CN110724201B - Rapid detection method for acinetobacter baumannii infection based on multiple epitope fusion antigen - Google Patents

Rapid detection method for acinetobacter baumannii infection based on multiple epitope fusion antigen Download PDF

Info

Publication number
CN110724201B
CN110724201B CN201911053066.6A CN201911053066A CN110724201B CN 110724201 B CN110724201 B CN 110724201B CN 201911053066 A CN201911053066 A CN 201911053066A CN 110724201 B CN110724201 B CN 110724201B
Authority
CN
China
Prior art keywords
acinetobacter baumannii
protein
epitope fusion
multiple epitope
fusion antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
CN201911053066.6A
Other languages
Chinese (zh)
Other versions
CN110724201A (en
Inventor
杨波
胡征
王毅
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Hubei University of Technology
Original Assignee
Hubei University of Technology
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Hubei University of Technology filed Critical Hubei University of Technology
Priority to CN201911053066.6A priority Critical patent/CN110724201B/en
Publication of CN110724201A publication Critical patent/CN110724201A/en
Application granted granted Critical
Publication of CN110724201B publication Critical patent/CN110724201B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/21—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Pseudomonadaceae (F)
    • C07K14/212—Moraxellaceae, e.g. Acinetobacter, Moraxella, Oligella, Psychrobacter
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70—Vectors or expression systems specially adapted for E. coli
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/531—Production of immunochemical test materials
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56911—Bacteria
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Hematology (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • Urology & Nephrology (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pathology (AREA)
  • Food Science & Technology (AREA)
  • Biophysics (AREA)
  • General Engineering & Computer Science (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Plant Pathology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Virology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The invention relates to a preparation method of an acinetobacter baumannii infection rapid detection card based on multiple epitope fusion antigens, which comprises a sample pad, a combination pad, a nitrocellulose membrane, a water absorption pad and a PVC (polyvinyl chloride) plate, wherein a colorful latex microsphere coupled multiple epitope fusion antigen polyclonal antibody of acinetobacter baumannii surface protein is sprayed on the combination pad, and the nitrocellulose membrane is coated with a detection line of the multiple epitope fusion antigen polyclonal antibody of the acinetobacter baumannii surface protein and a quality control line of a goat anti-rabbit IgG antibody. When the added sample contains acinetobacter baumannii, the acinetobacter baumannii firstly forms a compound with a latex-rabbit anti-acinetobacter baumannii surface protein polyclonal antibody, the compound is captured when the compound migrates to a detection line coated with the acinetobacter baumannii surface protein polyclonal antibody under the capillary action, and the detection line is in corresponding color, so that whether the sample contains the acinetobacter baumannii or not can be detected. The detection card has the advantages of rapidness, simplicity, high sensitivity and good specificity.

Description

Rapid detection method for acinetobacter baumannii infection based on multiple epitope fusion antigen
Technical Field
The invention belongs to the field of biological detection, and particularly relates to a rapid detection method for acinetobacter baumannii infection based on multiple epitope fusion antigens.
Background
Acinetobacter baumannii (Ab) is a non-fermented gram-negative bacillus, widely exists in the nature and belongs to conditional pathogenic bacteria. The bacterium is an important pathogenic bacterium of hospital infection, mainly causes respiratory tract infection, and also can cause bacteremia, urinary system infection, secondary meningitis, operation site infection, ventilator-associated pneumonia and the like. The resistance rate to commonly used antibiotics tends to increase year by year and is of serious concern to clinicians and microbiologists. Domestic data indicate that a. Baumann ii accounts for approximately 70% or more of clinically isolated acinetobacter. The drug resistance rate of baumann ii to the third and fourth generation cephalosporins reaches 63.0-89.9%, and the drug resistance rate of the bacteria to the four aminoglycosides (amikacin, gentamicin, netilmicin, tobramycin) and ciprofloxacin reaches 96.3%. The vast majority of strains currently in China remain sensitive to imipenem, meropenem, cefperazone/sulbactam and polymyxin B, but have poor efficacy in the treatment of respiratory tract infections. In view of the recent trend toward further increase in the drug resistance of acinetobacter baumannii, this should be highly appreciated by clinicians and the microbiology. The clinician should pay attention to the acquired acinetobacter baumannii infection, and closely cooperate with the clinical microorganism laboratory to enhance the monitoring of the infection and effectively prevent and control the infection.
The existing method for detecting the pathogen in the respiratory tract mainly takes a traditional method, namely a separation and identification method, the method needs long time, generally 2-3 days, and the requirement of quick identification is difficult to meet; the PCR technology developed in recent years is a quick, sensitive and specific technology, but at present, the technology still depends on the previous enrichment step of the traditional method, and PCR inhibitors are often contained in the enrichment liquid, so that the amplification effect is influenced. Meanwhile, the technology also needs professional detection equipment, and is not suitable for bedside detection. Immunological detection based on antibodies has become an indispensable important technical means for detecting human pathogenic microorganisms. Various specific immunoassay techniques, such as Radioimmunoassay (RIA), enzyme Immunoassay (EIA), fluorescence Immunoassay (FIA), chemiluminescence Immunoassay (CIA), immunoprecipitation, immunoagglutination, ELISA detection kit, immune colloidal gold test strip, immune latex detection reagent, and the like, have been developed. Among them, immune latex test paper and other immunological detection techniques based on antibody have become an indispensable important means for detecting pathogenic microorganisms due to their characteristics of simplicity, rapidness, sensitivity, accuracy and practicality. Therefore, research and development of antibodies against pathogenic microorganisms having proprietary intellectual property rights are the basis for development of ELISA detection methods, latex microsphere labeling detection methods, and the like having proprietary intellectual property rights.
The choice of antigenic component is critical to the specificity of the assay. The Acinetobacter baumannii fhuE receptor, ompA, pilF and PonA proteins are important molecules positioned on the surface of cells, and the surface proteins fhuE receptor, ompA, pilF and PonA with interspecies specificity are selected as antigens in the research to prepare a polyclonal antibody with good specificity, and the polyclonal antibody is applied to the preparation of the Acinetobacter baumannii latex microsphere immunochromatography detection card.
Disclosure of Invention
The invention aims to develop a latex microsphere immunochromatography detection card for quickly and quickly detecting acinetobacter baumannii, which is simple to operate and low in cost, by using an immune latex labeling technology on the basis of a polyclonal antibody.
The purpose of the invention is realized by the following technical scheme:
a preparation method of an acinetobacter baumannii infection rapid detection card based on a multiple epitope fusion antigen is characterized by comprising the following steps: the method comprises the following steps:
1) Preparation of multiple epitope fusion antigen (Fhue + OmpA) antibody of Acinetobacter baumannii:
respectively obtaining peptide segments with the most abundant antigenic epitopes in the surface protein Fhue of acinetobacter baumannii and the extracellular domain of the surface protein OmpA, finding out the gene coding sequence of the peptide segments, optimizing the gene coding sequence of the peptide segments, and connecting the optimized gene coding sequence of the peptide segments by using the coding sequence of flexible connecting peptide to form a fusion gene; the Acinetobacter baumannii surface protein Fhue and the surface protein OmpA have access numbers of KMV27515 and AJF83030 in an NCBI protein database respectively; the sequence of the flexible connecting peptide is ggsggsggsggs; simultaneously, enzyme cutting site NdeI is introduced into the 5 'end of the fusion gene, and termination signal TAA and enzyme cutting site BamHI are introduced into the 3' end of the fusion gene, and then a whole gene sequence is chemically synthesized and is marked as FhuOmp;
the complete sequence of the FhuOmp gene is as follows:
CATATGTTCGATGGCAACTACCTGGACCCGGTAGAAGGTAACTCTACTGAAGTTGGTCTCAAATCCGCT
NdeITGGTTTGACGGCCGTCTGAACGGTACCCTGGCTCTGTACCACATCAAACAGGACAACCTGGCACAGGAAGCGGGCCAAGTTACCCGTAACGGTGTTAAAGAGACTTACTACCGTGCAGCGAAAGGCGCTACATCCGAAGGTTTTGAAGTTGAAGTATCAGGTCAGATCACTCCAGATTGGAACATCACCGCAGGTTACTCTCAATTTTCTGCTAAGGACGCGAACGATGCGGACGTAAACACTCAGCTTCCGCGTAAAATGATCCAGAGCTTCACTACCTATAAACTGCCTGGTAAACTGGAAAACATCACAGTTGGCGGTGGCGTAAACTGGCAGTCTTCTACCTACGTGAACGCAAAAAACCCGAAAAAAGTAATCGAAAAAGTTGAGCAGGGTGACTACGCTCTGGTAAACCTGATGGCGCGTTACCAGATCACTAAGGACTTTTCTGCACAGCTTAACATTAACAACGTTTTCGGTGGTTCTGGTGGTTCTGGTGGTTCTGGTGGTTCTCTGGGTTACACCTTCCAGGATACTCAGCACAACAACGGCGGTAAAGACGGTGAACTGACCAACGGTCCGGAACTGCAGGACGACCTGTTCGTTGGTGCTGCGCTGGGTATCGAACTGACTCCGTGGCTGGGTTTCGAAGCCGAGTATAACCAGGTTAAGGGTGACGTGGATGGCCTGGCAGCGGGTGCTGAATACAAACAGAAACAGATCAACGGTAACTTCTACGTTACCAGCGACCTGATTACCAAGAACTATGACTCTAAAATCAAACCGTATGTTCTGCTGGGTGCGGGCCACTACAAATACGAAATCCCGGACCTTTCCTATCACAACGACGAGGAAGGCACTCTGGGTAACGCGGGTGTTGGTGCTTTCTGGCGTCTGAACGACGCTCTGTCTCTGCGTACCGAAGCTCGTGGTACCTATAACTAAGGATCC；
BamHI
the protein sequence coded by the FhuOmp gene is as follows:
MFDGNYLDPVEGNSTEVGLKSAWFDGRLNGTLALYHIKQDNLAQEAGQVTRNGVKETYYRAAKG ATSEGFEVEVSGQITPDWNITAGYSQFSAKDANDADVNTQLPRKMIQSFTTYKLPGKLENITVGGGVNWQSSTYVNAKNPKKVIEKVEQGDYALVNLMARYQITKDFSAQLNINNVFGGSGGSGGSGGSLGYTFQDTQHNNGGKDGELTNGPELQDDLFVGAALGIELTPWLGFEAEYNQVKGDVDGLAAGAEYKQKQINGNFYVTSDLITKNYDSKIKPYVLLGAGHYKYEIPDLSYHNDEEGTLGNAGVGAFWRLNDALSLRTEARGTYN；
the protein sequence coded by the FhuOmp gene is 509-688aa of surface protein Fhue of acinetobacter baumannii and 31-173aa of surface protein OmpA; the two protein sequences are connected by flexible connecting peptide ggsggsggs; cloning the gene fragment into prokaryotic expression vector pET-28a (+) according to conventional method, inducing recombinant Escherichia coli expression by IPTG, and using Ni 2+ Purifying the recombinant His-FhuOmp protein by affinity chromatography; taking the recombinant protein as an immune antigen, mixing the immune antigen with Freund's adjuvant, then repeatedly and artificially immunizing healthy New Zealand white rabbits, drawing blood for titer determination, separating and purifying high-titer recombinant protein antibodies, and finally obtaining the Acinetobacter baumannii multiple epitope fusion antigen (Fhue + OmpA) antibody;
2) Preparation of a multiple epitope fusion antigen (Pilf + ponA) antibody of Acinetobacter baumannii:
respectively obtaining peptide segments with the most abundant antigenic epitopes in the surface protein Pilf of the acinetobacter baumannii and the extracellular domain of the surface protein ponA, finding out the gene coding sequence of the peptide segment, optimizing the gene coding sequence of the peptide segment, and connecting the two segments of sequences by using the coding sequence of rigid connecting peptide to form a fusion gene; the Acinetobacter baumannii surface protein Pilf and the surface protein ponA have access numbers in an NCBI protein database of AJF80497 and ADX05080 respectively; the sequence of the rigid linker peptide is eaaakaaaak; simultaneously, enzyme cutting site NdeI is introduced into the 5 'end of the fusion gene, and termination signal TAA and enzyme cutting site BamHI are introduced into the 3' end of the fusion gene, and then a complete gene sequence is chemically synthesized and is marked as PilPon;
the complete sequence of the PilPon gene is as follows:
CATATGGCGGTTAAGGTACGCACTCAACTGGCGGCTGAATATATCCGTTCAGGTGATCTGGACTCCGCG
NdeIAAACGCTCCCTGGACCAGGCCCTGAGCGTTGACTCTCGTGACGCGACAGCAAACATGATGATGGGCATCCTGCTGCAGCAGGAGGGCTCTAAATCTAACCTGGAGAAAGCGGAGCACTACTTCAAACGTGCTATCAGTTCTGAACCGGATAACGCTCAGGCGCGCAACAACTATGGTACCTATCTGTACCAGATGGAACGTTATAACGACGCGATTGAACAGTTTCGTATCGCAGGTGCGACCCTGGGTTATGATCAGCGTTATCAGGCGCTGGAAAACCTGGGCCGCATCTACCTGAAGCTGGGTAACATCGCCAGCGCTGAAAAAACTTTCAAGCAGGCACTGCTGGCGAACCGTGACTCCTACATCTCTATGCTGGAGCTGGCTGAAATCTTTTACCTGCAGCAGGAAGCTGCTGCTGCTAAAGAAGCTGCTGCTGCTAAAGGCTCTATCGAAGCTATCGTAGGTGGTTACAACTTCTACCAGTCCAAGTTTAACCGTGCGCTCCAGGGCTGGCGCCAGCCGGGCTCTACCATTAAACCTTTCCTGTACGCTCTGGCTCTGGAACGTGGCATGACCCCGTACAGCATGGTAAACGATTCTCCGATCACTATTGGTAAATGGACCCCAAAAAATTCTGACGGCCGTTACCTGGGTATGATCCCGCTGCGTCGCGCTCTGTACCTGTCCCGTAACACTGTATCCGTTCGTCTGCTGCAGACTGTTGGCATCGAACGTACCCGCCAACTGTTTATGGATTTCGGTCTGCAGGAAGACCAGATTCCACGTAACTACACTATCGCTCTGGGCACTCCGCAGGTACTGCCGATCCAGATGGCTACCGGCTACGCTACTTTCGCTAATGGCGGCTACCGTGTTCAGCCACATTTCATCCAGCGTATCGAAGACGCGTATGGTAAAGTAATTTACGAAGCTAAACCGGAATATAAGGATCC；
BamHI
the PilPon-encoded protein sequence is:
MAVKVRTQLAAEYIRSGDLDSAKRSLDQALSVDSRDATANMMMGILLQQEGSKSNLEKAEHYFKRAISSEPDNAQARNNYGTYLYQMERYNDAIEQFRIAGATLGYDQRYQALENLGRIYLKLGNIASAEKTFKQALLANRDSYISMLELAEIFYLQQEAAAAKEAAAAKGSIEAIVGGYNFYQSKFNRALQGWRQPGSTIKPFLYALALERGMTPYSMVNDSPITIGKWTPKNSDGRYLGMIPLRRALYLSRNTVSVRLLQTVGIERTRQLFMDFGLQEDQIPRNYTIALGTPQVLPIQMATGYATFANGGYRVQPHFIQRIEDAYGKVIYEAKPEY；
the protein sequences coded by the PilPon gene are 28-184aa of surface protein Pilf of acinetobacter baumannii and 406-572aa of surface protein ponA, and the two protein sequences are connected by rigid connecting peptide eaaakaak; cloning the gene fragment into prokaryotic expression vector pET-28a (+) according to conventional method, inducing recombinant Escherichia coli expression by IPTG, and using Ni 2+ Purifying the recombinant His-PilPon protein by affinity chromatography; taking the recombinant protein as an immune antigen, mixing the immune antigen with Freund's adjuvant, then repeatedly and artificially immunizing healthy New Zealand white rabbits, drawing blood for titer determination, separating and purifying a high-titer recombinant protein antibody, and finally obtaining an acinetobacter baumannii multiple epitope fusion antigen (Pilf + ponA) antibody;
3) Preparing latex microsphere markers of the acinetobacter baumannii multiple epitope fusion antigen (Fhue + OmpA) antibody:
3.1 Activation of latex microspheres
Taking 1mL of colored carboxylated polystyrene latex microsphere solution with the concentration of 10%, adding 9mL of LMES (2- (N-morpholinyl) ethanesulfonic acid) buffer solution, mixing uniformly, adding NHS (N-hydroxysuccinimide) and EDC (1- (3-dimethylaminopropyl) -3-ethyl 1- (3-dimethylaminopropyl) -3-ethylcarbodiimide hydrochloride) until the final concentration of the NHS (N-hydroxysuccinimide) and the EDC is 1mg/mL, slowly mixing uniformly at room temperature for 30 minutes, centrifuging 19000g after the incubation is finished for 20 minutes, removing supernatant, precipitating by using 10mL of borax buffer solution (0.1 mol/L Na) 2 B 4 O 7 pH8.5), carrying out resuspension, oscillation and ultrasonic treatment to obtain activated latex microspheres; the MES buffer solution comprises the following components in percentage by weight: 0.1mol/LMES, pH of MES buffer =8.5; the content of the components in the borax buffer solution is 0.1mol/L Na 2 B 4 O 7 Wherein the pH of the borax buffer is =8.5; the grain size of the colored carboxylated polystyrene latex microspheres is 100nm;
3.2 Preparation of latex microsphere markers
Diluting the acinetobacter baumannii multiple epitope fusion antigen (Fhue + OmpA) antibody obtained in the step 1) into 1mg/mL by using borax buffer solution; 10mL of acinetobacter baumannii multi-epitope fusion antigen (Fhue + OmpA) antibody is added into 10mL of activated latex microspheres, and slowly and uniformly mixed with 319000g after 0min was centrifuged for 10min to remove the supernatant; resuspending the precipitate with 10mL borax buffer solution containing 1% casein, ultrasonically pulverizing, centrifuging for 1 time, and removing supernatant; resuspending the precipitate by the same method, repeatedly centrifuging for 1 time after ultrasonic crushing, and removing supernatant; resuspending the precipitate with 10mL borax buffer solution containing 1% casein, namely the latex microsphere marker of the acinetobacter baumannii multiple epitope fusion antigen (Fhue + OmpA) antibody; the content of the components in the borax buffer solution is 0.1mol/L Na 2 B 4 O 7 Wherein the pH of the borax buffer solution is =8.5;
4) Preparation of the bonding pad:
spraying the latex microsphere marker of the acinetobacter baumannii multiple epitope fusion antigen (Fhue + OmpA) antibody obtained in the step 3) on a bonding pad made of a polyester fiber material, wherein the spraying amount of a polyester fiber film per square centimeter is 10 mu L of the latex microsphere marker; drying at 37 deg.C in environment with relative humidity not more than 30%, sealing at 25 deg.C, drying and storing;
5) Preparation of antibody solid-phase nitrocellulose membrane:
diluting the Acinetobacter baumannii multiple epitope fusion antigen (Pilf + ponA) antibody obtained in the step 2) into 1.5mg/mL by using a borax buffer solution, and then coating the antibody on a detection line position on a nitrocellulose membrane by using a membrane spraying instrument as a detection line capture antibody, wherein the coating parameter is 1 mu L/cm; spraying goat anti-rabbit IgG on a quality control line position on a nitrocellulose membrane as a control line to capture an antibody, wherein the concentration is 1mg/mL, and the coating parameter is 1 mu L/cm; after coating, putting the nitrocellulose membrane in an environment with the relative humidity not more than 30%, drying at 37 ℃, sealing at 25 ℃, drying and storing; the content of the components in the borax buffer solution is 0.1mol/L Na 2 B 4 O 7 Wherein the pH of the borax buffer is =8.5;
6) Preparation of sample pad
Taking a glass cellulose membrane, soaking the glass cellulose membrane in a sample pad treatment solution for at least 3h, placing the sample pad treatment solution in a biological safety cabinet for ventilation drying at 37 ℃, cutting the sample pad treatment solution into required specifications, and sealing, drying and storing the sample pad treatment solution at 25 ℃; thus, a sample pad was prepared;
the sample pad treatment solution comprises the following components in percentage by weight: 0.01mol/L Na 2 B 4 O 7 2g/L sodium chloride, 20g/L casein, 10ml/L Tween-20 and 10ml/L defoamer S-17; pH =8.5 of the sample pad treatment fluid;
7) Assembly of test card
Respectively sticking a water absorption pad, an antibody solid-phase nitrocellulose membrane, a combination pad and a sample pad which are made of water absorption filter paper materials on a PVC (polyvinyl chloride) base plate in sequence, wherein a quality control line on the nitrocellulose membrane is close to the end of the water absorption pad, a detection line is close to the end of the sample pad, cutting the nitrocellulose membrane into detection cards with certain widths, sealing and packaging the detection cards, and drying the detection cards for low-temperature storage; thus, the multiple epitope fusion antigen-based acinetobacter baumannii infection rapid detection card is prepared.
The invention has the advantages that:
(1) The invention adopts structural analysis, gene optimization and other modes to construct two brand new fusion genes, and successfully obtains soluble recombinant Fhue/OmpA fusion protein and Pilf/ponA fusion protein for the first time through soluble over-expression. The two fusion proteins have high expression amount, low preparation cost, good protein solubility, strong antigenicity, high antibody titer and low cost.
(2) The antibody prepared by utilizing the four protein exposed regions on the surface of the acinetobacter baumannii for the first time has high titer, many targeted antigen sites, strong capture capacity, no site competition problem and high sensitivity of the detection card. The detection sensitivity of the kit to Acinetobacter baumannii standard strain ATCC19606 reaches 2 multiplied by 10 4 CFU/mL is obviously higher than that of the traditional microbial detection method, and has the advantages of rapidness, high efficiency and the like.
(3) The detection card has good specificity, and the specific experiment is carried out by using 6 Acinetobacter baumannii strains and 18 non-Acinetobacter baumannii standard strains (containing most common pathogens of respiratory tract), and the result shows that the detection card has good specificity and stability, can detect all tested Acinetobacter baumannii, has no cross reaction with all non-Acinetobacter baumannii standard strains, and is very suitable for clinical non-diagnostic application.
(4) The detection card can be preserved for two years at normal temperature, effectively prolongs the shelf life and reduces the storage condition; non-professional persons can finish the whole-process detection by using the detection test paper, the operation is simple, and the popularization of the method is facilitated; the whole detection process can be finished within 10min at the fastest speed, and is more suitable for bedside detection.
Drawings
FIG. 1 is a schematic diagram of the explosion structure of the multiple epitope fusion antigen-based Acinetobacter baumannii infection rapid detection card provided by the invention;
FIG. 2 is a schematic structural diagram of an Acinetobacter baumannii infection rapid detection card based on a multiple epitope fusion antigen provided by the invention;
wherein:
1-sample pad; 2-a conjugate pad; 3-NC film; 4-absorbent pad; 5-PVC sheet.
Detailed Description
The present invention is further specifically described by the following examples.
Sources of various materials used or employed in the present invention
1. Latex microspheres: the latex microspheres used in the invention are carboxylated modified polystyrene latex microspheres, are products of Shanghai Yanghe Biotech, inc., have the size of 100NM and the color of red, have the tolerance of the average diameter of within 10 percent, are in the form of 10 percent solid aqueous suspension, and have the product code of MSI-CAR100NM.
2. Glass cellulose membrane: the thickness is 0.45-0.55mm, and the water absorption capacity is 600-800mg/m 2 The glass fiber has a diameter of 0.6-3 μm, has good hydrophilicity, and is available from Shanghai gold Biotech Co., ltd. (model number BT 50).
3. Polyester fiber film: has a thickness of 0.25-0.35mm, a climbing speed of 15-40mm/60s, excellent hydrophilicity, and is used for preparing a conjugate pad, which is purchased from Shanghai gold-labeled Biotech Co., ltd. (model number VL 98).
4. Cellulose nitrate membrane: model number Millipore Corp SHF135, with liner plates, was purchased from Millipore corporation.
5. Water-absorbing filter paper: the thickness is 0.95mm, the water absorption speed is 60s/4cm, and the water absorption capacity is 700mg/cm 2 Has good water absorption and is used as a material for manufacturing the water absorption pad. Purchase atShanghai gold-labeled Biotech Co., ltd. (model: CH 37K).
6. A bottom plate: is made of high-whiteness PVC material, the surface of which is coated with a single-layer high-polymer pressure-sensitive adhesive SM31, and is purchased from Shanghai gold-labeled Biotech Co.
7. The microorganism samples used in the present invention were purchased from the American Type Culture Collection (ATCC).
8. pET28a (+): e.coli expression vectors, introduced from Novagen, USA.
9. Escherichia coli (e. Coli) BL21 (DE 3): purchased from northern Biotechnology, inc., shanghai.
10. Goat anti-rabbit IgG: is product of doctor De bioengineering GmbH, product number BA1039, and concentration is 1mg/ml.
The methods used in the following examples are conventional methods unless otherwise specified.
Example 1
Preparation of acinetobacter baumannii multiple epitope fusion antigen (Fhue + OmpA) antibody:
1.1 Cloning of Acinetobacter baumannii FhuOmp fusion Gene
The method comprises the steps of obtaining peptide segments with most abundant antigen epitopes in extracellular domains of acinetobacter baumannii surface proteins Fhue and OmpA (the accession numbers in an NCBI protein database are KMV27515 and AJF83030 respectively), finding out gene coding sequences of the peptide segments, optimizing the gene coding sequences of the peptide segments, and connecting the two sequences by using the coding sequences of flexible connecting peptides (ggsggsggsggs) to form fusion genes. Simultaneously, enzyme cutting site NdeI is introduced into the 5 'end of the fusion gene, and termination signal TAA and enzyme cutting site BamHI are introduced into the 3' end of the fusion gene, and then a whole gene sequence is chemically synthesized and is marked as FhuOmp. The whole gene sequence and the coded amino acid sequence are shown in a sequence table. Specifically, the protein sequences coded by the FhuOmp gene are 509-688aa of the surface protein Fhue of acinetobacter baumannii and 31-173aa of the surface protein OmpA, and the two protein sequences are connected by flexible connecting peptide (ggsggsggs). The gene sequence is delivered to Nanjing Jinslei Biotech, inc. for complete gene chemical synthesis, and the artificially synthesized gene fragment is connected to vector pUC57 at delivery. The vector pUC57 containing the artificially synthesized DNA fragment was digested with NdeI and BamHI, and the desired fragment was recovered by a conventional method and used. And simultaneously carrying out double enzyme digestion on the vector pET-28a (+) by NdeI and BamHI, connecting the FhuOmp gene obtained after double enzyme digestion into the pET-28a (+) vector according to a conventional molecular biology method, converting Escherichia coli TOP10, and constructing the pET-FhuOmp expression vector. The construction of the expression vector is verified to be correct by enzyme digestion and sequence determination. The vector expresses the recombinant FhuOmp fusion protein.
1.2 Acinetobacter baumannii FhuOmp fusion protein expression and purification
Culturing the positive clone bacteria, extracting plasmid, transferring into competent E.coli BL21 (DE 3) according to conventional technique, coating the bacteria liquid on LB plate containing 50 ug/mL kanamycin, and screening expression strain according to conventional method. Individual colonies transformed with pET-FhuOmp having the ability to express foreign proteins were picked and inoculated into 100mL of LB medium and cultured overnight at 37 ℃. After taking out the bacterial liquid, the bacterial liquid is prepared according to the following steps of 1:100 was inoculated into 100mL of LB medium containing 50. Mu.g/mL kanamycin, cultured at 30 ℃ to OD600=0.6, 1mol/L IPTG was added to a final concentration of 0.5mmol/L, and cultured with shaking at 18 ℃ to induce expression of the fusion protein. After 12h of induction, the thalli are collected by centrifugation for 10min at 8000 r/min. The cells were washed with 50mL Buffer A (50 mM Na) 3 PO 4 0.5M NaCl; pH7.4) was washed 3 times and 50mL of loading buffer (50 mM Na) 3 PO 4 0.5M NaCl;5mM imidazole, pH 7.4) followed by resuspension, sonication, operating under the following conditions: the power is 50W, the working time is 2s, the interval time is 3s, the alarm temperature is 60 ℃, and the total time is 30min. After the ultrasonic treatment is finished, the mixture is centrifuged at 12000g for 15min, and then the precipitate and the supernatant are respectively collected for electrophoresis detection. The recombinant FhuOmp fusion protein was found to be present in partially solubilized form in the bacterial cells (the other portion was present in the form of inclusion bodies). Thin-layer scanning showed that the recombinant protein accounted for more than 30% of the total bacterial protein. The wild type FhuOmp gene which is not subjected to sequence optimization is expressed in the same way, the expression product only accounts for about 4% of the total protein of the thallus, the expression amount is weak, and the gene optimization effect is good. The sonicated supernatant obtained above was filtered through a 0.45 μm filter and then applied to His Trap affinity columns (GE healthcare Co., ltd.)Products), the recombinant FhuOmp protein was purified according to the method described in the specification. The specific method comprises the following steps:
1.2.1 A peristaltic pump (Shanghai Huxi Analyzer, model DHL-A), a chromatography column (GE healthcare product, his Trap affinity column) and an ultraviolet detector (Shanghai Huxi Analyzer, model HD 1), wherein the column volume is 2ml, and the ultraviolet detector is preheated for about 30min until the reading is stable;
1.2.2 Proofreading T%: adjusting a brightness knob to display 100%;
1.2.3 Rotary sensitivity to the appropriate position, typically with 0.2A;
1.2.4 Equilibrate the chromatography system with the loading buffer, rotate "zero" to show "000" after the reading stabilizes;
1.2.5 ) applying protein sample, controlling the flow rate within 5ml/min, and collecting penetration liquid;
1.2.6 Washing off unbound protein with loading buffer, recording the reading during this process until the reading no longer changes, and collecting the eluate;
1.2.7 Elution with Buffer A +10mM imidazole) and collection of the elution peak;
1.2.8 Elution with Buffer A +20mM imidazole) and collection of the elution peak;
1.2.9 Eluted with Buffer A +40mM imidazole and the peak was collected;
1.2.10 Eluted with Buffer A +100mM imidazole and the peak was collected;
1.2.11 Eluted with Buffer A +150mM imidazole and the peak was collected;
1.2.12 100ul of each elution peak sample is taken for SDS-PAGE electrophoresis;
1.2.13 As a result, it was found that the target protein was eluted at 100mM imidazole and had a purity of 90% or more, and the concentration was adjusted to 0.2mg/mL for use after the protein concentration was measured with a bradford kit. So as to prepare the Acinetobacter baumannii FhuOmp fusion protein.
1.3 Preparation of Acinetobacter baumannii multiple epitope fusion antigen (Fhue + OmpA) antibody
1.3.1 2 Indomobacterium baumannii FhuOmp fusion proteins prepared in the step (1.2) and Freund's complete adjuvant are mixed, emulsified and used as immunogen to immunize 2 male New Zealand rabbits, the total amount of the immunogen injected subcutaneously into each rabbit is 2ml, and the total amount of the antigen is 2 mg/rabbit. And then, immunizing once by using emulsion formed by the FhuOmp fusion protein and Freund's incomplete adjuvant every two weeks for 5 times, wherein the using amount of the antigen is the same as that of the primary immunization. Large amount of blood is taken 3-5 days after five-immunization, placed at 37 ℃ for 1 hour, then placed in a refrigerator at 4 ℃ overnight, and serum is taken every other day.
1.3.2 Measurement of polyclonal antibody titer
Using FhuOmp fusion protein as a coating antigen, the coating concentration was 5. Mu.g/ml, each well was coated with 100. Mu.l, and the serum antibody level was measured by indirect ELISA. The serum dilution times of the experimental groups are as follows: 1: 200. 1: 400. 1: 800. 1: 1600. 1: 3200. 1: 6400. 1: 12800. 1: 25600. 1: 51200. 1:102400, 1:204800;
the ELISA plate is coated with bovine serum albumin as a negative control, and an enzyme-linked detector is used for measuring OD450, so that the positive result is obtained when the P/N value is more than 2.1. The results showed that the serum antibody titers of 2 rabbits all reached 1:102400, it is indicated that the immune effect is better.
1.3.3 ) extraction of polyclonal antibodies
The antibodies were purified using a GE-HiTrap Protein A HP pre-packed column as specified, in the following manner:
1.3.3.1 5mL of antiserum was added 0.5mL of 1M Tris (pH 8.0) adjusted to pH8.0, and 20,000 g was centrifuged for 20min to remove the precipitate.
1.3.3.2 After loading on the column, the column was washed with 10 column volumes of buffer A (100 mM Tris-Cl, pH 8.0) and then with 10 column volumes of buffer B (10 mM Tris-Cl, pH 8.0).
1.3.3.3 IgG was eluted with approximately three column volumes of IgG elution buffer (100mM glycine, pH 3.0). (0.1 mL IgG-neutralizing buffer (1M Tris-Cl, pH 8.0) was preloaded into the collection tube, 0.9mL of eluent was loaded into each tube)
1.3.3.4 The eluate was dialyzed against 50 volumes of Tris (10 mM Tris-Cl, pH 8.0).
1.3.3.5 ) after concentration by ultrafiltration, the concentration was adjusted to 5mg/ml and the mixture was stored at-70 ℃ for further use. Thus, the Acinetobacter baumannii multi-epitope fusion antigen (Fhue + OmpA) antibody is prepared.
Example 2
Preparation of a multiple epitope fusion antigen (Pilf + ponA) antibody of Acinetobacter baumannii:
2.1 Cloning of Acinetobacter baumannii PilPon fusion Gene
The method comprises the steps of obtaining peptide segments with most abundant antigen epitopes in extracellular domains of acinetobacter baumannii surface proteins Pilf and ponA (the access numbers in an NCBI protein database are AJF80497 and ADX05080 respectively), finding out gene coding sequences of the peptide segments, optimizing the gene coding sequences of the peptide segments, and connecting the two sequences by using coding sequences of rigid connecting peptide (eaaakaak) to form a fusion gene. Meanwhile, after introducing a restriction site NdeI at the 5 'end and introducing a termination signal TAA and restriction site BamHI at the 3' end of the fusion gene, a complete gene sequence is chemically synthesized and is marked as PilPon. The complete gene sequence and the coded amino acid sequence are shown in a sequence table. Specifically, the protein sequences coded by the PilPon gene are 28-184aa of surface protein Pilf of Acinetobacter baumannii and 406-572aa of surface protein ponA, and rigid connecting peptide (eaaakaaak) is connected between the two protein sequences. The gene sequence is delivered to Nanjing Jinslei Biotech, inc. for complete gene chemical synthesis, and the artificially synthesized gene fragment is connected to vector pUC57 at delivery. The vector pUC57 containing the artificially synthesized DNA fragment was digested with NdeI and BamHI, and the desired fragment was recovered by a conventional method and used. And simultaneously carrying out double enzyme digestion on the vector pET-28a (+) by NdeI and BamHI, connecting the PilPon gene obtained after double enzyme digestion into the pET-28a (+) vector according to a conventional molecular biology method, and transforming Escherichia coli TOP10 to construct a pET-PilPon expression vector. The construction of the expression vector is verified to be correct by enzyme digestion and sequence determination. The vector expresses recombinant PilPon fusion protein.
2.2 Acinetobacter baumannii PilPon fusion protein expression and purification
Culturing the positive clone bacteria, extracting plasmid, transferring into competent E.coli BL21 (DE 3) according to conventional technique, coating the bacteria liquid on LB plate containing 50 ug/mL kanamycin, and screening expression strain according to conventional method. Picking pET-PilPon transformedIndividual colonies capable of expressing the foreign protein were inoculated into 100mL of LB medium and cultured overnight at 37 ℃. After taking out the bacterial liquid, the bacterial liquid is prepared according to the following steps of 1:100 in 100mL containing 50 u g/mL kanamycin LB medium, at 30 degrees C culture to OD600=0.6, adding 1mol/L IPTG to the final concentration of 0.5mmol/L, at 37 degrees C culture shake, induction of fusion protein expression. After induction for 4h, the thalli are collected by centrifugation for 10min at 8000 r/min. The cells were washed with 50mL Buffer A (50 mM Na) 3 PO 4 0.5M NaCl; pH7.4) was washed 3 times and 50mL of loading buffer (50 mM Na) 3 PO 4 0.5M NaCl;5mM imidazole, pH 7.4) followed by resuspension, sonication, operating under the following conditions: the power is 50W, the working time is 2s, the interval time is 3s, the alarm temperature is 60 ℃, and the total time is 30min. After the ultrasonic treatment is finished, the mixture is centrifuged at 12000g for 15min, and then the precipitate and the supernatant are respectively collected for electrophoresis detection. The recombinant PilPon fusion protein was found to be present in the bacterial cells in solubilized form. Thin-layer scanning showed that the recombinant protein accounted for more than 20% of the total bacterial protein. And the wild PilPon gene which is not subjected to sequence optimization is expressed in the same manner, and no expression product is found, so that the gene optimization is successful and the effect is good. The sonicated supernatant obtained above was filtered through a 0.45 μm filter and purified by His Trap affinity columns (GE healthcare Co.) according to the method described in the specification. The specific method comprises the following steps:
(1) Connecting a chromatography system, wherein the system comprises a sample inlet pipe, a peristaltic pump (Shanghai Huxi analysis instrument factory, model DHL-A), a chromatography column (GE healthcare company product, trade name His Trap affinity columns) and an ultraviolet detector (Shanghai Huxi analysis instrument factory, model HD 1), the volume of the column is 2ml, and the ultraviolet detector is preheated for about 30min until the reading is stable;
(2) And (5) correcting T%: adjusting a brightness knob to display 100%;
(3) Rotate the sensitivity to the appropriate position, typically 0.2A;
(4) Equilibrating the chromatography system with the loading buffer until the reading stabilizes and then rotating "zero" to show "000";
(5) Applying protein sample, controlling the flow rate within 5ml/min, and collecting penetration liquid;
(6) Washing away unbound protein with a loading buffer, recording the reading during the process until the reading does not change any more, and collecting the eluate;
(7) Eluting with Buffer A +10mM imidazole, and collecting an elution peak;
(8) Eluting with Buffer A +20mM imidazole, and collecting an elution peak;
(9) Eluting with Buffer A +40mM imidazole, and collecting an elution peak;
(10) Eluting with Buffer A +60mM imidazole, and collecting an elution peak;
(11) Eluting with Buffer A +100mM imidazole, and collecting an elution peak;
(12) Eluting with Buffer A +150mM imidazole, and collecting an elution peak;
(13) Taking 100ul of each elution peak sample to perform SDS-PAGE electrophoresis;
(14) As a result, it was found that the target protein was eluted at 60mM imidazole and had a purity of 90% or more, and the concentration was adjusted to 0.2mg/mL for use after the protein concentration was measured with a bradford kit. Thus obtaining the Acinetobacter baumannii PilPon fusion protein.
2.3 Preparation of Acinetobacter baumannii multiple epitope fusion antigen (Pilf + ponA) antibody
2.3.1 2.2) and Freund's complete adjuvant, emulsifying to obtain immunogen for immunizing 2 male New Zealand rabbits, injecting subcutaneously 2ml of the total amount of antigen per rabbit, and 2mg of the total amount of antigen per rabbit. And then immunizing once by using emulsion formed by the PilPon fusion protein and Freund's incomplete adjuvant every two weeks, wherein the immunization is performed for 5 times totally, and the using amount of the antigen is the same as that of the primary immunization. Large amount of blood is taken 3-5 days after five-immunization, placed at 37 ℃ for 1 hour, then placed in a refrigerator at 4 ℃ overnight, and serum is taken every other day.
2.3.2 Measurement of polyclonal antibody titer
The PilPon fusion protein is used as a coating antigen, the coating concentration is 5 mu g/ml, each well is coated with 100 mu l, and the level of the serum antibody is detected by an indirect ELISA method. The dilution times of the sera of the experimental groups are as follows: 1: 200. 1: 400. 1: 800. 1: 1600. 1: 3200. 1: 6400. 1: 12800. 1: 25600. 1: 51200. 1:102400, 1:204800;
the ELISA plate is coated with bovine serum albumin as a negative control, and an enzyme-linked detector is used for measuring OD450, so that the positive result is obtained when the P/N value is more than 2.1. The results showed that the serum antibody titers of 2 rabbits all reached 1:102400, it is indicated that the immune effect is better.
2.3.3 ) extraction of polyclonal antibodies
The antibodies were purified using a GE-HiTrap Protein A HP pre-packed column as described, in the following manner:
2.3.3.1 5mL of antiserum was added 0.5mL of 1M Tris (pH 8.0) adjusted to pH8.0, and 20,000 g was centrifuged for 20min to remove the precipitate.
2.3.3.2 After loading on the column, the column was washed with 10 column volumes of buffer A (100 mM Tris-Cl, pH 8.0) and then with 10 column volumes of buffer B (10 mM Tris-Cl, pH 8.0).
2.3.3.3 IgG was eluted with approximately three column volumes of IgG elution buffer (100mM glycine, pH 3.0). (0.1 mL IgG-neutralizing buffer (1M Tris-Cl, pH 8.0) was preloaded into the collection tube, 0.9mL of eluent was loaded into each tube)
2.3.3.4 The eluate was dialyzed against 50 volumes of Tris (10 mM Tris-Cl, pH 8.0).
2.3.3.5 ) after concentration by ultrafiltration, the concentration was adjusted to 5mg/ml and the mixture was stored at-70 ℃ for further use. Thus, an acinetobacter baumannii multiple epitope fusion antigen (Pilf + ponA) antibody is prepared.
Example 3
Preparing latex microsphere markers of the acinetobacter baumannii multiple epitope fusion antigen (Fhue + OmpA) antibody:
3.1 Activation of latex microspheres
Taking 1mL of a 10% red carboxylated polystyrene latex microsphere (100 nm) solution, adding 9mL of 2- (N-morpholinyl) ethanesulfonic acid (MES) buffer solution (0.1 mol/LMES, pH8.5), and uniformly mixing; preparing 10mg/mL of N-hydroxysuccinimide (NHS) and 10mg/mL of 1- (3-dimethylaminopropyl) -3-ethyl-1- (3-dimethylaminopropyl) -3-ethylcarbodiimide hydrochloride (EDC) solution by using MES buffer solution;
sequentially adding 1mL of NHS solution and 1mL of EDC solution into the polystyrene latex microsphere (100 nm) solution, slowly and uniformly mixing for 30 minutes at room temperature, and after the incubation is finished, 190 mL of EDC solutionCentrifuging at 00g for 20min, removing supernatant, precipitating with 10mL borax buffer (0.1 mol/L Na) 2 B 4 O 7 Ph 8.5), resuspension, shaking, sonication (sonicator model: YJ92-IIDN, the power is 50W, the working time is 2s, the interval time is 3s, the alarm temperature is 60 ℃, and the total time is 30 min) to obtain the activated latex microspheres.
3.2 Preparation of latex microsphere markers
Using borax buffer (0.1 mol/L Na) 2 B 4 O 7 pH8.5) the Acinetobacter baumannii multiple epitope fusion antigen (Fhue + OmpA) antibody obtained in the step 1 was diluted to 1mg/mL. 10mL of Acinetobacter baumannii multiple epitope fusion antigen (Fhue + OmpA) antibody is added into 10mL of activated latex microspheres, slowly and uniformly mixed for 30 minutes, then 19000g is centrifuged for 10 minutes, and the supernatant is removed. The precipitate was resuspended in 10mL of borax buffer containing 1% casein, and after ultrasonication (model: YJ92-IIDN, power 50W, working time 2s, interval time 3s, alarm temperature 60 ℃ C., total time 30 min), 19000g was centrifuged repeatedly for 1 time (10 min), and the supernatant was removed. The pellet was resuspended in the same way, sonicated and centrifuged again at 19000g for 1 time (10 min) and the supernatant removed. And (3) resuspending the precipitate by using 10mL of borax buffer solution containing 1% casein, thus obtaining the latex microsphere marker of the acinetobacter baumannii multiple epitope fusion antigen (Fhue + OmpA) antibody.
Example 4
Preparation of the bonding pad:
the polyester fiber film was cut into pieces of 4cm × 0.8 cm/piece, and 32 μ L of the latex microsphere marker prepared in example 3 was dropped onto the cut pieces of the film. After spraying, drying at 37 ℃ for 12h in an environment with the relative humidity of 20%. Sealing, drying and storing at 25 ℃.
Example 5
Preparation of antibody solid-phase nitrocellulose membrane:
the nitrocellulose membrane was cut to a size of 4cm × 2.3 cm. Then borax buffer solution (0.1 mol/L Na) is used 2 B 4 O 7 pH8.5) the Acinetobacter baumannii multiple epitope fusion antigen (Pilf + ponA) antibody obtained in example 2 and the goat anti-rabbit IgG were diluted to 1.5mg/mL and 1mg/mL, respectively; diluting Acinetobacter baumanniiFilling a multiple epitope fusion antigen (Pilf + ponA) antibody into a nozzle 1 of a BIODOT membrane scribing instrument, and spraying the antibody on a nitrocellulose membrane by the amount of 1.0 mul/cm to form a detection line, wherein the edge distance between the detection line and the nitrocellulose membrane is 0.8cm; and (3) filling the diluted goat anti-rabbit IgG into a nozzle 2 of a BIODOT membrane scribing instrument, setting the volume of 1.0 mu l/cm, spraying the diluted goat anti-rabbit IgG on a nitrocellulose membrane to be used as a quality control line, and setting the distance between the diluted goat anti-rabbit IgG and the detection line to be 0.7cm. After coating, the nitrocellulose membrane is put in an environment with the relative humidity of 20 percent, dried at 37 ℃ for 12h, sealed at 25 ℃ and stored in a dry way.
Example 6
Preparation of sample pad:
preparing sample pad treating fluid with different formulas, observing the release effect of the latex microsphere labeled antibody, and optimizing through multiple orthogonal tests to obtain the optimal formula (0.01 mol/L Na) of the sample pad treating fluid 2 B 4 O 7 2g/L sodium chloride, 20g/L casein, 10ml/L Tween-20, 10ml/L antifoam S-17, pH 8.5). Taking a glass cellulose membrane, soaking the glass cellulose membrane in the sample pad treatment solution for 3h, then placing the sample pad in a biological safety cabinet for 12h at 37 ℃ for ventilation drying, cutting the sample pad into strips with the specification of 4cm multiplied by 3cm, sealing and drying at 25 ℃ for storage, and obtaining the sample pad. Thus, a sample pad was prepared. Tests prove that the use of the sample pad greatly improves the release rate of the latex microsphere labeled antibody on the bonding pad, and achieves better application effect.
EXAMPLE 7 absorbent pad cutting
A piece of water-absorbing filter paper purchased from Shanghai gold-labeled Biotech Co., ltd, having a model of CH37K, was cut into pieces of 4cm × 3cm per strip for use.
EXAMPLE 8 tailoring of PVC sheets
A high-whiteness PVC sheet purchased from Shanghai gold-labeled Biotechnology Co., ltd., model number SM31 was cut into 4cm × 8.5 cm/strip for use.
EXAMPLE 9 Assembly of test card
As shown in fig. 1 and 2, an NC film 3, a conjugate pad 2, an absorbent pad 4, and a sample pad 1 are sequentially bonded on a single-sided PVC sheet 5, wherein the conjugate pad 2 and the absorbent pad 4 are stacked on the NC film 3, respectively overlapping the NC film 3 by about 2mm, and the sample pad 1 is stacked on the conjugate pad 2, overlapping the conjugate pad 2 by about 2mm. The NC membrane 3 is marked with a detection line T and a quality control line C. Cutting the adhered detection board into detection cards with the width of 4mm by a cutting machine, and putting the prepared detection cards and a drying agent into an aluminum foil bag for sealing and storing.
Example 10 method of use of test cards:
10.1 Treatment of the sample to be examined
The throat swab of the subject was obtained by a conventional method, and inserted into a 500. Mu.L sample treatment solution (0.01 mol/L Na) 2 B 4 O 7 2g/L sodium chloride, 20ml/L Tween-20), the wall of the plastic tube is pressed to fully dissolve the sample on the swab.
10.2 Adding the sample to be examined, and determining the result
Adding 100 mu L of sample into a detection card which is randomly extracted and assembled, combining Acinetobacter baumannii in sample liquid with an antibody marked by a latex microsphere on a combination pad and with a detection line (T line) under the action of chromatography, and acting for 10min at room temperature, wherein two red lines, namely a detection line T line and a quality control line C line, appear in a positive result; if the sample does not contain the acinetobacter baumannii, a negative result only shows that a red line appears on the C line of the quality control line, and the sample does not contain the acinetobacter baumannii.
Example 11 measurement of the Performance of test cards:
11.1 Analysis of specificity
In order to verify the specificity of the multiple epitope fusion antigen-based acinetobacter baumannii infection rapid detection card of the present invention, the composition and the using method of the detection card according to the embodiment 9 and the embodiment 10 are 2 × 10 for the concentration 5 CFU/mL of 6 Acinetobacter baumannii strains and 17 non-Acinetobacter baumannii standard strains were tested and shown in Table 1. The result shows that the detection card of the invention has positive detection results on all 6 Acinetobacter baumannii strains, and has negative detection results on other 17 common respiratory pathogenic microorganisms. The test card showed good specificity.
TABLE 1
Figure BDA0002255817590000141
Figure BDA0002255817590000151
At the same time, the concentration is 2 multiplied by 10 5 The results of 120 CFU/mL clinical isolates of Acinetobacter baumannii detected by the detection card are positive, and the detection card shows high detection coverage on the clinically isolated Acinetobacter baumannii.
11.2 Measurement of sensitivity)
Inoculating Acinetobacter baumannii ATCC19606 strain in sheep blood chocolate culture medium, culturing at 35 deg.C for 36 hr, diluting with normal saline 10 times gradient, and counting to obtain 10-fold thallus concentration 8 -10 3 CFU/mL of the cell solution, 100. Mu.L of the cell solution was dropped on the sample pad, and the assay was performed according to the assay card composition and the method of use described in examples 9 and 10. The results show that the detection sensitivity of the detection card of the invention is 2 multiplied by 10 4 CFU/mL。
11.3 Stability test
The test card was dried and sealed, and then placed at 4 ℃,25 ℃, 37 ℃ and used to test the physiological saline dilution of acinetobacter baumannii ATCC19606 after 6 months, 12 months, 18 months, 21 months and 24 months, respectively, and the results were observed.
After the detection card is dried and sealed, the detection card can still detect a strong positive result after being respectively placed at 4 ℃ and 25 ℃ for 6-24 months; positive results were also detected when incubated at 37 ℃ for 6-18 months, but were diminished when incubated for 21-24 months. Indicating that the test card can be stored at 4 ℃ or 25 ℃ for at least 2 years.
Finally, it is noted that the above-mentioned embodiments illustrate rather than limit the invention, and that, while the invention has been described with reference to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the spirit and scope of the invention as defined by the appended claims.
Sequence listing
<110> Hubei university of industry
<120> multiple epitope fusion antigen-based rapid detection method for acinetobacter baumannii infection
<141> 2019-10-31
<160> 4
<170> SIPOSequenceListing 1.0
<210> 1
<211> 1020
<212> DNA
<213> FhuOmp Gene sequence (FhuOmp)
<400> 1
catatgttcg atggcaacta cctggacccg gtagaaggta actctactga agttggtctc 60
aaatccgctt ggtttgacgg ccgtctgaac ggtaccctgg ctctgtacca catcaaacag 120
gacaacctgg cacaggaagc gggccaagtt acccgtaacg gtgttaaaga gacttactac 180
cgtgcagcga aaggcgctac atccgaaggt tttgaagttg aagtatcagg tcagatcact 240
ccagattgga acatcaccgc aggttactct caattttctg ctaaggacgc gaacgatgcg 300
gacgtaaaca ctcagcttcc gcgtaaaatg atccagagct tcactaccta taaactgcct 360
ggtaaactgg aaaacatcac agttggcggt ggcgtaaact ggcagtcttc tacctacgtg 420
aacgcaaaaa acccgaaaaa agtaatcgaa aaagttgagc agggtgacta cgctctggta 480
aacctgatgg cgcgttacca gatcactaag gacttttctg cacagcttaa cattaacaac 540
gttttcggtg gttctggtgg ttctggtggt tctggtggtt ctctgggtta caccttccag 600
gatactcagc acaacaacgg cggtaaagac ggtgaactga ccaacggtcc ggaactgcag 660
gacgacctgt tcgttggtgc tgcgctgggt atcgaactga ctccgtggct gggtttcgaa 720
gccgagtata accaggttaa gggtgacgtg gatggcctgg cagcgggtgc tgaatacaaa 780
cagaaacaga tcaacggtaa cttctacgtt accagcgacc tgattaccaa gaactatgac 840
tctaaaatca aaccgtatgt tctgctgggt gcgggccact acaaatacga aatcccggac 900
ctttcctatc acaacgacga ggaaggcact ctgggtaacg cgggtgttgg tgctttctgg 960
cgtctgaacg acgctctgtc tctgcgtacc gaagctcgtg gtacctataa ctaaggatcc 1020
<210> 2
<211> 336
<212> PRT
<213> FhuOmp protein sequence (FhuOmp)
<400> 2
Met Phe Asp Gly Asn Tyr Leu Asp Pro Val Glu Gly Asn Ser Thr Glu
1 5 10 15
Val Gly Leu Lys Ser Ala Trp Phe Asp Gly Arg Leu Asn Gly Thr Leu
20 25 30
Ala Leu Tyr His Ile Lys Gln Asp Asn Leu Ala Gln Glu Ala Gly Gln
35 40 45
Val Thr Arg Asn Gly Val Lys Glu Thr Tyr Tyr Arg Ala Ala Lys Gly
50 55 60
Ala Thr Ser Glu Gly Phe Glu Val Glu Val Ser Gly Gln Ile Thr Pro
65 70 75 80
Asp Trp Asn Ile Thr Ala Gly Tyr Ser Gln Phe Ser Ala Lys Asp Ala
85 90 95
Asn Asp Ala Asp Val Asn Thr Gln Leu Pro Arg Lys Met Ile Gln Ser
100 105 110
Phe Thr Thr Tyr Lys Leu Pro Gly Lys Leu Glu Asn Ile Thr Val Gly
115 120 125
Gly Gly Val Asn Trp Gln Ser Ser Thr Tyr Val Asn Ala Lys Asn Pro
130 135 140
Lys Lys Val Ile Glu Lys Val Glu Gln Gly Asp Tyr Ala Leu Val Asn
145 150 155 160
Leu Met Ala Arg Tyr Gln Ile Thr Lys Asp Phe Ser Ala Gln Leu Asn
165 170 175
Ile Asn Asn Val Phe Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly
180 185 190
Ser Leu Gly Tyr Thr Phe Gln Asp Thr Gln His Asn Asn Gly Gly Lys
195 200 205
Asp Gly Glu Leu Thr Asn Gly Pro Glu Leu Gln Asp Asp Leu Phe Val
210 215 220
Gly Ala Ala Leu Gly Ile Glu Leu Thr Pro Trp Leu Gly Phe Glu Ala
225 230 235 240
Glu Tyr Asn Gln Val Lys Gly Asp Val Asp Gly Leu Ala Ala Gly Ala
245 250 255
Glu Tyr Lys Gln Lys Gln Ile Asn Gly Asn Phe Tyr Val Thr Ser Asp
260 265 270
Leu Ile Thr Lys Asn Tyr Asp Ser Lys Ile Lys Pro Tyr Val Leu Leu
275 280 285
Gly Ala Gly His Tyr Lys Tyr Glu Ile Pro Asp Leu Ser Tyr His Asn
290 295 300
Asp Glu Glu Gly Thr Leu Gly Asn Ala Gly Val Gly Ala Phe Trp Arg
305 310 315 320
Leu Asn Asp Ala Leu Ser Leu Arg Thr Glu Ala Arg Gly Thr Tyr Asn
325 330 335
<210> 4
<211> 1025
<212> DNA
<213> PilPon Gene sequence (PilPon)
<400> 4
catatggcgg ttaaggtacg cactcaactg gcggctgaat atatccgttc aggtgatctg 60
gactccgcga aacgctccct ggaccaggcc ctgagcgttg actctcgtga cgcgacagca 120
aacatgatga tgggcatcct gctgcagcag gagggctcta aatctaacct ggagaaagcg 180
gagcactact tcaaacgtgc tatcagttct gaaccggata acgctcaggc gcgcaacaac 240
tatggtacct atctgtacca gatggaacgt tataacgacg cgattgaaca gtttcgtatc 300
gcaggtgcga ccctgggtta tgatcagcgt tatcaggcgc tggaaaacct gggccgcatc 360
tacctgaagc tgggtaacat cgccagcgct gaaaaaactt tcaagcaggc actgctggcg 420
aaccgtgact cctacatctc tatgctggag ctggctgaaa tcttttacct gcagcaggaa 480
gctgctgctg ctaaagaagc tgctgctgct aaaggctcta tcgaagctat cgtaggtggt 540
tacaacttct accagtccaa gtttaaccgt gcgctccagg gctggcgcca gccgggctct 600
accattaaac ctttcctgta cgctctggct ctggaacgtg gcatgacccc gtacagcatg 660
gtaaacgatt ctccgatcac tattggtaaa tggaccccaa aaaattctga cggccgttac 720
ctgggtatga tcccgctgcg tcgcgctctg tacctgtccc gtaacactgt atccgttcgt 780
ctgctgcaga ctgttggcat cgaacgtacc cgccaactgt ttatggattt cggtctgcag 840
gaagaccaga ttccacgtaa ctacactatc gctctgggca ctccgcaggt actgccgatc 900
cagatggcta ccggctacgc tactttcgct aatggcggct accgtgttca gccacatttc 960
atccagcgta tcgaagacgc gtatggtaaa gtaatttacg aagctaaacc ggaatataag 1020
gatcc 1025
<210> 4
<211> 338
<212> PRT
<213> PilPon protein sequence (PilPon)
<400> 4
Met Ala Val Lys Val Arg Thr Gln Leu Ala Ala Glu Tyr Ile Arg Ser
1 5 10 15
Gly Asp Leu Asp Ser Ala Lys Arg Ser Leu Asp Gln Ala Leu Ser Val
20 25 30
Asp Ser Arg Asp Ala Thr Ala Asn Met Met Met Gly Ile Leu Leu Gln
35 40 45
Gln Glu Gly Ser Lys Ser Asn Leu Glu Lys Ala Glu His Tyr Phe Lys
50 55 60
Arg Ala Ile Ser Ser Glu Pro Asp Asn Ala Gln Ala Arg Asn Asn Tyr
65 70 75 80
Gly Thr Tyr Leu Tyr Gln Met Glu Arg Tyr Asn Asp Ala Ile Glu Gln
85 90 95
Phe Arg Ile Ala Gly Ala Thr Leu Gly Tyr Asp Gln Arg Tyr Gln Ala
100 105 110
Leu Glu Asn Leu Gly Arg Ile Tyr Leu Lys Leu Gly Asn Ile Ala Ser
115 120 125
Ala Glu Lys Thr Phe Lys Gln Ala Leu Leu Ala Asn Arg Asp Ser Tyr
130 135 140
Ile Ser Met Leu Glu Leu Ala Glu Ile Phe Tyr Leu Gln Gln Glu Ala
145 150 155 160
Ala Ala Ala Lys Glu Ala Ala Ala Ala Lys Gly Ser Ile Glu Ala Ile
165 170 175
Val Gly Gly Tyr Asn Phe Tyr Gln Ser Lys Phe Asn Arg Ala Leu Gln
180 185 190
Gly Trp Arg Gln Pro Gly Ser Thr Ile Lys Pro Phe Leu Tyr Ala Leu
195 200 205
Ala Leu Glu Arg Gly Met Thr Pro Tyr Ser Met Val Asn Asp Ser Pro
210 215 220
Ile Thr Ile Gly Lys Trp Thr Pro Lys Asn Ser Asp Gly Arg Tyr Leu
225 230 235 240
Gly Met Ile Pro Leu Arg Arg Ala Leu Tyr Leu Ser Arg Asn Thr Val
245 250 255
Ser Val Arg Leu Leu Gln Thr Val Gly Ile Glu Arg Thr Arg Gln Leu
260 265 270
Phe Met Asp Phe Gly Leu Gln Glu Asp Gln Ile Pro Arg Asn Tyr Thr
275 280 285
Ile Ala Leu Gly Thr Pro Gln Val Leu Pro Ile Gln Met Ala Thr Gly
290 295 300
Tyr Ala Thr Phe Ala Asn Gly Gly Tyr Arg Val Gln Pro His Phe Ile
305 310 315 320
Gln Arg Ile Glu Asp Ala Tyr Gly Lys Val Ile Tyr Glu Ala Lys Pro
325 330 335
Glu Tyr

Claims (8)

1. An acinetobacter baumannii multiple epitope fusion antigen Fhue + OmpA, which is characterized in that: the protein sequence of the acinetobacter baumannii multiple epitope fusion antigen Fhue + OmpA is as follows:
MFDGNYLDPVEGNSTEVGLKSAWFDGRLNGTLALYHIKQDNLAQEAGQVTRNGVKETYYRAAKGATSEGFEVEVSGQITPDWNITAGYSQFSAKDANDADVNTQLPRKMIQSFTTYKLPGKLENITVGGGVNWQSSTYVNAKNPKKVIEKVEQGDYALVNLMARYQITKDFSAQLNINNVFGGSGGSGGSGGSLGYTFQDTQHNNGGKDGELTNGPELQDDLFVGAALGIELTPWLGFEAEYNQVKGDVDGLAAGAEYKQKQINGNFYVTSDLITKNYDSKIKPYVLLGAGHYKYEIPDLSYHNDEEGTLGNAGVGAFWRLNDALSLRTEARGTYN；
the complete sequence of the nucleic acid gene for coding the acinetobacter baumannii multiple epitope fusion antigen Fhue + OmpA is as follows:
CATATGTTCGATGGCAACTACCTGGACCCGGTAGAAGGTAACTCTACTGAAGTTGGTCTCAAATCCGCT
TGGTTTGACGGCCGTCTGAACGGTACCCTGGCTCTGTACCACATCAAACAGGACAACCTGGCACAGGAAGCGGGCCAAGTTACCCGTAACGGTGTTAAAGAGACTTACTACCGTGCAGCGAAAGGCGCTACATCCGAAGGTTTTGAAGTTGAAGTATCAGGTCAGATCACTCCAGATTGGAACATCACCGCAGGTTACTCTCAATTTTCTGCTAAGGACGCGAACGATGCGGACGTAAACACTCAGCTTCCGCGTAAAATGATCCAGAGCTTCACTACCTATAAACTGCCTGGTAAACTGGAAAACATCACAGTTGGCGGTGGCGTAAACTGGCAGTCTTCTACCTACGTGAACGCAAAAAACCCGAAAAAAGTAATCGAAAAAGTTGAGCAGGGTGACTACGCTCTGGTAAACCTGATGGCGCGTTACCAGATCACTAAGGACTTTTCTGCACAGCTTAACATTAACAACGTTTTCGGTGGTTCTGGTGGTTCTGGTGGTTCTGGTGGTTCTCTGGGTTACACCTTCCAGGATACTCAGCACAACAACGGCGGTAAAGACGGTGAACTGACCAACGGTCCGGAACTGCAGGACGACCTGTTCGTTGGTGCTGCGCTGGGTATCGAACTGACTCCGTGGCTGGGTTTCGAAGCCGAGTATAACCAGGTTAAGGGTGACGTGGATGGCCTGGCAGCGGGTGCTGAATACAAACAGAAACAGATCAACGGTAACTTCTACGTTACCAGCGACCTGATTACCAAGAACTATGACTCTAAAATCAAACCGTATGTTCTGCTGGGTGCGGGCCACTACAAATACGAAATCCCGGACCTTTCCTATCACAACGACGAGGAAGGCACTCTGGGTAACGCGGGTGTTGGTGCTTTCTGGCGTCTGAACGACGCTCTGTCTCTGCGTACCGAAGCTCGTGGTACCTATAACTAAGGATCC 。
2. a preparation method of an acinetobacter baumannii multiple epitope fusion antigen Fhue + OmpA is characterized in that: the preparation method comprises the following steps: respectively obtaining peptide fragments with most abundant antigenic epitopes in the surface protein Fhue of the acinetobacter baumannii and the extracellular domain of the surface protein OmpA, finding out the gene coding sequence of the peptide fragments, optimizing the gene coding sequence of the peptide fragments, and connecting the optimized gene coding sequence of the peptide fragments by using the coding sequence of flexible connecting peptide to form a fusion gene; the accession numbers of the acinetobacter baumannii surface protein Fhue and the surface protein OmpA in the NCBI protein database are KMV27515 and AJF83030 respectively; the sequence of the flexible connecting peptide is ggsggsggsggs; simultaneously, after enzyme cutting site NdeI is introduced into the 5 'end of the fusion gene and termination signal TAA and enzyme cutting site BamHI are introduced into the 3' end, a complete gene sequence is chemically synthesized and is marked asFhuOmp；
The above-mentionedFhuOmpThe complete sequence of the gene is:
CATATGTTCGATGGCAACTACCTGGACCCGGTAGAAGGTAACTCTACTGAAGTTGGTCTCAAATCCGCT
TGGTTTGACGGCCGTCTGAACGGTACCCTGGCTCTGTACCACATCAAACAGGACAACCTGGCACAGGAAGCGGGCCAAGTTACCCGTAACGGTGTTAAAGAGACTTACTACCGTGCAGCGAAAGGCGCTACATCCGAAGGTTTTGAAGTTGAAGTATCAGGTCAGATCACTCCAGATTGGAACATCACCGCAGGTTACTCTCAATTTTCTGCTAAGGACGCGAACGATGCGGACGTAAACACTCAGCTTCCGCGTAAAATGATCCAGAGCTTCACTACCTATAAACTGCCTGGTAAACTGGAAAACATCACAGTTGGCGGTGGCGTAAACTGGCAGTCTTCTACCTACGTGAACGCAAAAAACCCGAAAAAAGTAATCGAAAAAGTTGAGCAGGGTGACTACGCTCTGGTAAACCTGATGGCGCGTTACCAGATCACTAAGGACTTTTCTGCACAGCTTAACATTAACAACGTTTTCGGTGGTTCTGGTGGTTCTGGTGGTTCTGGTGGTTCTCTGGGTTACACCTTCCAGGATACTCAGCACAACAACGGCGGTAAAGACGGTGAACTGACCAACGGTCCGGAACTGCAGGACGACCTGTTCGTTGGTGCTGCGCTGGGTATCGAACTGACTCCGTGGCTGGGTTTCGAAGCCGAGTATAACCAGGTTAAGGGTGACGTGGATGGCCTGGCAGCGGGTGCTGAATACAAACAGAAACAGATCAACGGTAACTTCTACGTTACCAGCGACCTGATTACCAAGAACTATGACTCTAAAATCAAACCGTATGTTCTGCTGGGTGCGGGCCACTACAAATACGAAATCCCGGACCTTTCCTATCACAACGACGAGGAAGGCACTCTGGGTAACGCGGGTGTTGGTGCTTTCTGGCGTCTGAACGACGCTCTGTCTCTGCGTACCGAAGCTCGTGGTACCTATAACTAAGGATCC ；
the above-mentionedFhuOmpThe protein sequences of the gene codes are 509-688aa of the surface protein Fhue of acinetobacter baumannii and 31-173aa of the surface protein OmpA; the middle of the two protein sequences is connected by flexible connecting peptide; cloning the gene fragment into prokaryotic expression vector pET-28a (+) according to conventional method, inducing recombinant Escherichia coli expression by IPTG, and using Ni 2+ Purifying the recombinant His-FhuOmp protein by affinity chromatography;
the above-mentionedFhuOmpThe protein sequence encoded by the gene is:
MFDGNYLDPVEGNSTEVGLKSAWFDGRLNGTLALYHIKQDNLAQEAGQVTRNGVKETYYRAAKGATSEGFEVEVSGQITPDWNITAGYSQFSAKDANDADVNTQLPRKMIQSFTTYKLPGKLENITVGGGVNWQSSTYVNAKNPKKVIEKVEQGDYALVNLMARYQITKDFSAQLNINNVFGGSGGSGGSGGSLGYTFQDTQHNNGGKDGELTNGPELQDDLFVGAALGIELTPWLGFEAEYNQVKGDVDGLAAGAEYKQKQINGNFYVTSDLITKNYDSKIKPYVLLGAGHYKYEIPDLSYHNDEEGTLGNAGVGAFWRLNDALSLRTEARGTYN。
3. a method for preparing an Acinetobacter baumannii multiple epitope fusion antigen Fhue + OmpA antibody, which is characterized by comprising the following steps: the method comprises the following steps: the recombinant His-FhuOmp protein as claimed in claim 2 is used as an immune antigen, and is mixed with Freund's adjuvant, and then the healthy New Zealand white rabbits are repeatedly and artificially immunized, and then the blood is drawn for titer determination, and high titer recombinant protein antibodies are separated and purified, and finally the Acinetobacter baumannii multiple epitope fusion antigen Fhue + OmpA antibodies are obtained.
4. An acinetobacter baumannii multiple epitope fusion antigen Pilf + ponA, which is characterized in that: the protein sequence of the acinetobacter baumannii multiple epitope fusion antigen Pilf + ponA is as follows:
MAVKVRTQLAAEYIRSGDLDSAKRSLDQALSVDSRDATANMMMGILLQQEGSKSNLEKAEHYFKRAISSEPDNAQARNNYGTYLYQMERYNDAIEQFRIAGATLGYDQRYQALENLGRIYLKLGNIASAEKTFKQALLANRDSYISMLELAEIFYLQQEAAAAKEAAAAKGSIEAIVGGYNFYQSKFNRALQGWRQPGSTIKPFLYALALERGMTPYSMVNDSPITIGKWTPKNSDGRYLGMIPLRRALYLSRNTVSVRLLQTVGIERTRQLFMDFGLQEDQIPRNYTIALGTPQVLPIQMATGYATFANGGYRVQPHFIQRIEDAYGKVIYEAKPEY；
the complete sequence of the nucleic acid gene for coding the acinetobacter baumannii multiple epitope fusion antigen Pilf + ponA is as follows:
CATATGGCGGTTAAGGTACGCACTCAACTGGCGGCTGAATATATCCGTTCAGGTGATCTGGACTCCGCG
AAACGCTCCCTGGACCAGGCCCTGAGCGTTGACTCTCGTGACGCGACAGCAAACATGATGATGGGCATCCTGCTGCAGCAGGAGGGCTCTAAATCTAACCTGGAGAAAGCGGAGCACTACTTCAAACGTGCTATCAGTTCTGAACCGGATAACGCTCAGGCGCGCAACAACTATGGTACCTATCTGTACCAGATGGAACGTTATAACGACGCGATTGAACAGTTTCGTATCGCAGGTGCGACCCTGGGTTATGATCAGCGTTATCAGGCGCTGGAAAACCTGGGCCGCATCTACCTGAAGCTGGGTAACATCGCCAGCGCTGAAAAAACTTTCAAGCAGGCACTGCTGGCGAACCGTGACTCCTACATCTCTATGCTGGAGCTGGCTGAAATCTTTTACCTGCAGCAGGAAGCTGCTGCTGCTAAAGAAGCTGCTGCTGCTAAAGGCTCTATCGAAGCTATCGTAGGTGGTTACAACTTCTACCAGTCCAAGTTTAACCGTGCGCTCCAGGGCTGGCGCCAGCCGGGCTCTACCATTAAACCTTTCCTGTACGCTCTGGCTCTGGAACGTGGCATGACCCCGTACAGCATGGTAAACGATTCTCCGATCACTATTGGTAAATGGACCCCAAAAAATTCTGACGGCCGTTACCTGGGTATGATCCCGCTGCGTCGCGCTCTGTACCTGTCCCGTAACACTGTATCCGTTCGTCTGCTGCAGACTGTTGGCATCGAACGTACCCGCCAACTGTTTATGGATTTCGGTCTGCAGGAAGACCAGATTCCACGTAACTACACTATCGCTCTGGGCACTCCGCAGGTACTGCCGATCCAGATGGCTACCGGCTACGCTACTTTCGCTAATGGCGGCTACCGTGTTCAGCCACATTTCATCCAGCGTATCGAAGACGCGTATGGTAAAGTAATTTACGAAGCTAAACCGGAATATAAGGATCC。
5. a preparation method of an acinetobacter baumannii multiple epitope fusion antigen Pilf + ponA is characterized in that: the preparation method comprises the following steps: respectively obtaining peptide segments with the most abundant antigenic epitopes in the surface protein Pilf of the acinetobacter baumannii and the extracellular domain of the surface protein ponA, finding out the gene coding sequence of the peptide segment, optimizing the gene coding sequence of the peptide segment, and connecting the two segments of sequences by using the coding sequence of rigid connecting peptide to form a fusion gene; the Acinetobacter baumannii surface protein Pilf and the surface protein ponA have access numbers in an NCBI protein database of AJF80497 and ADX05080 respectively; the sequence of the rigid linker peptide is eaaakaaaak; simultaneously, enzyme cutting site NdeI is introduced into the 5 'end of the fusion gene, and termination signal TAA and enzyme cutting site Bam are introduced into the 3' endHI post-chemosynthesis of the complete Gene sequence, scoredPilPon；
The above-mentionedPilPonThe complete sequence of the gene is:
CATATGGCGGTTAAGGTACGCACTCAACTGGCGGCTGAATATATCCGTTCAGGTGATCTGGACTCCGCG
AAACGCTCCCTGGACCAGGCCCTGAGCGTTGACTCTCGTGACGCGACAGCAAACATGATGATGGGCATCCTGCTGCAGCAGGAGGGCTCTAAATCTAACCTGGAGAAAGCGGAGCACTACTTCAAACGTGCTATCAGTTCTGAACCGGATAACGCTCAGGCGCGCAACAACTATGGTACCTATCTGTACCAGATGGAACGTTATAACGACGCGATTGAACAGTTTCGTATCGCAGGTGCGACCCTGGGTTATGATCAGCGTTATCAGGCGCTGGAAAACCTGGGCCGCATCTACCTGAAGCTGGGTAACATCGCCAGCGCTGAAAAAACTTTCAAGCAGGCACTGCTGGCGAACCGTGACTCCTACATCTCTATGCTGGAGCTGGCTGAAATCTTTTACCTGCAGCAGGAAGCTGCTGCTGCTAAAGAAGCTGCTGCTGCTAAAGGCTCTATCGAAGCTATCGTAGGTGGTTACAACTTCTACCAGTCCAAGTTTAACCGTGCGCTCCAGGGCTGGCGCCAGCCGGGCTCTACCATTAAACCTTTCCTGTACGCTCTGGCTCTGGAACGTGGCATGACCCCGTACAGCATGGTAAACGATTCTCCGATCACTATTGGTAAATGGACCCCAAAAAATTCTGACGGCCGTTACCTGGGTATGATCCCGCTGCGTCGCGCTCTGTACCTGTCCCGTAACACTGTATCCGTTCGTCTGCTGCAGACTGTTGGCATCGAACGTACCCGCCAACTGTTTATGGATTTCGGTCTGCAGGAAGACCAGATTCCACGTAACTACACTATCGCTCTGGGCACTCCGCAGGTACTGCCGATCCAGATGGCTACCGGCTACGCTACTTTCGCTAATGGCGGCTACCGTGTTCAGCCACATTTCATCCAGCGTATCGAAGACGCGTATGGTAAAGTAATTTACGAAGCTAAACCGGAATATAAGGATCC ;
the above-mentionedPilPonThe encoded protein sequence is:
MAVKVRTQLAAEYIRSGDLDSAKRSLDQALSVDSRDATANMMMGILLQQEGSKSNLEKAEHYFKRAISSEPDNAQARNNYGTYLYQMERYNDAIEQFRIAGATLGYDQRYQALENLGRIYLKLGNIASAEKTFKQALLANRDSYISMLELAEIFYLQQEAAAAKEAAAAKGSIEAIVGGYNFYQSKFNRALQGWRQPGSTIKPFLYALALERGMTPYSMVNDSPITIGKWTPKNSDGRYLGMIPLRRALYLSRNTVSVRLLQTVGIERTRQLFMDFGLQEDQIPRNYTIALGTPQVLPIQMATGYATFANGGYRVQPHFIQRIEDAYGKVIYEAKPEY；
the above-mentionedPilPonThe protein sequences coded by the genes are 28-184aa of surface protein Pilf of acinetobacter baumannii and 406-572aa of surface protein ponA, and the two protein sequences are connected by rigid connecting peptide; cloning the gene fragment into a prokaryotic expression vector pET-28a (+) according to a conventional method, inducing recombinant escherichia coli to express by IPTG,the recombinant His-PilPon protein was purified by Ni2+ affinity chromatography.
6. A method for preparing an Acinetobacter baumannii multi-epitope fusion antigen Pilf + ponA antibody is characterized in that: the method is to take the recombinant His-PilPon protein as an immune antigen as claimed in claim 5, mix with Freund's adjuvant, then repeatedly and artificially immunize healthy New Zealand white rabbits, take blood for titer determination, separate high-titer recombinant protein antibodies and purify, finally obtain the Acinetobacter baumannii multiple epitope fusion antigen Pilf + ponA antibodies.
7. A rapid detection card for acinetobacter baumannii infection based on multiple epitope fusion antigens is characterized in that: the rapid detection card for acinetobacter baumannii infection based on the multiple epitope fusion antigen comprises a latex microsphere marker coated with the acinetobacter baumannii multiple epitope fusion antigen Fhue + OmpA antibody of claim 1 and a nitrocellulose membrane coated with the acinetobacter baumannii multiple epitope fusion antigen Pilf + ponA antibody of claim 4.
8. Method for the preparation of the multiple epitope fusion antigen based rapid detection card for acinetobacter baumannii infection according to claim 7, characterized in that: the method comprises the following steps:
1) Preparing an acinetobacter baumannii multi-epitope fusion antigen Fhue + OmpA antibody and an acinetobacter baumannii multi-epitope fusion antigen Pilf + ponA antibody;
2) Preparing a latex microsphere marker of the acinetobacter baumannii multiple epitope fusion antigen Fhue + OmpA antibody:
2.1 Activation of latex microspheres
Taking 1mL of colored carboxylated polystyrene latex microsphere solution with the concentration of 10%, adding 9mL of MES buffer solution, uniformly mixing, adding NHS and EDC until the final concentration of the two is 1mg/mL, slowly and uniformly mixing for 30 minutes at room temperature, centrifuging for 20 minutes at 19000g after the incubation is finished, removing supernatant, re-suspending the precipitate with 10mL of borax buffer solution, oscillating, and performing ultrasonic treatment to obtain the activated latex microsphere(ii) a The MES buffer solution comprises the following components in percentage by weight: 0.1mol/L MES, pH of the MES buffer =8.5; the content of components in the borax buffer solution is 0.1mol/L Na 2 B 4 O 7 Wherein the pH of the borax buffer is =8.5; the particle size of the colored carboxylated polystyrene latex microspheres is 100nm;
2.2 Preparation of latex microsphere markers:
diluting the Acinetobacter baumannii multiple epitope fusion antigen Fhue + OmpA antibody obtained in the step 1) into 1mg/mL by using a borax buffer solution; adding 10mL of acinetobacter baumannii multiple epitope fusion antigen Fhue + OmpA antibody into 10mL of activated latex microspheres, slowly mixing uniformly for 30 minutes, centrifuging at 19000g for 10 minutes, and removing supernatant; resuspending the precipitate with 10mL borax buffer solution containing 1% casein, repeating centrifugation for 1 time after ultrasonic pulverization, and removing supernatant; resuspending the precipitate by the same method, repeatedly centrifuging for 1 time after ultrasonic crushing, and removing supernatant; resuspending the precipitate with 10mL of borax buffer solution containing 1% casein to obtain the latex microsphere marker of the acinetobacter baumannii multiple epitope fusion antigen Fhue + OmpA antibody; the content of the components in the borax buffer solution is 0.1mol/L Na 2 B 4 O 7 Wherein the pH of the borax buffer is =8.5;
3) Preparation of the bonding pad:
spraying the latex microsphere marker of the acinetobacter baumannii multiple epitope fusion antigen Fhue + OmpA antibody obtained in the step 2) on a bonding pad made of a polyester fiber material, wherein the spraying amount of a polyester fiber membrane per square centimeter is 10 muL; drying at 37 deg.C in environment with relative humidity not more than 30%, sealing at 25 deg.C, drying and storing;
4) Preparation of antibody solid-phase nitrocellulose membrane:
diluting the Acinetobacter baumannii multiple epitope fusion antigen Pilf + ponA antibody obtained in the step 1) into 1.5mg/mL by using a borax buffer solution, coating the antibody on a detection line position on a nitrocellulose membrane by using a membrane spraying instrument as a detection line to capture the antibody, wherein the coating parameter is 1 muL/cm; spraying goat anti-rabbit IgG to a quality control line position on a nitrocellulose membrane to serve as a control line to capture the antibody, wherein the concentration is 1mg/mL, and the coating parameter is 1 muL/cm; after coating, the nitrocellulose membrane was left relatively wetDrying at 37 deg.C in an environment with a temperature not more than 30%, sealing at 25 deg.C, drying and storing; the content of the components in the borax buffer solution is 0.1mol/L Na 2 B 4 O 7 Wherein the pH of the borax buffer is =8.5;
5) Preparation of sample pad:
taking a glass cellulose membrane, soaking the glass cellulose membrane in a sample pad treatment solution for at least 3h, placing the sample pad treatment solution in a biological safety cabinet for ventilation drying at 37 ℃, cutting the sample pad treatment solution into required specifications, and sealing, drying and storing the sample pad at 25 ℃; thus, a sample pad was prepared;
the sample pad treatment solution comprises the following components in percentage by weight: 0.01mol/L Na 2 B 4 O 7 2g/L sodium chloride, 20g/L casein, 10ml/L tween-20 and 10ml/L defoamer S-17; pH =8.5 of the sample pad treatment fluid;
6) Assembling the detection card:
respectively sticking a water absorption pad, an antibody solid-phase nitrocellulose membrane, a combination pad and a sample pad which are made of water absorption filter paper materials on a PVC (polyvinyl chloride) base plate in sequence, wherein a quality control line on the nitrocellulose membrane is close to the end of the water absorption pad, a detection line is close to the end of the sample pad, cutting the nitrocellulose membrane into detection cards with certain widths, sealing and packaging the detection cards, and drying the detection cards for low-temperature storage; thus, the multiple epitope fusion antigen-based acinetobacter baumannii infection rapid detection card is prepared.
CN201911053066.6A 2019-10-31 2019-10-31 Rapid detection method for acinetobacter baumannii infection based on multiple epitope fusion antigen Active CN110724201B (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN201911053066.6A CN110724201B (en) 2019-10-31 2019-10-31 Rapid detection method for acinetobacter baumannii infection based on multiple epitope fusion antigen

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201911053066.6A CN110724201B (en) 2019-10-31 2019-10-31 Rapid detection method for acinetobacter baumannii infection based on multiple epitope fusion antigen

Publications (2)

Publication Number Publication Date
CN110724201A CN110724201A (en) 2020-01-24
CN110724201B true CN110724201B (en) 2023-01-24

Family

ID=69223502

Family Applications (1)

Application Number Title Priority Date Filing Date
CN201911053066.6A Active CN110724201B (en) 2019-10-31 2019-10-31 Rapid detection method for acinetobacter baumannii infection based on multiple epitope fusion antigen

Country Status (1)

Country Link
CN (1) CN110724201B (en)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111474357B (en) * 2020-04-15 2023-07-25 杭州恒奥科技有限公司 African swine fever virus rapid detection test strip and preparation method and application thereof

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN104651376A (en) * 2015-02-15 2015-05-27 中国人民解放军第三军医大学 Application of acinetobacter baumannii membrane protein A1S_0851 as antigen
TWI649331B (en) * 2015-06-11 2019-02-01 國立中興大學 Acinetobacter baumannii (Acinetobacter baumaniini) multiple peptide antigen and its antibody and nucleic acid encoding the antigen
CN109420165B (en) * 2017-08-23 2021-11-16 中国人民解放军军事医学科学院生物工程研究所 Vaccine for preventing and treating diseases caused by acinetobacter baumannii and preparation method thereof
CN108503698B (en) * 2018-05-24 2021-03-05 中国人民解放军军事科学院军事医学研究院 Immunogenicity of Acinetobacter baumannii Ata protein

Also Published As

Publication number Publication date
CN110724201A (en) 2020-01-24

Similar Documents

Publication Publication Date Title
CN111220803B (en) Novel coronavirus antibody detection reagent, preparation method thereof and novel coronavirus antibody detection card
CN110540595B (en) Preparation method of klebsiella pneumoniae antibody latex microsphere immunochromatography detection test paper
CN110161239B (en) EFTu-based double-antibody sandwich colloidal gold test paper, staphylococcus detection method and application
Xu et al. Rapid detection of Campylobacter jejuni using fluorescent microspheres as label for immunochromatographic strip test
CN104181301A (en) Method and kit for performing quick co-detection on anti-human Hi (Haemophilus influenzae) IgM (Immunoglobulin M) and IgG (Immunoglobulin G) antibodies based on magnetic separation and multi-color quantum dot labeling
CN108314710B (en) Mycoplasma pneumoniae recombinant antigen and application thereof
CN111253478B (en) Mycoplasma pneumoniae antigen and preparation method and application thereof
CN110540594B (en) Preparation method of latex microsphere immunochromatographic test paper based on Moraxella catarrhalis surface protein
CN110724201B (en) Rapid detection method for acinetobacter baumannii infection based on multiple epitope fusion antigen
CN113588946B (en) Recombinant protein and method for detecting mycoplasma hyopneumoniae antibody by indirect ELISA (enzyme-linked immunosorbent assay)
CN111087453A (en) Preparation method and application method of chlamydia pneumoniae recombinant antigen
CN114152748A (en) Double-antibody sandwich ELISA diagnostic kit for detecting African swine fever virus and method thereof
CN110713523B (en) Detection strip for qualitatively detecting acinetobacter baumannii specific antibody in human serum
CN110540597B (en) Preparation method of latex microsphere immunochromatographic test paper based on haemophilus influenzae surface protein
CN110540969A (en) monoclonal antibody of surface protein of mycoplasma hyopneumoniae and antigen capture ELISA kit
CN103834668A (en) Recombination mycoplasma pneumoniae protein and application thereof
CN109541199B (en) Immune colloidal gold test paper for rapidly detecting mycoplasma bovis and preparation method thereof
CN110540600B (en) Preparation method of latex microsphere immunochromatographic test paper based on surface protein of klebsiella pneumoniae
CN110687302A (en) Test paper strip and method for rapidly detecting porcine circovirus type 2 antigen or antibody colloidal gold
CN105242040B (en) Human Haemophilus influenza quantum dot immunochromatography detection card, preparation method and application thereof
CN105223352A (en) Based on magnetic resolution and quantum dot-labeled human influenza haemophilus method for quick and kit
CN105319360B (en) People&#39;s CPN quantum dot immune chromatography detection card and its preparation method and application
CN110713524B (en) High-sensitivity acinetobacter baumannii antigen Elisa determination kit
CN110540599A (en) Klebsiella pneumoniae Elisa detection kit based on Klebsiella pneumoniae surface protein antibody and preparation method thereof
CN110540598B (en) Haemophilus influenzae Elisa detection kit based on surface protein antibody of haemophilus influenzae and preparation method

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
GR01 Patent grant
GR01 Patent grant