYYPPCPEPERTLGT GPHCDPTALTILLQDDVGGLEVLVDGDWRPVRPVPGAMVINIGDTFMALSNGRYKSCLHRRW

SEQ ID No _5, CAPS molecular marker SiSD1NciI primer sequence:

SiSD1NciIF：5′-GGGCCTGTAGCGGCTGGAGTACAA-3′

SEQ ID No-6, CAPS molecular marker SiSD1NciI primer sequence:

SiSD1NciIB：5′-TCGCGCGGGCACAGGAAGAAGG-3′

SEQ ID No _7, CAPS molecular marker SiSD1NciI grain PCR product sequence:

GGGCCTGTAGCGGCTGGAGTACAAGCAGATTGGTTGGGTTGGGTTGCTGCTGCTTGGCTGTTGCCCG CCCGCTTTCTAGCCGTTTCCGCTCGCCATCCGGCACGCGGCGCCCACGCCGGGGCTCCAGCTCGGCCC CTTTGGCCGTGTGGGTGGCAGGCACCCCTGCATCGTCTCGTGCGTCCGGTTTCCGCGCCTGGCCCCCC GCCTTGAGGTTTCCCTGTGCTTTTGACAAGACTTTCGTAGATATATGTGTGTGTATGTGTGTGTGTGCG TGCGCGCGTGTGTGTATATATATATATAAATAAATAACATCTGTGAATGATGGATTACACGTGTAGCTGA CCGGCTGATTGTGTTCGCGTGTGTGTCTTCGATGCATTGCAGGCTCTGTCCAACGGGCGGTACAAGAG CTGCCTGCACCGGGCGGTGGTGAACCAGCGGCAGGAGCGGCGGTCGCTGGCCTTCTTCCTGTGCCCG CGCGA

SEQ ID No-8, CAPS molecular marker SiSD1NciI S2 PCR product sequence:

GGGCCTGTAGCGGCTGGAGTACAAGCAGATTGGTTGGGTTGGGTTGCTGCTGCTTGGCTGTTGCCCG CCCGCTTTCTAGCCGTTTCCGCTCGCCATCCGGCACGCGGCGCCCACGCCGGGGCTCCAGCTCGGCCC CTTTGGCCGTGTGGGTGGCAGGCACCCCTGCATCGTCTCGTGCGTCCGGTTTCCGCGCCTGGCCCCCC GCCTTGAGGTTTCCCTGTGCTTTTGACAAGACTTTCGTAGATATATGTGTGTGTATGTGTGTGTGTGCG TGCGCGCGTGTGTGTATATATATATATAAATAAATAACATCTGTGAATGATGGATTACACGTGTAGCTGA CCGGCTGATTGTGTTCGCGTGTGTGTCTTCGATGCATTGCAGGCTCTGTCCAACGGGCGGTACAAGAG CTGCCTGCACCGGCGGTGGTGAACCAGCGGCAGGAGCGGCGGTCGCTGGCCTTCTTCCTGTGCCCGC GCGA。

sequence listing

<120> SiSD1 gene, use thereof in controlling millet plant height trait and genotype identification method

<160> 8

<170> PatentIn version 3.3

<210> 1

<211> 2900

<212> DNA

<213> millet

<400> 1

atggcctccc ctgtggggcg ggtcccacat gaggtagcaa atgtttcctc cttcccttgt 60

ttctgtcgtt gctcgcgaac tccccctcct cccctgctac aaataccccc accggcccgg 120

acaggtctcc tgcacactcg cagctcgcac atctcatggt gtcccaagca cagcaagagc 180

cagctctgcc tcacagcagc agcaccgcca agcgcgcagc cgcgtcactc atggacgccc 240

gcccggccca gcctctcctc ctccgcgccc cgactcccag cattgacctc cccgcgtcca 300

agccggacag ggccgccgcg gcggccggca aggccgccgc cgcctccgtg ttcgacctgc 360

ggcgggagcc caagatcccg gcgccattcg tgtggccgca cgacgacgcg cggccggcgt 420

cggcggcgga gctggacgtg ccgttggtgg acgtgggcgt gctgcgcaat ggcgaccgcg 480

cggggctgcg gcgcgctgcg gcgcaggtgg ccgcggcgtg cgcgacgcac gggttcttcc 540

aggtgtgcgg gcacggcgtg ggcgcggacc tggcgcgcgc ggcgctggac ggcgccagtg 600

acttcttccg gctgccgctg gcggagaagc agcgcgcccg gcgcgtcccg gggaccgtgt 660

ccgggtacac gagcgcgcac gccgaccggt tcgcgtccaa gctcccctgg aaggagaccc 720

tctccttcgg gttccacgac ggcgccgcgt cgcccgtcgt cgtcgactac ttcgccggca 780

ccctcgggca ggacttcgag gcagtggggt aagtatgtag gaatgaactt ggcacgcatt 840

gcatccacat ggcgtgctga tcgaacgagc tgagccaacc ggcatgcaca catggcgtgg 900

caggcgggtg taccagaggt actgcgagga gatgaaggct ctgtcgctga cgatcatgga 960

gctcctggag ctgagcctgg gcgtggagcg cggctactac cgcgacttct tcgaggacag 1020

ccgctccatc atgcggtgca actactaccc gccgtgcccg gagccggagc gcacgctggg 1080

cacgggcccg cactgcgacc ccaccgcgct gaccatcctc ctccaggacg acgtcggcgg 1140

gctcgaggtc ctcgtcgacg gcgactggcg ccccgtccgc cccgtccccg gcgccatggt 1200

catcaacatc ggcgacacct tcatggtacg gccgccgcta atccatcctt ttgttgctct 1260

tatctcctct ggcgagtgcg agtaacgaaa gcgctagctc ccctgctcct tgtcctgctc 1320

tgtttcccaa gtcctaatgg agctaaccgg gcagactgca acacgcacgc gtaggcatgt 1380

cacgtagcca ccacttgcac tgtgctgcgc agcgacgacg caacgcggac gtgcgttcga 1440

gtcggttcca tctcggcgcc gctacacgcg gccgcggctc ctagcctcct agggctccct 1500

gatccctatc cccgagccct tccgcgggaa aagttcgttg gcgacggcag aggagagccg 1560

acgggtccgt gccgttggag cgtggcggca ggagaggccg ggagggtgtt ttgttgcgtt 1620

gcgcggcggc gcggaggatg cgatggcgcg ggcgggcggc gctttcggcg gtggcccccg 1680

cgacccacgt gcgcgcgcgg tctcgtcgcc ttccctgttt tggtgccacc tctctgtgtc 1740

cgggaatggg ttggcttagc ggcgaccgag accgggcggt ggtctggcct gctcccggcg 1800

cccatcccgc ctggtctctc atcctgctcc tcctatgcgc gagggggcct gtagcggctg 1860

gagtacaagc agattggttg ggttgggttg ctgctgcttg gctgttgccc gcccgctttc 1920

tagccgtttc cgctcgccat ccggcacgcg gcgcccacgc cggggctcca gctcggcccc 1980

tttggccgtg tgggtggcag gcacccctgc atcgtctcgt gcgtccggtt tccgcgcctg 2040

gccccccgcc ttgaggtttc cctgtgcttt tgacaagact ttcgtagata tatgtgtgtg 2100

tatgtgtgtg tgtgcgtgcg cgcgtgtgtg tatatatata tataaataaa taacatctgt 2160

gaatgatgga ttacacgtgt agctgaccgg ctgattgtgt tcgcgtgtgt gtcttcgatg 2220

cattgcaggc tctgtccaac gggcggtaca agagctgcct gcaccgggcg gtggtgaacc 2280

agcggcagga gcggcggtcg ctggccttct tcctgtgccc gcgcgaggac cgggtggtgc 2340

gcccgccggc cagcggcgcc gtcggcgagg cgccccgccg ctacccggac ttcacctggg 2400

ccgacctcat gcgcttcacg cagcgccact accgcgccga cacccgcacg ctggacgcct 2460

tcacacgctg gctctcccac ggcccggccc aggacgcgcc agtggcggcg gcggcttcca 2520

cctagctagc ggcgcggatc cgaccgagcc cattgacgac gccgtccctt tccgccgccg 2580

ccggggcccg cgcgggggtt caccccacgt gcgcgcccag gtgggcgagg tggcggcctc 2640

gtggcccgcg ggccccgcgc cgccttccca tttttgggcg ctgccgcccc gcgcgcatgc 2700

cggatgcgtg cgtccacggc ctactgctgc tactagtgta catatacaaa catacatata 2760

tacgtagtat aaatatataa gcaagcggcc cggtgcccct tttcgttttc ttgttttgtc 2820

gatcacaatc tctggattcg atggatggat aaatgtttgt acgcatgcat gtagatgggc 2880

tcatgaaatt tcagaatctg 2900

<210> 2

<211> 423

<212> PRT

<213> millet

<400> 2

Met Val Ser Gln Ala Gln Gln Glu Pro Ala Leu Pro His Ser Ser Ser

1 5 10 15

Thr Ala Lys Arg Ala Ala Ala Ser Leu Met Asp Ala Arg Pro Ala Gln

20 25 30

Pro Leu Leu Leu Arg Ala Pro Thr Pro Ser Ile Asp Leu Pro Ala Ser

35 40 45

Lys Pro Asp Arg Ala Ala Ala Ala Ala Gly Lys Ala Ala Ala Ala Ser

50 55 60

Val Phe Asp Leu Arg Arg Glu Pro Lys Ile Pro Ala Pro Phe Val Trp

65 70 75 80

Pro His Asp Asp Ala Arg Pro Ala Ser Ala Ala Glu Leu Asp Val Pro

85 90 95

Leu Val Asp Val Gly Val Leu Arg Asn Gly Asp Arg Ala Gly Leu Arg

100 105 110

Arg Ala Ala Ala Gln Val Ala Ala Ala Cys Ala Thr His Gly Phe Phe

115 120 125

Gln Val Cys Gly His Gly Val Gly Ala Asp Leu Ala Arg Ala Ala Leu

130 135 140 145

Asp Gly Ala Ser Asp Phe Phe Arg Leu Pro Leu Ala Glu Lys Gln Arg

150 155 160

Ala Arg Arg Val Pro Gly Thr Val Ser Gly Tyr Thr Ser Ala His Ala

165 170 175

Asp Arg Phe Ala Ser Lys Leu Pro Trp Lys Glu Thr Leu Ser Phe Gly

180 185 190

Phe His Asp Gly Ala Ala Ser Pro Val Val Val Asp Tyr Phe Ala Gly

195 200 205

Thr Leu Gly Gln Asp Phe Glu Ala Val Gly Arg Val Tyr Gln Arg Tyr

210 215 220 225

Cys Glu Glu Met Lys Ala Leu Ser Leu Thr Ile Met Glu Leu Leu Glu

230 235 240

Leu Ser Leu Gly Val Glu Arg Gly Tyr Tyr Arg Asp Phe Phe Glu Asp

245 250 255

Ser Arg Ser Ile Met Arg Cys Asn Tyr Tyr Pro Pro Cys Pro Glu Pro

260 265 270

Glu Arg Thr Leu Gly Thr Gly Pro His Cys Asp Pro Thr Ala Leu Thr

275 280 285

Ile Leu Leu Gln Asp Asp Val Gly Gly Leu Glu Val Leu Val Asp Gly

290 295 300 305

Asp Trp Arg Pro Val Arg Pro Val Pro Gly Ala Met Val Ile Asn Ile

310 315 320

Gly Asp Thr Phe Met Ala Leu Ser Asn Gly Arg Tyr Lys Ser Cys Leu

325 330 335

His Arg Ala Val Val Asn Gln Arg Gln Glu Arg Arg Ser Leu Ala Phe

340 345 350

Phe Leu Cys Pro Arg Glu Asp Arg Val Val Arg Pro Pro Ala Ser Gly

355 360 365

Ala Val Gly Glu Ala Pro Arg Arg Tyr Pro Asp Phe Thr Trp Ala Asp

370 375 380 385

Leu Met Arg Phe Thr Gln Arg His Tyr Arg Ala Asp Thr Arg Thr Leu

390 395 400

Asp Ala Phe Thr Arg Trp Leu Ser His Gly Pro Ala Gln Asp Ala Pro

405 410 415

Val Ala Ala Ala Ala Ser Thr

420

<210> 3

<211> 2899

<212> DNA

<213> millet

<400> 3

atggcctccc ctgtggggcg ggtcccacat gaggtagcaa atgtttcctc cttcccttgt 60

ttctgtcgtt gctcgcgaac tccccctcct cccctgctac aaataccccc accggcccgg 120

acaggtctcc tgcacactcg cagctcgcac atctcatggt gtcccaagca cagcaagagc 180

cagctctgcc tcacagcagc agcaccgcca agcgcgcagc cgcgtcactc atggacgccc 240

gcccggccca gcctctcctc ctccgcgccc cgactcccag cattgacctc cccgcgtcca 300

agccggacag ggccgccgcg gcggccggca aggccgccgc cgcctccgtg ttcgacctgc 360

ggcgggagcc caagatcccg gcgccattcg tgtggccgca cgacgacgcg cggccggcgt 420

cggcggcgga gctggacgtg ccgttggtgg acgtgggcgt gctgcgcaat ggcgaccgcg 480

cggggctgcg gcgcgctgcg gcgcaggtgg ccgcggcgtg cgcgacgcac gggttcttcc 540

aggtgtgcgg gcacggcgtg ggcgcggacc tggcgcgcgc ggcgctggac ggcgccagtg 600

acttcttccg gctgccgctg gcggagaagc agcgcgcccg gcgcgtcccg gggaccgtgt 660

ccgggtacac gagcgcgcac gccgaccggt tcgcgtccaa gctcccctgg aaggagaccc 720

tctccttcgg gttccacgac ggcgccgcgt cgcccgtcgt cgtcgactac ttcgccggca 780

ccctcgggca ggacttcgag gcagtggggt aagtatgtag gaatgaactt ggcacgcatt 840

gcatccacat ggcgtgctga tcgaacgagc tgagccaacc ggcatgcaca catggcgtgg 900

caggcgggtg taccagaggt actgcgagga gatgaaggct ctgtcgctga cgatcatgga 960

gctcctggag ctgagcctgg gcgtggagcg cggctactac cgcgacttct tcgaggacag 1020

ccgctccatc atgcggtgca actactaccc gccgtgcccg gagccggagc gcacgctggg 1080

cacgggcccg cactgcgacc ccaccgcgct gaccatcctc ctccaggacg acgtcggcgg 1140

gctcgaggtc ctcgtcgacg gcgactggcg ccccgtccgc cccgtccccg gcgccatggt 1200

catcaacatc ggcgacacct tcatggtacg gccgccgcta atccatcctt ttgttgctct 1260

tatctcctct ggcgagtgcg agtaacgaaa gcgctagctc ccctgctcct tgtcctgctc 1320

tgtttcccaa gtcctaatgg agctaaccgg gcagactgca acacgcacgc gtaggcatgt 1380

cacgtagcca ccacttgcac tgtgctgcgc agcgacgacg caacgcggac gtgcgttcga 1440

gtcggttcca tctcggcgcc gctacacgcg gccgcggctc ctagcctcct agggctccct 1500

gatccctatc cccgagccct tccgcgggaa aagttcgttg gcgacggcag aggagagccg 1560

acgggtccgt gccgttggag cgtggcggca ggagaggccg ggagggtgtt ttgttgcgtt 1620

gcgcggcggc gcggaggatg cgatggcgcg ggcgggcggc gctttcggcg gtggcccccg 1680

cgacccacgt gcgcgcgcgg tctcgtcgcc ttccctgttt tggtgccacc tctctgtgtc 1740

cgggaatggg ttggcttagc ggcgaccgag accgggcggt ggtctggcct gctcccggcg 1800

cccatcccgc ctggtctctc atcctgctcc tcctatgcgc gagggggcct gtagcggctg 1860

gagtacaagc agattggttg ggttgggttg ctgctgcttg gctgttgccc gcccgctttc 1920

tagccgtttc cgctcgccat ccggcacgcg gcgcccacgc cggggctcca gctcggcccc 1980

tttggccgtg tgggtggcag gcacccctgc atcgtctcgt gcgtccggtt tccgcgcctg 2040

gccccccgcc ttgaggtttc cctgtgcttt tgacaagact ttcgtagata tatgtgtgtg 2100

tatgtgtgtg tgtgcgtgcg cgcgtgtgtg tatatatata tataaataaa taacatctgt 2160

gaatgatgga ttacacgtgt agctgaccgg ctgattgtgt tcgcgtgtgt gtcttcgatg 2220

cattgcaggc tctgtccaac gggcggtaca agagctgcct gcaccggcgg tggtgaacca 2280

gcggcaggag cggcggtcgc tggccttctt cctgtgcccg cgcgaggacc gggtggtgcg 2340

cccgccggcc agcggcgccg tcggcgaggc gccccgccgc tacccggact tcacctgggc 2400

cgacctcatg cgcttcacgc agcgccacta ccgcgccgac acccgcacgc tggacgcctt 2460

cacacgctgg ctctcccacg gcccggccca ggacgcgcca gtggcggcgg cggcttccac 2520

ctagctagcg gcgcggatcc gaccgagccc attgacgacg ccgtcccttt ccgccgccgc 2580

cggggcccgc gcgggggttc accccacgtg cgcgcccagg tgggcgaggt ggcggcctcg 2640

tggcccgcgg gccccgcgcc gccttcccat ttttgggcgc tgccgccccg cgcgcatgcc 2700

ggatgcgtgc gtccacggcc tactgctgct actagtgtac atatacaaac atacatatat 2760

acgtagtata aatatataag caagcggccc ggtgcccctt ttcgttttct tgttttgtcg 2820

atcacaatct ctggattcga tggatggata aatgtttgta cgcatgcatg tagatgggct 2880

catgaaattt cagaatctg 2899

<210> 4

<211> 340

<212> PRT

<213> millet

<400> 4

Met Val Ser Gln Ala Gln Gln Glu Pro Ala Leu Pro His Ser Ser Ser

1 5 10 15

Thr Ala Lys Arg Ala Ala Ala Ser Leu Met Asp Ala Arg Pro Ala Gln

20 25 30

Pro Leu Leu Leu Arg Ala Pro Thr Pro Ser Ile Asp Leu Pro Ala Ser

35 40 45

Lys Pro Asp Arg Ala Ala Ala Ala Ala Gly Lys Ala Ala Ala Ala Ser

50 55 60

Val Phe Asp Leu Arg Arg Glu Pro Lys Ile Pro Ala Pro Phe Val Trp

65 70 75

Pro His Asp Asp Ala Arg Pro Ala Ser Ala Ala Glu Leu Asp Val Pro

80 85 90 95

Leu Val Asp Val Gly Val Leu Arg Asn Gly Asp Arg Ala Gly Leu Arg

100 105 110

Arg Ala Ala Ala Gln Val Ala Ala Ala Cys Ala Thr His Gly Phe Phe

115 120 125

Gln Val Cys Gly His Gly Val Gly Ala Asp Leu Ala Arg Ala Ala Leu

130 135 140

Asp Gly Ala Ser Asp Phe Phe Arg Leu Pro Leu Ala Glu Lys Gln Arg

145 150 155

Ala Arg Arg Val Pro Gly Thr Val Ser Gly Tyr Thr Ser Ala His Ala

160 165 170 175

Asp Arg Phe Ala Ser Lys Leu Pro Trp Lys Glu Thr Leu Ser Phe Gly

180 185 190

Phe His Asp Gly Ala Ala Ser Pro Val Val Val Asp Tyr Phe Ala Gly

195 200 205

Thr Leu Gly Gln Asp Phe Glu Ala Val Gly Arg Val Tyr Gln Arg Tyr

210 215 220

Cys Glu Glu Met Lys Ala Leu Ser Leu Thr Ile Met Glu Leu Leu Glu

225 230 235

Leu Ser Leu Gly Val Glu Arg Gly Tyr Tyr Arg Asp Phe Phe Glu Asp

240 245 250 255

Ser Arg Ser Ile Met Arg Cys Asn Tyr Tyr Pro Pro Cys Pro Glu Pro

260 265 270

Glu Arg Thr Leu Gly Thr Gly Pro His Cys Asp Pro Thr Ala Leu Thr

275 280 285

Ile Leu Leu Gln Asp Asp Val Gly Gly Leu Glu Val Leu Val Asp Gly

290 295 300

Asp Trp Arg Pro Val Arg Pro Val Pro Gly Ala Met Val Ile Asn Ile

305 310 315

Gly Asp Thr Phe Met Ala Leu Ser Asn Gly Arg Tyr Lys Ser Cys Leu

320 325 330 335

His Arg Arg Trp

340

<210> 5

<211> 24

<212> DNA

<213> Artificial sequence

<400> 5

gggcctgtag cggctggagt acaa 24

<210> 6

<211> 22

<212> DNA

<213> Artificial sequence

<400> 6

tcgcgcgggc acaggaagaa gg 22

<210> 7

<211> 482

<212> DNA

<213> millet

<400> 7

gggcctgtag cggctggagt acaagcagat tggttgggtt gggttgctgc tgcttggctg 60

ttgcccgccc gctttctagc cgtttccgct cgccatccgg cacgcggcgc ccacgccggg 120

gctccagctc ggcccctttg gccgtgtggg tggcaggcac ccctgcatcg tctcgtgcgt 180

ccggtttccg cgcctggccc cccgccttga ggtttccctg tgcttttgac aagactttcg 240

tagatatatg tgtgtgtatg tgtgtgtgtg cgtgcgcgcg tgtgtgtata tatatatata 300

aataaataac atctgtgaat gatggattac acgtgtagct gaccggctga ttgtgttcgc 360

gtgtgtgtct tcgatgcatt gcaggctctg tccaacgggc ggtacaagag ctgcctgcac 420

cgggcggtgg tgaaccagcg gcaggagcgg cggtcgctgg ccttcttcct gtgcccgcgc 480

ga 482

<210> 8

<211> 481

<212> DNA

<213> millet

<400> 8

gggcctgtag cggctggagt acaagcagat tggttgggtt gggttgctgc tgcttggctg 60

ttgcccgccc gctttctagc cgtttccgct cgccatccgg cacgcggcgc ccacgccggg 120

gctccagctc ggcccctttg gccgtgtggg tggcaggcac ccctgcatcg tctcgtgcgt 180

ccggtttccg cgcctggccc cccgccttga ggtttccctg tgcttttgac aagactttcg 240

tagatatatg tgtgtgtatg tgtgtgtgtg cgtgcgcgcg tgtgtgtata tatatatata 300

aataaataac atctgtgaat gatggattac acgtgtagct gaccggctga ttgtgttcgc 360

gtgtgtgtct tcgatgcatt gcaggctctg tccaacgggc ggtacaagag ctgcctgcac 420

cggcggtggt gaaccagcgg caggagcggc ggtcgctggc cttcttcctg tgcccgcgcg 480

a 481

Claims (9)

1. The SiSD1 gene related to the millet plant height character is characterized in that the nucleotide sequence of the SiSD1 gene is SEQ ID No _1, and the sequence of the SiSD1 gene coding protein is shown in SEQ ID No _ 2.

2. Use of the SiSD1 gene according to claim 1 in controlling the plant height trait of millet.

3. The use of the SiSD1 gene in controlling the millet plant height trait according to claim 2, wherein the SiSD1 gene is used for breeding high-stalk or dwarf trait plants.

4. Use of the SiSD1 gene in controlling the plant height trait of millet according to claim 3, wherein the plants include but are not limited to Arabidopsis, rice and millet.

5. The use of the SiSD1 gene in controlling the plant height of millet as claimed in claim 4, characterized in that, the SiSD1 target gene is transferred into dwarf millet varieties by using the conventional crossbreeding technology, so that the SiSD1 target gene is over-expressed in plants to obtain high-stalk plants and improve the plant height of the plants;

or editing SiSD1 by using a gene editing method or reducing the expression of SiSD1 gene by using RNAi, and using the SiSD1 gene to breed dwarf millet germplasm;

wherein, the SiSD1 target gene is the sequence shown by SEQ ID No _1 and SEQ ID No _2, or the sequence with more than 90% homology with SEQ ID No _1 or SEQ ID No _ 2.

6. The use of the SiSD1 gene in controlling the plant height trait of millet according to claim 2, wherein the mutation site of the SiSD1 gene is 2266 th site of the third exon, so that a molecular marker for identifying the plant height of the millet is developed and used for the dwarf breeding of the millet.

7. A method for identifying the SiSD1 genotype as claimed in claim 1, characterized in that, the genomic DNA of the sample to be detected is extracted, primers are designed according to the nucleotide sequence shown in SEQ ID No _1 for PCR amplification, if the electrophoresis detects an amplification product band with the same size as the SEQ ID No _1 fragment, and the PCR amplified fragment of the genomic DNA with the primers SiSD1NciIF and SiSD1NciIB can be cut into three fragments of 61, 117 and 304bp after NciI enzyme digestion, the sample to be detected has SiSD1 gene;

wherein, the nucleotide sequences of SiSD1NciIF and SiSD1NciIB are respectively shown in SEQ ID No _5 and SEQ ID No _ 6; the length of the PCR amplified fragment is 482bp, and the nucleotide sequence is shown in SEQ ID No _ 7.

8. The use of the genotyping method of claim 7 for the improvement of plant germplasm resources.

9. The use according to claim 2 or 8, wherein the technical means of plant germplasm resource improvement includes, but is not limited to, molecular marker assisted breeding.

Images