CN110205330B - Tobacco heat shock protein HSP22 and application thereof - Google Patents
Tobacco heat shock protein HSP22 and application thereof Download PDFInfo
- Publication number
- CN110205330B CN110205330B CN201910533362.XA CN201910533362A CN110205330B CN 110205330 B CN110205330 B CN 110205330B CN 201910533362 A CN201910533362 A CN 201910533362A CN 110205330 B CN110205330 B CN 110205330B
- Authority
- CN
- China
- Prior art keywords
- tobacco
- hsp22
- gene
- heat shock
- content
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8242—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
- C12N15/8243—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
- C12N15/825—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine involving pigment biosynthesis
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Plant Pathology (AREA)
- Nutrition Science (AREA)
- Botany (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The invention belongs to the field of tobacco gene engineering, and particularly relates to a tobacco heat shock protein HSP22 gene and an application patent thereof. The base sequence of the gene is shown in SEQ ID NO. 1. The tobacco heat shock protein HSP22 consists of 192 amino acid residues, wherein the amino acids from 68 to 159 are conserved in the SHSP structural domain. The protein is related to the content of pigment substances in plant leaves, and after the expression of the protein is reduced, the content of the pigment substances in the plant leaves is obviously reduced, wherein the pigment substances are as follows: neoxanthin, violaxanthin, lutein, chlorophyll a/b, beta-carotene. According to the invention, through preliminary research on the specific tobacco heat shock protein HSP22, the high correlation with the content of the tobacco pigment substances is found, and the content of the pigment substances in the tobacco is obviously reduced after the gene is silenced. Based on the characteristic, a certain application basis and reference can be developed for the new variety of tobacco.
Description
Technical Field
The invention belongs to the field of tobacco genetic engineering, and particularly relates to a tobacco heat shock protein HSP22 and an application patent application thereof.
Background
Nicotiana, tubuliformes, commonly ingested by humansNicotiana) There are more than 60 species, and the tobacco used for preparing the tobacco to be smoked is mainly two cultivars, respectively, common tobacco (also called carthamus tinctorius,Nicotiana tabacum) And yellow flower tobacco: (Nicotiana rustica) The former occupying the major area, while the latter having a relatively small cultivation area.
The cultivated tobacco can be divided into six types of flue-cured tobacco, sun-cured tobacco, air-cured tobacco, burley tobacco, aromatic tobacco and yellow flower tobacco according to the characteristics of the quality, biological characters, cultivation modulation methods and the like of the tobacco leaves, wherein the flue-cured tobacco is the most widely cultivated common tobacco. The flue-cured tobacco planting area and the total yield of China are in the first place in the world. As a leaf economic crop, the cultivation technology of flue-cured tobacco is different from other field crops, and not only a certain tobacco yield is required, but also the quality of the tobacco is emphasized. The tobacco leaf quality determines the availability of the tobacco leaves, directly influences the color, the fragrance, the taste and the commodity value of cigarette commodities, is also related to the economic benefit of tobacco growers, and is the life and the starting point of the tobacco industry. In order to stand in a field in future market competition at home and abroad and meet the increasing demand of cigarette enterprises at home and abroad on high-quality tobacco leaves, the quality and the safety of the tobacco leaves must be improved.
Plant pigments are an important class of compounds in tobacco, mainly including chlorophyll and carotenoids. Chlorophyll is largely degraded and disappeared in the process of tobacco ripening and tobacco leaf modulation, is an unfavorable chemical component in dry tobacco leaves, often has green miscellaneous gas, and is one of indexes strictly controlled in tobacco leaf grading. If the chlorophyll is not fully degraded in the modulation treatment process, the tobacco leaves are baked, and green and yellow tobacco with different degrees can be baked. The green and yellow tobacco has poor appearance quality, and harmful substances are generated during combustion, so that the grade and quality of the tobacco are influenced.
During the fermentation and alcoholization of tobacco leaves, the chlorophyll porphyrin ring can be degraded to generate pyrrole compounds, thereby increasing the aging fragrance of the tobacco leaves and reducing the green miscellaneous gas; on the other hand, phytol generated by chlorophyll hydrolysis can be further degraded into neophytadiene and then degraded into phytofuran, and further converted into sweet components of tobacco leaves. Therefore, chlorophyll is an important aroma precursor, and is beneficial to smoke quality after being fully degraded.
The tobacco yellow pigment is mainly carotenoid, the carotenoid content of the tobacco leaves has positive correlation with the quality of the tobacco leaves, and on one hand, the appearance quality of the tobacco leaves is directly correlated with the content of the components; on the other hand, the carotenoid is an important precursor of the tobacco aroma components, and has a positive correlation with the aroma quantity and the aroma quality of the tobacco. The flavor components in tobacco leaves are mostly degradation products of carotenoids, and many of the compounds are key aroma components in tobacco, such as ionone, damascone, isophorone and the like.
Based on the important function of the pigments in the tobacco leaves, the regulation and control genes of the tobacco pigments are deeply researched, and a new tobacco variety is constructed by utilizing genetic engineering, so that a good application foundation can be laid for improving the tobacco variety.
Disclosure of Invention
Based on the research of the tobacco pigment substance content regulating gene, the invention aims to provide the tobacco heat shock protein HSP22 gene and the application thereof in the aspect of regulating the tobacco pigment substance content, thereby laying a foundation for the cultivation of new tobacco varieties.
The technical scheme adopted by the application is detailed as follows.
Coding gene of tobacco heat shock protein HSP22HSP22The base sequence is shown as SEQ ID NO.1, wherein the specific nucleic acid fragment is 202-477 base.
The codingHSP22The application of the gene in the regulation and control of the leaf pigment content utilizes a gene silencing technology or a gene overexpression method to regulate and control the content of the pigment substances in tobacco leaves by regulating the expression level of HSP22 protein of the tobacco, and the pigment substances are as follows: neoxanthin, violaxanthin, lutein, chlorophyll a/b, beta-carotene.
The amino acid sequence of the tobacco heat shock protein HSP22 is shown in SEQ ID NO.2 and consists of 192 amino acid residues, wherein the amino acid at the 68 th position to the 159 th position is a conserved SHSP structural domain.
The application of the tobacco heat shock protein HSP22 in regulation and control of the content of leaf pigments is that the protein is related to the content of the pigments in plant leaves, and after the expression of the protein is reduced, the content of the pigments in the leaves is obviously reduced, and the pigments are as follows: neoxanthin, violaxanthin, lutein, chlorophyll a/b, beta-carotene.
Using the coding geneHSP22The method for cultivating the new variety of tobacco comprises constructing the tobacco containing gene by a transgenic technology, a transient expression technology or a genome editing technologyHSP22Transforming tobacco by using a virus-induced silencing vector, an RNAi interference vector, an overexpression vector or a genome editing vector of the gene, and screening to obtain a new tobacco variety with variable pigment content;
specific examples thereof include: interference using virus-induced gene silencing (VIGS) techniqueHSP22The expression of the gene causes it to be silenced,HSP22the content of pigment substances in the gene silencing plant is obviously reduced, and a new plant variety with reduced pigment content is obtained.
According to the invention, through preliminary research on the specific tobacco heat shock protein HSP22, the high correlation with the content of the tobacco pigment substances is found, and the content of the pigment substances in the tobacco is obviously reduced after the gene is silenced. Based on the characteristic, a certain application basis and reference can be developed for the new variety of tobacco.
Drawings
FIG. 1 is a comparison of the phenotypes of the tobacco TRV2-PDS, TRV2-GFP and TRV2-NtHSP22 vector-transformed groups of the present invention;
FIG. 2 is a graph of the relative expression of the NtHSP22 gene in silenced plants compared to control plants;
FIG. 3 is a comparison of the main pigment content in tobacco leaves with virus-induced gene silencing and in control tobacco leaves.
Detailed Description
The present application is further illustrated by the following examples, which are intended to provide a brief summary of the experimental background information in the examples given below, before describing the examples.
Biological material:
the Nicotiana benthamiana, a common tobacco material, is planted in a Zhenzhou tobacco institute planting base in the following examples, seedling is grown in a seedling raising pot, seedling division is carried out two weeks after germination, the seedling is planted in a plastic pot (10 cm multiplied by 10 cm), and daily fertilizer and water management and the like are carried out under the dark condition of 16h light/8 h at the temperature of 22 ℃;
the VIGS vector used in the following examples is a viral vector (TRV) derived from tobacco rattle virus, specifically using TRV2 stored by Zheng Nicotiana tobacco institute Gene center, which carries Kanna selection marker and 35S promoter, and TRV2 carries multiple cloning sites such as EcoR I and BamH I, which can be used to carry and transform foreign genes;
experimental reagent:
LB liquid medium, 1L content contains: 10 g bacterial peptone (bacteriological peptone); 10 g sodium chloride (NaCl); 5g yeast extract (yeast extract), autoclaving;
YEB liquid culture medium, 1L content contains: 5g beef extract (beef extract); 5g bacterial peptone (bacteriological peptone); 5g sucrose (sucrose); 1 g yeast extract (yeast extract); 2 mL of 1M magnesium sulfate (MgSO 4), autoclaved;
1M 2- (N-morpholine) ethanesulfonic acid (MES) stock: ddH2Dissolving O, filtering, sterilizing, and storing at-20 ℃ for later use;
200 mM Acetosyringone (Acetosyringone, As) stock solution: dissolving Dimethyl Sulfoxide (DSMO), and storing at-20 deg.C;
MMA（100 mL）：1 mL（1 M）MgCl2；1 mL（1 M，pH5.6）MES；75 μL（200 mM）As。
example 1
This example relates to tobaccoNtHSP22The construction of gene cloning and silencing vectors is briefly described below.
(1) TobaccoNtHSP22Cloning of genes
According to the previous research on the tobacco genome and related HSP22 genes, a specific coding sequence is selected as a target segment, and a primer sequence for PCR amplification is designed as follows:
NtHSP22-F：5’-ACCGAATTCGCTCAGACTGGAAGGAAACA- 3’，
NtHSP22-R：5’-ACCGGATCCGCTTTAATGTCCTCACCACC- 3’；
using cDNA of tobacco K326 leaf as template, carrying out PCR amplification to obtainNtHSP22A gene;
the PCR amplification procedure was: pre-denaturation at 95 ℃ for 3 min; denaturation at 95 ℃ for 15s, annealing at 55 ℃ for 15s, extension at 72 ℃ for 30s, and complete extension at 72 ℃ for 5min after 34 cycles;
and carrying out agarose gel electrophoresis detection on the PCR amplification product, and recovering the electrophoresis product for later use.
(2) Construction of recombinant TRV2-NtHSP22 vector
Carrying out EcoRI and BamHI double enzyme digestion on the PCR amplification product in the step (1), simultaneously carrying out EcoRI and BamHI double enzyme digestion on an empty vector TRV2, respectively recovering enzyme digestion products, and utilizing T4 DNA ligase to carry out ligation;
transforming the ligation product into escherichia coli competent DH5 alpha, coating the transformation product on LB solid culture medium containing 50mg/L Kan after the transformation operation is finished, and culturing at 37 ℃ overnight;
and selecting positive single colonies, amplifying, and then further performing PCR identification, and ensuring that a correctly constructed recombinant vector TRV2-NtHSP22 is obtained by combining sequencing verification.
It should be noted that:
tobaccoNtHSP22A gene comprising 579 bases, the specific base sequence being:
ATGGTGAAAACAACTGTTAGTCTTTTGAGCTTTCTAGTGTTAGCAATGGCTGTAGTCTTATTTCTTCCATCACAAACTGAAGCACTAATGCCATACACACGCCCTTTTTGGGACTTAACGTTCCCACCAGAAGATCCTTTCAAGATTCTTGAACAAATCCCACTAACCATCCCAAAAGGGGTCGATTCAATCGCCTTAGCTCGCTCAGACTGGAAGGAAACAGGAACAGAGCACGTAATTACCCTCGACATACCAGGGATGAAAAGGGATGACATCAAGATCGAGGTGGAAGAGAACAGGGTGTTGAGAATCATTGGGGAAAGGAAAATAGAGGAAGAAGTTGAAGGAGAAAAGTGGCACAGAGCTGAGAGGACTTCTGGAAAATTCTGGAGACAGTTTAGGTTACCTGGGAATGCAGATTTGGAACACATAAAGGCTCATTTGGAAAATGGTGTCTTGAAGATTACTGTGCCAAAGTTGGCTGAAGAGAAGAAGAAACAGACAAAGGTGATTAATATTGCTGAGGATGGTAACTCTGCTGGTGGTGAGGACATTAAAGCTACCAAAGCTGAGATGT；
the tobacco heat shock protein HSP22 comprises 192 amino acids, and the specific amino acid sequence is as follows:
MVKTTVSLLSFLVLAMAVVLFLPSQTEALMPYTRPFWDLTFPPEDPFKILEQIPLTIPKGVDSIALARSDWKETGTEHVITLDIPGMKRDDIKIEVEENRVLRIIGERKIEEEVEGEKWHRAERTSGKFWRQFRLPGNADLEHIKAHLENGVLKITVPKLAEEKKKQTKVINIAEDGNSAGGEDIKATKAEM。
example 2
Based on example 1, the inventor further transforms the constructed recombinant TRV2-NtHSP22 vector into tobacco plants by utilizing the agrobacterium-mediated VIGS technology, and performs verification analysis on the phenotype change conditions of the related plants, and the specific experimental process is summarized as follows.
(1) Transformation of Agrobacterium
It should be noted that, referring to the operation of example 1 and the prior art, the inventors prepared TRV2-GFP and TRV2-PDS recombinant vectors at the same time as a control, and the specific transformation process was as follows:
positive cloning plasmids of TRV2-GFP (vector control), TRV2-PDS (VIGS efficiency control) and TRV2-NtHSP22 are respectively transformed into agrobacterium GV3101 competent cells by an electric shock transformation mode, cultured and screened by using YEB plates containing 50mg/L Kan and 50mg/L Rif, and subjected to inverted culture at 28 ℃ for 2d, and then screened for agrobacterium carrying the target gene by colony PCR.
(2) Preparation of a transfection solution
Culturing the positive agrobacterium clones obtained by screening in the step (1) in 5 mL of YEB liquid culture medium (containing 50mg/L Kan and 50mg/L Rif) at 28 ℃ and 250 rpm overnight;
50uL of the overnight culture was inoculated into 50 mL of YEB liquid medium (containing 50mg/L Kan), and cultured to OD600= 1.0-1.5, then centrifuged at 4000g for 5min, the cells were collected and then MMA (1 mL (1M) MgCl2(ii) a 1 mL (1M, pH 5.6) MES; 75 μ L (200 mM) As) resuspended and OD adjusted600 About = 1.0;
finally, the mixture is placed at room temperature for about 3 hours and then used as a bacterial liquid for transfection.
(3) Transient transformation
And (3) taking 3-4 w seedling-age tobacco leaves as an experimental material, injecting the bacterial liquid for transfection prepared in the step (2) into the tobacco leaves by using a 1 mL-specification injector, continuously culturing the injected tobacco in an artificial incubator, and observing the phenotypic change.
The phenotypic changes of tobacco 3 weeks after injection are shown in figure 1. As can be seen, the newly grown leaves of the Agrobacterium tumefaciens-impregnated plant containing TRV2-PDS are bleached, indicating that the infection is successful; the TRV2-GFP group has no obvious change, and the color of the tobacco leaves of the corresponding TRV2-NtHSP22 group has obvious change, which shows that the NtHSP22 gene is highly related to the pigment content in the tobacco leaves.
Further, the expression condition of the NtHSP22 gene is detected by qRT-PCR, and the result is shown in FIG. 2, and it can be seen that the expression level of NtHSP22 is remarkably reduced in the infected plant of TRV2-NtHSP 22.
Further, the inventors tested the content of plant pigments (neoxanthin, violaxanthin, lutein, chlorophyll a/b, β -carotene) in the experimental group (TRV 2-NtHSP22 impregnated plants) and the control group (TRV 2-GFP impregnated plants) (tested according to the national tobacco industry standard YC/T382-.
TABLE 1 percentage reduction of phytochrome content in fresh tobacco samples
From the results in the table above, the contents of various pigments such as neoxanthin, violaxanthin, lutein, chlorophyll a, chlorophyll b and beta carotene in the experimental group are all significantly reduced compared with the control group, which further indicates that the plant pigment content in the tobacco leaves can be regulated and controlled by silencing NtHSP22 gene, and further a certain technical basis can be laid for the quality regulation and control of tobacco leaves.
SEQUENCE LISTING
<110> Zhengzhou tobacco institute of China tobacco general Co
<120> tobacco heat shock protein HSP22 and application thereof
<130> none
<160> 2
<170> PatentIn version 3.5
<210> 1
<211> 577
<212> DNA
<213> Nicotiana tabacum
<400> 1
atggtgaaaa caactgttag tcttttgagc tttctagtgt tagcaatggc tgtagtctta 60
tttcttccat cacaaactga agcactaatg ccatacacac gccctttttg ggacttaacg 120
ttcccaccag aagatccttt caagattctt gaacaaatcc cactaaccat cccaaaaggg 180
gtcgattcaa tcgccttagc tcgctcagac tggaaggaaa caggaacaga gcacgtaatt 240
accctcgaca taccagggat gaaaagggat gacatcaaga tcgaggtgga agagaacagg 300
gtgttgagaa tcattgggga aaggaaaata gaggaagaag ttgaaggaga aaagtggcac 360
agagctgaga ggacttctgg aaaattctgg agacagttta ggttacctgg gaatgcagat 420
ttggaacaca taaaggctca tttggaaaat ggtgtcttga agattactgt gccaaagttg 480
gctgaagaga agaagaaaca gacaaaggtg attaatattg ctgaggatgg taactctgct 540
ggtggtgagg acattaaagc taccaaagct gagatgt 577
<210> 2
<211> 192
<212> PRT
<213> Nicotiana tabacum
<400> 2
Met Val Lys Thr Thr Val Ser Leu Leu Ser Phe Leu Val Leu Ala Met
1 5 10 15
Ala Val Val Leu Phe Leu Pro Ser Gln Thr Glu Ala Leu Met Pro Tyr
20 25 30
Thr Arg Pro Phe Trp Asp Leu Thr Phe Pro Pro Glu Asp Pro Phe Lys
35 40 45
Ile Leu Glu Gln Ile Pro Leu Thr Ile Pro Lys Gly Val Asp Ser Ile
50 55 60
Ala Leu Ala Arg Ser Asp Trp Lys Glu Thr Gly Thr Glu His Val Ile
65 70 75 80
Thr Leu Asp Ile Pro Gly Met Lys Arg Asp Asp Ile Lys Ile Glu Val
85 90 95
Glu Glu Asn Arg Val Leu Arg Ile Ile Gly Glu Arg Lys Ile Glu Glu
100 105 110
Glu Val Glu Gly Glu Lys Trp His Arg Ala Glu Arg Thr Ser Gly Lys
115 120 125
Phe Trp Arg Gln Phe Arg Leu Pro Gly Asn Ala Asp Leu Glu His Ile
130 135 140
Lys Ala His Leu Glu Asn Gly Val Leu Lys Ile Thr Val Pro Lys Leu
145 150 155 160
Ala Glu Glu Lys Lys Lys Gln Thr Lys Val Ile Asn Ile Ala Glu Asp
165 170 175
Gly Asn Ser Ala Gly Gly Glu Asp Ile Lys Ala Thr Lys Ala Glu Met
180 185 190
Claims (4)
1. Coding gene of tobacco heat shock protein HSP22HSP22The application of the plant extract in the regulation and control of the content of tobacco leaf pigments is characterized in that the gene silencing technology is utilized to down-regulate coding genesHSP22The expression quantity of the tobacco leaves is reduced, so that the content of pigment substances in the tobacco leaves is reduced;
the pigment substances refer to: neoxanthin, violaxanthin, lutein, chlorophyll a, chlorophyll b and beta-carotene;
the coding gene of the tobacco heat shock protein HSP22HSP22The nucleotide sequence is shown in SEQ ID NO. 1.
2. The gene encoding the tobacco heat shock protein HSP22 of claim 1HSP22The application of the gene in the regulation and control of the tobacco leaf pigment substance content is characterized in that the coding gene of the tobacco heat shock protein HSP22 is prepared by PCR amplificationHSP22Then, taking cDNA of the tobacco K326 as a template and NtHSP22-F, NtHSP22-R as a primer to carry out PCR amplification;
the NtHSP22-F, NtHSP22-R primer is specifically designed as follows:
NtHSP22-F：5’-ACCGAATTCGCTCAGACTGGAAGGAAACA- 3’，
NtHSP22-R：5’-ACCGGATCCGCTTTAATGTCCTCACCACC- 3’。
3. the application of the tobacco heat shock protein HSP22 in the regulation and control of the content of the pigment substances in the tobacco leaves is characterized in that the protein is related to the content of the pigment substances in the tobacco leaves, and the content of the pigment substances in the tobacco leaves is obviously reduced after the expression level of the protein is reduced;
the pigment substances are as follows: neoxanthin, violaxanthin, lutein, chlorophyll a, chlorophyll b and beta-carotene;
the amino acid sequence of the tobacco heat shock protein HSP22 is shown in SEQ ID NO. 2.
4. Coding gene of using tobacco heat shock protein HSP22HSP22The method for breeding a new variety of tobaccoCharacterized in that the virus-induced gene silencing technique is used to interfereHSP22Silencing the gene by the expression of the gene, and screening to obtain a new tobacco variety with reduced pigment content;
the coding gene of the tobacco heat shock protein HSP22HSP22The nucleotide sequence is shown as SEQ ID NO. 1;
the pigment refers to: neoxanthin, violaxanthin, lutein, chlorophyll a, chlorophyll b and beta-carotene.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201910533362.XA CN110205330B (en) | 2019-06-19 | 2019-06-19 | Tobacco heat shock protein HSP22 and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201910533362.XA CN110205330B (en) | 2019-06-19 | 2019-06-19 | Tobacco heat shock protein HSP22 and application thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN110205330A CN110205330A (en) | 2019-09-06 |
| CN110205330B true CN110205330B (en) | 2022-05-31 |
Family
ID=67793622
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201910533362.XA Active CN110205330B (en) | 2019-06-19 | 2019-06-19 | Tobacco heat shock protein HSP22 and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN110205330B (en) |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110903371B (en) * | 2019-12-19 | 2022-06-07 | 中国烟草总公司郑州烟草研究院 | Tobacco cellobiose-related protein NtCRP1 and application thereof |
| CN111019956B (en) * | 2019-12-19 | 2022-06-10 | 中国烟草总公司郑州烟草研究院 | Tobacco protein NtPBD1 and application thereof |
| CN111019954B (en) * | 2019-12-19 | 2022-06-10 | 中国烟草总公司郑州烟草研究院 | Tobacco protein ACTB and application thereof |
| CN111533794B (en) * | 2020-06-04 | 2022-06-24 | 中国烟草总公司郑州烟草研究院 | Tobacco NtDREB-1BL1 transcription factor and application thereof |
| CN111499712B (en) * | 2020-06-04 | 2022-07-08 | 中国烟草总公司郑州烟草研究院 | Tobacco NtDREB-1BL2 transcription factor and application thereof |
| CN113151296B (en) * | 2021-03-22 | 2022-09-13 | 云南中烟工业有限责任公司 | Tobacco heat shock protein related gene and application thereof |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107099540A (en) * | 2017-07-06 | 2017-08-29 | 中国烟草总公司郑州烟草研究院 | Influence NtFERL genes and its application of tobacco pigment content |
-
2019
- 2019-06-19 CN CN201910533362.XA patent/CN110205330B/en active Active
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107099540A (en) * | 2017-07-06 | 2017-08-29 | 中国烟草总公司郑州烟草研究院 | Influence NtFERL genes and its application of tobacco pigment content |
Non-Patent Citations (4)
| Title |
|---|
| ncbi.predicted.《Genbank database》.2016, * |
| predicted;ncbi;《Genbank database》;20160503;features,origin * |
| Variegated Expression of Hsp22 Transgenic Reporters Indicates Cell-specific Patterns of Aging in Drosophila Oenocytes;John Tower et al.;《Journals of Gerontology: BIOLOGICAL SCIENCES》;20140331;第253-259页 * |
| 热休克蛋白22结构和功能研究进展;杨官品等;《中国海洋大学学报》;20090930;第965-970页 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN110205330A (en) | 2019-09-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN110205330B (en) | Tobacco heat shock protein HSP22 and application thereof | |
| CN110240640B (en) | Tobacco AUX/IAA and application thereof | |
| CN107099540B (en) | NtFERL gene influencing tobacco pigment content and application thereof | |
| CN110923251B (en) | Tobacco polyphenol oxidase NtPPO4 and application thereof | |
| CN113549639B (en) | Regulatory gene for reducing contents of total proteins and phenol in flue gas of tobacco leaves | |
| CN114014917B (en) | FvbHLH36 protein, and encoding gene and application thereof | |
| CN110938639B (en) | Tobacco ATP synthase gamma chain NtATPG and application thereof | |
| CN110862445B (en) | NtOEP1 gene influencing tobacco pigment content and application thereof | |
| CN107177604B (en) | NtWRKY69 gene influencing tobacco pigment content and application thereof | |
| CN108517324A (en) | One NtIPMD gene for influencing tobacco axillary bud differentiation | |
| CN110923244B (en) | Tobacco mitochondrial RNA editing factor NtMEF1 and application thereof | |
| CN113278640B (en) | Tobacco pullulanase gene and application thereof | |
| CN110157717B (en) | Tobacco transcriptional repressor OFP1 and application thereof | |
| CN114230651A (en) | Method for instantaneously changing color of dendrobium nobile by using DhMYB2 gene | |
| CN114672494A (en) | Application of tobacco NtEXB1 gene in plant branch development regulation | |
| CN111019955B (en) | Tobacco protein ZR-1 and application thereof | |
| CN113151315A (en) | Tobacco polyphenol metabolic pathway protein gene NtPOE and application thereof | |
| CN111019954B (en) | Tobacco protein ACTB and application thereof | |
| CN111304212B (en) | Tobacco NtYcf45-like protein and application thereof | |
| CN112391397A (en) | Tobacco flavone monooxygenase gene NtCYP75B2 and application thereof | |
| CN110819640B (en) | Tobacco NtNRP1 gene and application thereof | |
| CN113151318B (en) | Tobacco starch branching enzyme gene NtGBE1 and application thereof | |
| CN113151322B (en) | Tobacco starch synthase gene and application thereof | |
| CN111533794B (en) | Tobacco NtDREB-1BL1 transcription factor and application thereof | |
| CN113278639B (en) | Tobacco NUDIX hydrolase gene and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant |