CN107372272B - Long-acting physical sign device of cuttlefish based on endoskeleton cuttlebone - Google Patents
Long-acting physical sign device of cuttlefish based on endoskeleton cuttlebone Download PDFInfo
- Publication number
- CN107372272B CN107372272B CN201710597601.9A CN201710597601A CN107372272B CN 107372272 B CN107372272 B CN 107372272B CN 201710597601 A CN201710597601 A CN 201710597601A CN 107372272 B CN107372272 B CN 107372272B
- Authority
- CN
- China
- Prior art keywords
- shell
- cuttlefish
- inner shell
- connecting sleeve
- outer shell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 241000238371 Sepiidae Species 0.000 title claims abstract description 85
- 238000005260 corrosion Methods 0.000 claims abstract description 13
- 230000008093 supporting effect Effects 0.000 claims abstract description 12
- 239000004519 grease Substances 0.000 claims abstract description 10
- 229920001296 polysiloxane Polymers 0.000 claims abstract description 8
- 239000000565 sealant Substances 0.000 claims abstract description 4
- 239000011248 coating agent Substances 0.000 claims description 31
- 238000000576 coating method Methods 0.000 claims description 31
- 238000007789 sealing Methods 0.000 claims description 14
- 230000007797 corrosion Effects 0.000 claims description 12
- 108090000623 proteins and genes Proteins 0.000 claims description 10
- 102000004169 proteins and genes Human genes 0.000 claims description 10
- ROPDWRCJTIRLTR-UHFFFAOYSA-L calcium metaphosphate Chemical compound [Ca+2].[O-]P(=O)=O.[O-]P(=O)=O ROPDWRCJTIRLTR-UHFFFAOYSA-L 0.000 claims description 8
- TVZRAEYQIKYCPH-UHFFFAOYSA-N 3-(trimethylsilyl)propane-1-sulfonic acid Chemical compound C[Si](C)(C)CCCS(O)(=O)=O TVZRAEYQIKYCPH-UHFFFAOYSA-N 0.000 claims description 5
- 101000945318 Homo sapiens Calponin-1 Proteins 0.000 claims description 5
- 101000652736 Homo sapiens Transgelin Proteins 0.000 claims description 5
- 102100031013 Transgelin Human genes 0.000 claims description 5
- 229910000077 silane Inorganic materials 0.000 claims description 5
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 claims description 5
- -1 silane compound Chemical class 0.000 claims description 4
- 238000005507 spraying Methods 0.000 claims description 4
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 claims description 2
- ZOKXTWBITQBERF-UHFFFAOYSA-N Molybdenum Chemical compound [Mo] ZOKXTWBITQBERF-UHFFFAOYSA-N 0.000 claims description 2
- 238000004140 cleaning Methods 0.000 claims description 2
- 239000013078 crystal Substances 0.000 claims description 2
- 238000001035 drying Methods 0.000 claims description 2
- 230000007774 longterm Effects 0.000 claims description 2
- 229910052750 molybdenum Inorganic materials 0.000 claims description 2
- 239000011733 molybdenum Substances 0.000 claims description 2
- 238000005498 polishing Methods 0.000 claims description 2
- 239000000843 powder Substances 0.000 claims description 2
- 238000002360 preparation method Methods 0.000 claims description 2
- 238000001771 vacuum deposition Methods 0.000 claims description 2
- 238000007738 vacuum evaporation Methods 0.000 claims description 2
- 239000003595 mist Substances 0.000 claims 1
- 238000011160 research Methods 0.000 abstract description 7
- 239000003550 marker Substances 0.000 abstract description 6
- 238000004519 manufacturing process Methods 0.000 abstract description 3
- 230000009286 beneficial effect Effects 0.000 abstract description 2
- 230000000737 periodic effect Effects 0.000 abstract description 2
- 230000001976 improved effect Effects 0.000 description 10
- 239000007788 liquid Substances 0.000 description 10
- 241000238366 Cephalopoda Species 0.000 description 8
- 210000001519 tissue Anatomy 0.000 description 8
- 239000003292 glue Substances 0.000 description 7
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 6
- 230000002349 favourable effect Effects 0.000 description 6
- 229910052710 silicon Inorganic materials 0.000 description 6
- 239000010703 silicon Substances 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 230000002378 acidificating effect Effects 0.000 description 5
- 230000015556 catabolic process Effects 0.000 description 5
- 238000002425 crystallisation Methods 0.000 description 5
- 230000008025 crystallization Effects 0.000 description 5
- 238000006731 degradation reaction Methods 0.000 description 5
- 238000010790 dilution Methods 0.000 description 5
- 239000012895 dilution Substances 0.000 description 5
- 230000028993 immune response Effects 0.000 description 5
- 239000011435 rock Substances 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 239000010687 lubricating oil Substances 0.000 description 3
- HSJKGGMUJITCBW-UHFFFAOYSA-N 3-hydroxybutanal Chemical compound CC(O)CC=O HSJKGGMUJITCBW-UHFFFAOYSA-N 0.000 description 2
- PAPSMOYMQDWIOR-AVGNSLFASA-N Arg-Lys-Val Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O PAPSMOYMQDWIOR-AVGNSLFASA-N 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- ZOPISOXXPQNOCO-SVSWQMSJSA-N Ser-Ile-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](CO)N ZOPISOXXPQNOCO-SVSWQMSJSA-N 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- COYHRQWNJDJCNA-NUJDXYNKSA-N Thr-Thr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O COYHRQWNJDJCNA-NUJDXYNKSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 230000001588 bifunctional effect Effects 0.000 description 2
- VEVRNHHLCPGNDU-MUGJNUQGSA-O desmosine Chemical compound OC(=O)[C@@H](N)CCCC[N+]1=CC(CC[C@H](N)C(O)=O)=C(CCC[C@H](N)C(O)=O)C(CC[C@H](N)C(O)=O)=C1 VEVRNHHLCPGNDU-MUGJNUQGSA-O 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000011049 filling Methods 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- HYLBTMZBXLEVCL-UWVGGRQHSA-N (2s)-2-amino-6-[[(5s)-5-amino-5-carboxypentyl]amino]hexanoic acid Chemical compound OC(=O)[C@@H](N)CCCCNCCCC[C@H](N)C(O)=O HYLBTMZBXLEVCL-UWVGGRQHSA-N 0.000 description 1
- GGNHBHYDMUDXQB-KBIXCLLPSA-N Ala-Glu-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)N GGNHBHYDMUDXQB-KBIXCLLPSA-N 0.000 description 1
- NCQMBSJGJMYKCK-ZLUOBGJFSA-N Ala-Ser-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O NCQMBSJGJMYKCK-ZLUOBGJFSA-N 0.000 description 1
- QOIGKCBMXUCDQU-KDXUFGMBSA-N Ala-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](C)N)O QOIGKCBMXUCDQU-KDXUFGMBSA-N 0.000 description 1
- ATABBWFGOHKROJ-GUBZILKMSA-N Arg-Pro-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O ATABBWFGOHKROJ-GUBZILKMSA-N 0.000 description 1
- ZAESWDKAMDVHLL-RCOVLWMOSA-N Asn-Val-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O ZAESWDKAMDVHLL-RCOVLWMOSA-N 0.000 description 1
- JNCRAQVYJZGIOW-QSFUFRPTSA-N Asn-Val-Ile Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O JNCRAQVYJZGIOW-QSFUFRPTSA-N 0.000 description 1
- CELPEWWLSXMVPH-CIUDSAMLSA-N Asp-Asp-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC(O)=O CELPEWWLSXMVPH-CIUDSAMLSA-N 0.000 description 1
- DONWIPDSZZJHHK-HJGDQZAQSA-N Asp-Lys-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)N)O DONWIPDSZZJHHK-HJGDQZAQSA-N 0.000 description 1
- XYPJXLLXNSAWHZ-SRVKXCTJSA-N Asp-Ser-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O XYPJXLLXNSAWHZ-SRVKXCTJSA-N 0.000 description 1
- 241001474374 Blennius Species 0.000 description 1
- LGIKBBLQVSWUGK-DCAQKATOSA-N Gln-Leu-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O LGIKBBLQVSWUGK-DCAQKATOSA-N 0.000 description 1
- ZOXBSICWUDAOHX-GUBZILKMSA-N Glu-Asn-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CCC(O)=O ZOXBSICWUDAOHX-GUBZILKMSA-N 0.000 description 1
- ZHNHJYYFCGUZNQ-KBIXCLLPSA-N Glu-Ile-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCC(O)=O ZHNHJYYFCGUZNQ-KBIXCLLPSA-N 0.000 description 1
- OQXDUSZKISQQSS-GUBZILKMSA-N Glu-Lys-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O OQXDUSZKISQQSS-GUBZILKMSA-N 0.000 description 1
- BDISFWMLMNBTGP-NUMRIWBASA-N Glu-Thr-Asp Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O BDISFWMLMNBTGP-NUMRIWBASA-N 0.000 description 1
- FGGKGJHCVMYGCD-UKJIMTQDSA-N Glu-Val-Ile Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O FGGKGJHCVMYGCD-UKJIMTQDSA-N 0.000 description 1
- ICUTTWWCDIIIEE-BQBZGAKWSA-N Gly-Met-Asn Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)CN ICUTTWWCDIIIEE-BQBZGAKWSA-N 0.000 description 1
- YXBRCTXAEYSCHS-XVYDVKMFSA-N His-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC1=CN=CN1)N YXBRCTXAEYSCHS-XVYDVKMFSA-N 0.000 description 1
- JXMSHKFPDIUYGS-SIUGBPQLSA-N Ile-Glu-Tyr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)N JXMSHKFPDIUYGS-SIUGBPQLSA-N 0.000 description 1
- CAHCWMVNBZJVAW-NAKRPEOUSA-N Ile-Pro-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)O)N CAHCWMVNBZJVAW-NAKRPEOUSA-N 0.000 description 1
- ANTFEOSJMAUGIB-KNZXXDILSA-N Ile-Thr-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@@H]1C(=O)O)N ANTFEOSJMAUGIB-KNZXXDILSA-N 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- IBMVEYRWAWIOTN-UHFFFAOYSA-N L-Leucyl-L-Arginyl-L-Proline Natural products CC(C)CC(N)C(=O)NC(CCCN=C(N)N)C(=O)N1CCCC1C(O)=O IBMVEYRWAWIOTN-UHFFFAOYSA-N 0.000 description 1
- LZHJZLHSRGWBBE-IHRRRGAJSA-N Leu-Lys-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O LZHJZLHSRGWBBE-IHRRRGAJSA-N 0.000 description 1
- SVBJIZVVYJYGLA-DCAQKATOSA-N Leu-Ser-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O SVBJIZVVYJYGLA-DCAQKATOSA-N 0.000 description 1
- LJADEBULDNKJNK-IHRRRGAJSA-N Lys-Leu-Val Chemical compound CC(C)C[C@H](NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O LJADEBULDNKJNK-IHRRRGAJSA-N 0.000 description 1
- YSPZCHGIWAQVKQ-AVGNSLFASA-N Lys-Pro-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCCCN YSPZCHGIWAQVKQ-AVGNSLFASA-N 0.000 description 1
- BDFHWFUAQLIMJO-KXNHARMFSA-N Lys-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCCCN)N)O BDFHWFUAQLIMJO-KXNHARMFSA-N 0.000 description 1
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 1
- XZFYRXDAULDNFX-UHFFFAOYSA-N N-L-cysteinyl-L-phenylalanine Natural products SCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XZFYRXDAULDNFX-UHFFFAOYSA-N 0.000 description 1
- 108010002311 N-glycylglutamic acid Proteins 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- SCKXGHWQPPURGT-KKUMJFAQSA-N Phe-Lys-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O SCKXGHWQPPURGT-KKUMJFAQSA-N 0.000 description 1
- XUSDDSLCRPUKLP-QXEWZRGKSA-N Pro-Asp-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]1CCCN1 XUSDDSLCRPUKLP-QXEWZRGKSA-N 0.000 description 1
- FKLSMYYLJHYPHH-UWVGGRQHSA-N Pro-Gly-Leu Chemical compound [H]N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CC(C)C)C(O)=O FKLSMYYLJHYPHH-UWVGGRQHSA-N 0.000 description 1
- TYMBHHITTMGGPI-NAKRPEOUSA-N Pro-Ile-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@@H]1CCCN1 TYMBHHITTMGGPI-NAKRPEOUSA-N 0.000 description 1
- HRIXMVRZRGFKNQ-HJGDQZAQSA-N Pro-Thr-Gln Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O HRIXMVRZRGFKNQ-HJGDQZAQSA-N 0.000 description 1
- AJJDPGVVNPUZCR-RHYQMDGZSA-N Pro-Thr-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@@H]1CCCN1)O AJJDPGVVNPUZCR-RHYQMDGZSA-N 0.000 description 1
- HJEBZBMOTCQYDN-ACZMJKKPSA-N Ser-Glu-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O HJEBZBMOTCQYDN-ACZMJKKPSA-N 0.000 description 1
- WSTIOCFMWXNOCX-YUMQZZPRSA-N Ser-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CO)N WSTIOCFMWXNOCX-YUMQZZPRSA-N 0.000 description 1
- SFTZWNJFZYOLBD-ZDLURKLDSA-N Ser-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CO SFTZWNJFZYOLBD-ZDLURKLDSA-N 0.000 description 1
- KKKVOZNCLALMPV-XKBZYTNZSA-N Ser-Thr-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O KKKVOZNCLALMPV-XKBZYTNZSA-N 0.000 description 1
- SNXUIBACCONSOH-BWBBJGPYSA-N Ser-Thr-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CO)C(O)=O SNXUIBACCONSOH-BWBBJGPYSA-N 0.000 description 1
- BLRPTPMANUNPDV-UHFFFAOYSA-N Silane Chemical compound [SiH4] BLRPTPMANUNPDV-UHFFFAOYSA-N 0.000 description 1
- FQPQPTHMHZKGFM-XQXXSGGOSA-N Thr-Ala-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O FQPQPTHMHZKGFM-XQXXSGGOSA-N 0.000 description 1
- KGKWKSSSQGGYAU-SUSMZKCASA-N Thr-Gln-Thr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N)O KGKWKSSSQGGYAU-SUSMZKCASA-N 0.000 description 1
- XOTBWOCSLMBGMF-SUSMZKCASA-N Thr-Glu-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XOTBWOCSLMBGMF-SUSMZKCASA-N 0.000 description 1
- XOWKUMFHEZLKLT-CIQUZCHMSA-N Thr-Ile-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O XOWKUMFHEZLKLT-CIQUZCHMSA-N 0.000 description 1
- YJCVECXVYHZOBK-KNZXXDILSA-N Thr-Ile-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H]([C@@H](C)O)N YJCVECXVYHZOBK-KNZXXDILSA-N 0.000 description 1
- GVMXJJAJLIEASL-ZJDVBMNYSA-N Thr-Pro-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(O)=O GVMXJJAJLIEASL-ZJDVBMNYSA-N 0.000 description 1
- VUXIQSUQQYNLJP-XAVMHZPKSA-N Thr-Ser-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CO)C(=O)N1CCC[C@@H]1C(=O)O)N)O VUXIQSUQQYNLJP-XAVMHZPKSA-N 0.000 description 1
- IEZVHOULSUULHD-XGEHTFHBSA-N Thr-Ser-Val Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O IEZVHOULSUULHD-XGEHTFHBSA-N 0.000 description 1
- AAZOYLQUEQRUMZ-GSSVUCPTSA-N Thr-Thr-Asn Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CC(N)=O AAZOYLQUEQRUMZ-GSSVUCPTSA-N 0.000 description 1
- APQIVBCUIUDSMB-OSUNSFLBSA-N Val-Ile-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](C(C)C)N APQIVBCUIUDSMB-OSUNSFLBSA-N 0.000 description 1
- GQMNEJMFMCJJTD-NHCYSSNCSA-N Val-Pro-Gln Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(O)=O GQMNEJMFMCJJTD-NHCYSSNCSA-N 0.000 description 1
- UJMCYJKPDFQLHX-XGEHTFHBSA-N Val-Ser-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)N)O UJMCYJKPDFQLHX-XGEHTFHBSA-N 0.000 description 1
- DVLWZWNAQUBZBC-ZNSHCXBVSA-N Val-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](C(C)C)N)O DVLWZWNAQUBZBC-ZNSHCXBVSA-N 0.000 description 1
- JAIZPWVHPQRYOU-ZJDVBMNYSA-N Val-Thr-Thr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](C(C)C)N)O JAIZPWVHPQRYOU-ZJDVBMNYSA-N 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 150000001413 amino acids Chemical group 0.000 description 1
- 108010047857 aspartylglycine Proteins 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- 125000002843 carboxylic acid group Chemical group 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- 230000006835 compression Effects 0.000 description 1
- 238000007906 compression Methods 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 238000013500 data storage Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000007641 inkjet printing Methods 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 108010057846 lysinenorleucine Proteins 0.000 description 1
- 108010009298 lysylglutamic acid Proteins 0.000 description 1
- 238000000034 method Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000036651 mood Effects 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 108010031719 prolyl-serine Proteins 0.000 description 1
- 108010070643 prolylglutamic acid Proteins 0.000 description 1
- 239000012460 protein solution Substances 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 239000013535 sea water Substances 0.000 description 1
- 150000004756 silanes Chemical class 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000009182 swimming Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 108010051110 tyrosyl-lysine Proteins 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000002023 wood Substances 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K61/00—Culture of aquatic animals
- A01K61/90—Sorting, grading, counting or marking live aquatic animals, e.g. sex determination
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Zoology (AREA)
- Environmental Sciences (AREA)
- Marine Sciences & Fisheries (AREA)
- Animal Husbandry (AREA)
- Biodiversity & Conservation Biology (AREA)
- Meat, Egg Or Seafood Products (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention discloses a cuttlefish long-acting physical marking device based on endoskeleton cuttlebone, which comprises an inner shell and a frequency-transmitting chip arranged in the inner shell, wherein the inner shell is connected with an outer shell through a supporting rod and a connecting sleeve, diluted heat-conducting silicone grease is filled between the inner shell and the outer shell, a threaded plug is connected in the connecting sleeve, sealant is filled outside the threaded plug, a supporting ring is arranged between the middle surface of the inner shell and the outer shell, a spherical hole is arranged in the supporting ring, and a balancing rod is arranged in the spherical hole. The beneficial effects are that: the locator arranged on the connecting sleeve can keep locating and tracking the marked cuttlefish in real time. The device has the advantages of simple structure, easy manufacture, convenient marking, low cost, suitability for the research of large individual quantity, long effective period of the chip and capability of carrying out the periodic research on the life of the marker. The device has excellent biocompatibility, does not influence the normal growth of the cuttlefish, and has excellent anti-corrosion performance.
Description
Technical Field
The invention relates to the field of biophysical markers, in particular to a cuttlefish long-acting physical marker device based on endoskeleton cuttlebone.
Background
Cuttlefish, also known as cuttlefish, cuttlefish of the order sepiales of the phylum mollusca cephalopoda, is different from squid in that it has a boat-shaped calcareous hard sheath. The inkfish can escape by using 'ink jetting' as a method for escaping when encountering strong enemies, so that the inkfish is named as 'inkfish', and the like. The pigmented vesicles in the skin change color and size with changes in "mood". The spring end lays eggs on wood chips or seaweed. The cuttlefish jumps out of the sea and has remarkable air flight capability.
The distribution, growth and resource conditions of cuttlefish in the prior art are not clear, the cuttlefish can be marked by a commonly used technology such as PIT (particle image transfer) marking, animals are marked by the PIT marking through a radio frequency marking system, and the labels are all glass products and are nontoxic and harmless. The anti-theft label can be implanted into an animal body through injection, each animal has a unique identity card, but a PIT-marked radio frequency chip in the prior art is packaged by glass, the label can be corroded by liquid in a cuttlefish body after being injected into the cuttlefish body, the sealing performance of the label is damaged, and the cuttlefish can have immunological rejection and inflammatory reaction on the PIT label injected into the body. Although the PIT marker in the prior art is small in size, the PIT marker has a slight influence on the activity of the cuttlefish after being implanted into the body of the cuttlefish, and may influence the swimming speed of the cuttlefish and the balance of the cuttlefish in water.
Disclosure of Invention
The invention aims to provide a cuttlefish long-acting physical marking device based on endoskeleton cuttlebone, which can obtain behaviors and activity environments of cuttlefish in a natural state, has excellent biocompatibility and does not influence the normal growth of the cuttlefish.
Aiming at the problems mentioned in the background technology, the invention adopts the technical scheme that: the utility model provides a long-term physical sign device of cuttlefish based on endoskeleton cuttlebone, includes the inner shell, and the chip is penetrated with frequency that sets up in the inner shell, and the inner shell is connected with the shell through bracing piece, adapter sleeve, and it has the heat conduction silicone grease of dilution to fill between inner shell and the shell, and the adapter sleeve in-connection has the corkscrew, and the corkscrew outside is filled there is sealed glue, is equipped with the support ring between inner shell middle part surface and the shell, is equipped with spherical hole in the support ring, and. The device of the invention is designed with a double-layer shell, which can effectively prevent the inner shell from being crushed by the tissues in the body of the cuttlefish or the cuttlebone of the endoskeleton or the deep sea, so that partial liquid in the body of the cuttlefish can not normally work when entering the device, and the deep sea pressure resistance of the device can be obviously improved by filling diluted heat-conducting silicon between the outer shell and the inner shell, wherein the dilution ratio of the heat-conducting silicon grease to water is 1: 10~20, the balancing pole that is equipped with is favorable to the equilibrium of cuttlefish in aqueous, rocks about through the balancing pole both ends and still is favorable to the speed of moving about of cuttlefish, through the leakproofness of the assurance this device that the screw plug can be fine with sealed glue, avoids its inside electrical part and liquid contact.
Preferably, one end of the inner shell is connected with the outer shell through the supporting rod, the other end of the inner shell is connected with the outer shell through the connecting sleeve, the length of the connecting sleeve is 1.5-3 times of that of the supporting rod, the connecting sleeve and the supporting rod are arranged to be beneficial to keeping the stability of the inner shell in the outer shell and avoiding collision between the inner shell and the outer shell, a concave hole is formed in the surface of the connecting sleeve, a locator is arranged in the concave hole, positioning research on squids can be realized through the locator, a sealing diaphragm is arranged on the surface of the concave hole and can avoid contact between diluted heat-conducting silicone grease and the locator, so that the locator cannot work, the volume of a cavity between the outer shell and the inner shell can be finely adjusted, a thread corresponding to a threaded plug is arranged in an inner hole of the connecting sleeve, a thread matched with the threaded plug is arranged in the, after the radio frequency chip is arranged, the sealing effect of the device is further improved through the self-locking property of the threaded plug and the sealant,
preferably, the middle end of the balance rod arranged in the support ring is provided with a ball body in clearance fit with the spherical hole of the support ring, the ball body in clearance fit can rotate among the spherical holes, lubricating oil can be coated on the surface of the ball body, the swinging efficiency of the balance rod can be obviously improved, the thickness ratio of the support ring to the shell is 0.85-1: 1, the compression strength of the device is favorably improved, and the situation that the shell cracks or is cracked to damage marked cuttlefish is avoided.
The surface of the shell (1) is coated with a biocompatible corrosion-resistant coating, and the coating comprises 35-50 parts of calcium metaphosphate, 70-90 parts of active protein, 90-110 parts of silane compound and 5-10 parts of SMCC or 8-20 parts of DSS. The coating has excellent biocompatibility, after the physical marking device is placed into cuttlebone in the cuttlefish endoskeleton, the cuttlefish is slightly inflamed only at the initial stage of placement, and then the device can not trigger the immune response in the cuttlefish body, can not generate rejection phenomenon and can not influence the normal growth of the cuttlefish; the coating can adjust the degradation speed of the coating and the shell by reducing the corrosion current density of the shell and controlling the crystallization state and the tissue structure of the coating, and can well protect the shell from being corroded by acidic liquid in a cuttlefish body.
Compared with the prior art, the invention has the advantages that:
1. the double-layer shell structure can prevent the shell from being broken by strong pressure of endoskeleton cuttlebone or tissue or deep sea in the cuttlefish body to cause the abnormal work of the mark. The deep sea pressure resistance of the device can be obviously improved by filling diluted heat-conducting silicone grease between the outer shell and the inner shell, and the strength, the pressure resistance and the impact resistance of the outer shell can be obviously enhanced by the designed thickness ratio of the outer shell to the inner shell.
2. Set up the locator and can keep fixing a position the tracking in real time to mark the cuttlefish on the adapter sleeve, be equipped with the screw thread in the adapter sleeve and can be connected with the screw plug cooperation, avoid the frequency shooting chip to drop, the spheroid at balancing pole middle part and support ring clearance fit can make the spheroid rock from top to bottom along with the moving about of cuttlefish class, change the equilibrium at spheroid both ends, help promoting the equilibrium and the speed of moving about of cuttlefish, are favorable to improving the viability of mark cuttlefish.
3. The device has the advantages of simple structure, easy manufacture, convenient marking, low cost, suitability for the research of large individual quantity, long effective period of the chip and capability of carrying out the periodic research on the life of the marker.
4. The device has excellent biocompatibility, after the physical marking device is placed into cuttlebone in the cuttlefish endoskeleton, the cuttlefish is slightly inflamed only at the initial stage of placement, and then the device can not trigger the immune response in the cuttlefish body, can not generate rejection phenomenon and can not influence the normal growth of the cuttlefish; the coating can adjust the degradation speed of the coating and the shell by reducing the corrosion current density of the shell and controlling the crystallization state and the tissue structure of the coating, and can well protect the shell from being corroded by acidic liquid in a cuttlefish body.
Drawings
Fig. 1 is a sectional view of a squid long-acting physical marking device based on endoskeleton cuttlebone according to the present invention;
fig. 2 is a schematic view of a balancing rod of the cuttlefish long-acting physical marking device based on endoskeleton cuttlebone according to the present invention;
fig. 3 is an enlarged view of n parts of a cuttlefish long-acting physical marker device based on endoskeleton cuttlebone according to the present invention.
Description of reference numerals: 1, a shell; 2, an inner shell; 3, supporting the rod; 4, a frequency-emitting chip; 5, a balance bar; 6, supporting the ring; 7, limiting plates; 8 an electronic chip; 9 a locator; 10 a threaded plug; 11, sealing glue; 13 connecting sleeves; 14 thermally conductive silicone grease.
Detailed Description
The following is described in further detail in connection with the examples and the figures:
example 1:
as shown in fig. 1-3, a squid long-acting physical marking device based on endoskeleton cuttlebone comprises an inner shell 2 and a frequency-emission chip 4 arranged in the inner shell 2, one end of the inner shell 2 is connected with an outer shell 1 through a support rod 3, the other end of the inner shell is connected with the outer shell 1 through a connecting sleeve 13, the outer shell 1 and the inner shell 2 are spherical cylinders, the thickness ratio of the outer shell 1 to the inner shell 2 is 1.2:1, the length of the connecting sleeve 13 is 2 times of that of the support rod 3, a concave hole is formed in the surface of the connecting sleeve 13, a locator 9 is arranged in the concave hole, a sealing diaphragm is arranged on the surface of the concave hole, diluted heat-conducting silicone grease 14 is filled between the inner shell 2 and the outer shell 1, a threaded plug 10 is connected in the connecting sleeve 13, threads corresponding to the threaded plug 10 are arranged in an inner hole of the connecting sleeve 13, a sealant 11 is filled outside the threaded, the electronic chip 8 is arranged on the inner side of the limiting plate 7, the support ring 6 is arranged between the middle surface of the inner shell 2 and the outer shell 1, the thickness ratio of the support ring 6 to the outer shell 1 is 0.92:1, a sphere in clearance fit with a spherical hole of the support ring 6 is arranged at the middle end of the balance rod 5 arranged in the support ring 6, two ends of the sphere in the middle of the balance rod 5 are connected with balance balls through connecting rods, and the diameter ratio of the balance balls to the sphere in the middle of the balance rod 5 is 1.05: 1. The surface of the housing 1 is coated with a biocompatible corrosion protection coating comprising 50 parts calcium metaphosphate, 90 parts active protein, 95 parts silane compound and 10 parts DSS. The coating has excellent biocompatibility, after the physical marking device is placed into cuttlebone in the cuttlefish endoskeleton, the cuttlefish is slightly inflamed only at the initial stage of placement, and then the device can not trigger the immune response in the cuttlefish body, can not generate rejection phenomenon and can not influence the normal growth of the cuttlefish; the coating can adjust the degradation speed of the coating and the shell by reducing the corrosion current density of the shell and controlling the crystallization state and the tissue structure of the coating, and can well protect the shell from being corroded by acidic liquid in a cuttlefish body.
Example 2:
as shown in fig. 1 to 3, a squid long-acting physical marking device based on endoskeleton cuttlebone comprises an inner shell 2 and a radio frequency chip 4 arranged in the inner shell 2, wherein one end of the inner shell 2 is connected with the outer shell 1 through a support rod 3, the other end of the inner shell is connected with the outer shell 1 through a connecting sleeve 13, the outer shell 1 and the inner shell 2 are spherical cylinders, the thickness ratio of the outer shell 1 to the inner shell 2 is 1.2:1, a double-layer shell structure is adopted to avoid the phenomenon that the shell is extruded and broken by the endoskeleton cuttlebone or deep sea water in the squid to cause the abnormal working of a mark, the thickness ratio of the designed outer shell to the inner shell can obviously enhance the strength and the impact resistance of the outer shell, the safety sealing of the inner shell is protected, the length of the connecting sleeve 13 is 2.2 times of the support rod 3, the connecting sleeve 13 and the support rod 3 are arranged to help to maintain the stability of the inner, the surface of the connecting sleeve 13 is provided with a concave hole, the concave hole is internally provided with a locator 9, the locator can realize the locating research of the cuttlefish, the surface of the concave hole is provided with a sealing diaphragm, the sealing diaphragm can avoid the contact of diluted heat-conducting silicone grease 14 and the locator 9, the connecting sleeve 13 is internally connected with a threaded plug 10, the outer side of the threaded plug 10 is filled with sealing glue 11, the inner hole of the connecting sleeve 13 is provided with threads corresponding to the threaded plug 10, the inner hole of the connecting sleeve is provided with threads matched with the threaded plug, compared with the sealing glue sealing adopted in the prior art, the sealing performance of the device can be enhanced by adopting threaded connection, a support ring 6 is arranged between the middle surface of the inner shell 2 and the outer shell 1, the thickness ratio of the support ring 6 to the outer shell 1 is 0.92:1, the compressive strength of the device can be improved, the damage of the marked cuttlefish caused by the crack or the fragmentation of the outer, the balls in clearance fit can rotate between the spherical holes, the two ends of the ball in the middle of the balancing rod 5 are connected with the balancing balls through the connecting rods, the diameter ratio of the ball in the middle of the balancing ball to the balancing rod 5 is 1:1, the designed ball and the supporting ring 6 in clearance fit can enable the ball to swing up and down along with the movement of the cuttlefish, the balance of the two ends of the ball is changed, the balance of the device in the cuttlefish body is favorably improved, the balance performance of the cuttlefish is improved, and when the balancing rod is assembled, lubricating oil can be coated on the surface of the ball, and the swing efficiency of the balancing rod is improved.
The device of the invention is designed with a double-layer shell, which can effectively prevent the inner shell 2 from being crushed by the tissues in the cuttlefish body or the cuttlebone of the endoskeletons or the deep sea, so that partial liquid in the cuttlefish body can not normally work after entering the device, and the diluted heat-conducting silicon 14 is filled between the outer shell 1 and the inner shell 2, so that the deep sea pressure resistance of the device can be obviously improved, and the dilution ratio of the heat-conducting silicon 14 to water is 1: 10, the balancing pole that is equipped with is favorable to the equilibrium of cuttlefish in aqueous, rocks about through the balancing pole both ends and still is favorable to the speed of moving about of cuttlefish, through the leakproofness of threaded plug and sealed glue assurance this device that can be fine, avoids its inside electrical part and liquid contact.
The surface of the shell 1 is coated with a biocompatible corrosion protection coating comprising 45 parts of calcium metaphosphate, 80 parts of active protein, 100 parts of silane compound and 7 parts of SMCC. The coating has excellent biocompatibility, after the physical marking device is placed into cuttlebone in the cuttlefish endoskeleton, the cuttlefish is slightly inflamed only at the initial stage of placement, and then the device can not trigger the immune response in the cuttlefish body, can not generate rejection phenomenon and can not influence the normal growth of the cuttlefish; the coating can adjust the degradation speed of the coating and the shell by reducing the corrosion current density of the shell and controlling the crystallization state and the tissue structure of the coating, and can well protect the shell from being corroded by acidic liquid in a cuttlefish body.
Example 3:
this device is implementing the during operation, arrest the squid, carry out biological sample collection after catching, and put into limiting plate 7 inboardly after with data storage to electronic chip 8, limiting plate 7 can be equipped with a parking space in inner shell 2, can place all kinds of little detectors or chips, it avoids taking place the striking damage to restrict its displacement, put into frequently shooting chip 4 again, accomplish after frequently shooting chip 4 fixed inject adapter sleeve 13 with the thread plug in, and fill sealed glue 11 in the thread plug 10 outside, accomplish the sealing to this device, the device fills the heat conduction silicon 14 of dilution between outer shell 1 and inner shell 2 in the manufacturing process, can show the deep sea compressive capacity who improves this device, the dilution ratio of heat conduction silicon grease 14 and water is 1: 15, the length of this device, diameter are rice grain size or slightly big, and the cuttlefish size customization that specific size was marked as required is put into the cuttlefish internally. The shell 1 is coated with a biocompatible corrosion-resistant coating, the biocompatibility of the coating is excellent, after the physical marking device is placed into cuttlebone in the cuttlefish inner skeleton, the cuttlefish is slightly inflamed only at the initial stage of placement, the immune response in the cuttlefish body cannot be triggered by the physical marking device, the rejection phenomenon cannot occur, and the normal growth of the cuttlefish is not influenced; the coating can adjust the degradation speed of the coating and the shell by reducing the corrosion current density of the shell and controlling the crystallization state and the tissue structure of the coating, and can well protect the shell from being corroded by acidic liquid in a cuttlefish body.
The surface of the shell 1 is coated with a biocompatible corrosion-resistant coating, and the most preferable preparation method of the coating is as follows:
1) polishing the outer surface of the shell to 1500#, ultrasonically cleaning with absolute ethyl alcohol for 15min, and drying with cold air;
2) 4.5g of calcium metaphosphate powder is placed on a molybdenum boat, and amorphous calcium metaphosphate is deposited on the surface of the polished shell by a vacuum evaporation method;
3) placing the shell subjected to vacuum evaporation in a vacuum furnace, and carrying out crystal bloom treatment for 55h at the temperature of 450 ℃;
4) the first solution was sprayed onto the skin by gas phase spraying followed by spraying the second solution onto the skin, which was kept in a mist-air interface until it was completely covered with a thin layer of the solution (the entire surface was wetted for about 30 min), and then allowed to dry naturally. The molecules other than the reacted species, byproducts, and cross-linked active proteins on the surface are removed by washing the surface. The first solution was 12.5mg/mL PBS (phosphate buffered silane, 8g NaCl, 0.2g KCl, 1.44g Na)2HPO4And 0.24gKH2PO4Dissolving in 800mLdH2O, pH 7.4); the second solution was a 10mg/mL active protein solution (0.7 g SMCC or 1.3g DSS dissolved in 800 mLdH)2In O). The amino acid sequence of the active protein is RKVNVGEKATSVSGTKPDVRKVNVIITPDDKEDSYKPVQLQLSVHACFEVISTSIPSTTTVPQTASSAVITTAEVTPTPTATPEISTETTQTLKVSSGKVTTPTQVSTTSPSPGLSITTIATTTPICEETDGMNSITTIPSTEITTNDKTAEIENLRPSSKTPFKSSEDKLVIEYVPTKT are provided. Active proteins are cross-linked to form cross-linked active proteins by several bifunctional and tetrafunctional cross-links (bifunctional lysine-norleucine and-aldelysine aldol and tetrafunctional desmosine (desmosine) cross-links) in the presence of SMCC or DSS, silanes are covalently coupled to the protein molecules via carboxylic acid groups, aldehydes or esters. The cross-linked protein molecules are not broken in the life period of the cuttlefish, are relatively fixed components in connective tissues during the survival period of the cuttlefish, and have excellent biocompatibility.
After the cuttlefish body is placed into to the device, can follow the research according to locator 9 to the cuttlefish of mark, be equipped with support ring 6 between 2 middle part surfaces of inner shell and the shell 1, 5 middle-ends of the balancing pole of settling in the support ring 6 are equipped with the spheroid with 6 spherical hole clearance fit of support ring, can be at spheroid surface coating lubricating oil, improve the swing efficiency of balancing pole 5, the spheroid of design and 6 clearance fit of support ring can make the spheroid rock up and down along with the play of cuttlefish, change the equilibrium at spheroid both ends, be favorable to promoting this device equilibrium in the cuttlefish body and then promote the equilibrium performance and the speed of moving about of cuttlefish, improve the cuttlefish survival rate of mark, when the cuttlefish of course at the localization tracking mark, can be close to the cuttlefish back through the code reader and directly read data wherein, need not take.
The length of the connecting sleeve 13 is not limited to 1.5-3 times of the supporting rod 3, but also can be 1.5 times, 1.51 times, 1.52 times, 1.53 times, 1.54 times, … … times, 2.99 times or 3 times; the thickness ratio of the support ring 6 to the shell 1 is not limited to 0.85-1: 1, but also can be 0.85: 1 or 0.86: 1 or 0.87: 1 or 0.88: 1 … … or 0.99 or 1: 1; the diameter ratio of the balance balls at the two ends of the balance rod 5 to the ball body in the middle of the balance rod 5 is not limited to 1-1.2: 1, and can be 1:1 or 1.01: 1 or 1.02: 1 or 1.03: 1 … … or 1.19: 1 or 1.2: 1; the thickness ratio of the outer shell 1 to the inner shell 2 is not limited to 1-1.4: 1, and can be 1:1 or 1.01: 1 or 1.02: 1 or 1.03: 1 or 1.04: 1 … … or 1.4: 1; the included angle between the limiting plate 7 and the inner wall of the inner shell 2 is not limited to 30 degrees to 52 degrees, and also comprises 30 degrees, 30.1 degrees, 30.2 degrees, 30.3 degrees, … … degrees, 51.9 degrees or 52 degrees.
Conventional operations in the operation steps of the present invention are well known to those skilled in the art and will not be described herein.
The embodiments described above are intended to illustrate the technical solutions of the present invention in detail, and it should be understood that the above-mentioned embodiments are only specific embodiments of the present invention, and are not intended to limit the present invention, and any modification, supplement or similar substitution made within the scope of the principles of the present invention should be included in the protection scope of the present invention.
SEQUENCE LISTING
<110> Zhejiang ocean university
<120> cuttlebone-based long-acting physical marking device for cuttlefish
<130>1
<160>1
<170>PatentIn version 3.5
<210>1
<211>180
<212>PRT
<213> Artificial Synthesis
<400>1
Arg Lys Val Asn Val Gly Glu Lys Ala Thr Ser Val Ser Gly Thr Lys
1 5 10 15
Pro Asp Val Arg Lys Val Asn Val Ile Ile Thr Pro Asp Asp Lys Glu
20 25 30
Asp Ser Tyr Lys Pro Val Gln Leu Gln Leu Ser Val His Ala Cys Phe
35 40 45
Glu Val Ile Ser Thr Ser Ile Pro Ser Thr Thr Thr Val Pro Gln Thr
50 55 60
Ala Ser Ser Ala Val Ile Thr Thr Ala Glu Val Thr Pro Thr Pro Thr
65 70 75 80
Ala Thr Pro Glu Ile Ser Thr Glu Thr Thr Gln Thr Leu Lys Val Ser
85 90 95
Ser Gly Lys Val Thr Thr Pro Thr Gln Val Ser Thr Thr Ser Pro Ser
100 105 110
Pro Gly Leu Ser Ile Thr Thr Ile Ala Thr Thr Thr Pro Ile Cys Glu
115 120 125
Glu Thr Asp Gly Met Asn Ser Ile Thr Thr Ile Pro Ser Thr Glu Ile
130 135 140
Thr Thr Asn Asp Lys Thr Ala Glu Ile Glu Asn Leu Arg Pro Ser Ser
145 150 155 160
Lys Thr Pro Phe Lys Ser Ser Glu Asp Lys Leu Val Ile Glu Tyr Val
165 170 175
Pro Thr Lys Thr
180
Claims (3)
1. The utility model provides a long-term physical sign device of cuttlefish based on endoskeleton cuttlebone, includes inner shell (2) and frequency that sets up in inner shell (2) penetrates chip (4), its characterized in that: the inner shell (2) is connected with the outer shell (1) through a support rod (3) and a connecting sleeve (13); diluted heat-conducting silicone grease (14) is filled between the inner shell (2) and the outer shell (1); a threaded plug (10) is connected in the connecting sleeve (13); the outer side of the threaded plug (10) is filled with a sealant (11); a support ring (6) is arranged between the middle surface of the inner shell (2) and the outer shell (1); a spherical hole is arranged in the support ring (6); a balancing rod (5) is arranged in the spherical hole;
one end of the inner shell (2) is connected with the outer shell (1) through the supporting rod (3), the other end of the inner shell is connected with the outer shell (1) through the connecting sleeve (13), the length of the connecting sleeve (13) is 1.5-3 times of that of the supporting rod (3), a concave hole is formed in the surface of the connecting sleeve (13), a locator (9) is arranged in the concave hole, a sealing diaphragm is arranged on the surface of the concave hole, and a thread corresponding to the threaded plug (10) is arranged in an inner hole of the connecting sleeve (13);
a sphere in clearance fit with a spherical hole of the support ring (6) is arranged at the middle end of a balance rod (5) arranged in the support ring (6), and the thickness ratio of the support ring (6) to the shell (1) is 0.85-1: 1;
the surface of the shell (1) is coated with a biocompatible corrosion-resistant coating, and the coating comprises 35-50 parts of calcium metaphosphate, 70-90 parts of active protein, 90-110 parts of silane compound and 5-10 parts of SMCC or 8-20 parts of DSS;
the balance rod (5) is provided with a ball body in the middle, two ends of the balance rod are connected with balance balls through connecting rods, and the diameter ratio of the balance balls to the ball body in the middle of the balance rod (5) is 1-1.2: 1;
the surface of the shell (1) is coated with a biocompatible corrosion-resistant coating, and the preparation method of the coating comprises the following steps:
1) polishing the outer surface of the shell to 1500#, ultrasonically cleaning with absolute ethyl alcohol for 15min, and drying with cold air;
2) 4.5g of calcium metaphosphate powder is placed on a molybdenum boat, and amorphous calcium metaphosphate is deposited on the surface of the polished shell by a vacuum evaporation method;
3) placing the shell subjected to vacuum evaporation in a vacuum furnace, and carrying out crystal bloom treatment for 55h at the temperature of 450 ℃;
4) the first solution was sprayed onto the casing by gas phase spraying, followed by spraying the first solution onto the casing, which was kept in a mist air interface until it was completely covered with a thin layer of the solution, the entire surface was wetted for about 30min, and then dried naturally.
2. The endoskeleton cuttlebone-based long-acting physical marking device for cuttlefish according to claim 1, wherein: the outer shell (1) and the inner shell (2) are spherical cylinders, and the thickness ratio of the outer shell (1) to the inner shell (2) is 1-1.4: 1.
3. The endoskeleton cuttlebone-based long-acting physical marking device for cuttlefish according to claim 1, wherein: the inner wall of one end, close to the end provided with the connecting sleeve (13), of the inner shell (2) is connected with a limiting plate (7), the included angle between the limiting plate (7) and the inner wall ranges from 30 degrees to 52 degrees, and an electronic chip (8) is arranged on the inner side of the limiting plate (7).
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710597601.9A CN107372272B (en) | 2017-07-21 | 2017-07-21 | Long-acting physical sign device of cuttlefish based on endoskeleton cuttlebone |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710597601.9A CN107372272B (en) | 2017-07-21 | 2017-07-21 | Long-acting physical sign device of cuttlefish based on endoskeleton cuttlebone |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN107372272A CN107372272A (en) | 2017-11-24 |
| CN107372272B true CN107372272B (en) | 2020-10-13 |
Family
ID=60336461
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710597601.9A Active CN107372272B (en) | 2017-07-21 | 2017-07-21 | Long-acting physical sign device of cuttlefish based on endoskeleton cuttlebone |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107372272B (en) |
Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5482008A (en) * | 1991-09-13 | 1996-01-09 | Stafford; Rodney A. | Electronic animal identification system |
| CN101491225A (en) * | 2009-02-19 | 2009-07-29 | 浙江海洋学院 | Rearing method capable of increasing cuttlebone medical value of Sepiella maindroni |
| CN101743918A (en) * | 2009-12-20 | 2010-06-23 | 浙江海洋学院 | Subcutaneous alizarin red S marking method for sepiella maindroni and special marking reagent thereof |
| CN101946733A (en) * | 2010-08-24 | 2011-01-19 | 浙江海洋学院 | RFID mark special for cuttlefish |
| CN102265798A (en) * | 2011-06-24 | 2011-12-07 | 浙江海洋学院 | Sepia cuttlebone tetracycline labeling method and special reagents thereof |
| CN102939925A (en) * | 2012-11-15 | 2013-02-27 | 浙江海洋学院 | Cuttlefish releasing population reinforcing device |
| CN102939926A (en) * | 2012-11-15 | 2013-02-27 | 浙江海洋学院 | Calibration production line of cuttlefish releasing population reinforcing device |
| CN203194298U (en) * | 2012-11-15 | 2013-09-18 | 浙江海洋学院 | Squid intensification label |
-
2017
- 2017-07-21 CN CN201710597601.9A patent/CN107372272B/en active Active
Patent Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5482008A (en) * | 1991-09-13 | 1996-01-09 | Stafford; Rodney A. | Electronic animal identification system |
| CN101491225A (en) * | 2009-02-19 | 2009-07-29 | 浙江海洋学院 | Rearing method capable of increasing cuttlebone medical value of Sepiella maindroni |
| CN101743918A (en) * | 2009-12-20 | 2010-06-23 | 浙江海洋学院 | Subcutaneous alizarin red S marking method for sepiella maindroni and special marking reagent thereof |
| CN101946733A (en) * | 2010-08-24 | 2011-01-19 | 浙江海洋学院 | RFID mark special for cuttlefish |
| CN102265798A (en) * | 2011-06-24 | 2011-12-07 | 浙江海洋学院 | Sepia cuttlebone tetracycline labeling method and special reagents thereof |
| CN102939925A (en) * | 2012-11-15 | 2013-02-27 | 浙江海洋学院 | Cuttlefish releasing population reinforcing device |
| CN102939926A (en) * | 2012-11-15 | 2013-02-27 | 浙江海洋学院 | Calibration production line of cuttlefish releasing population reinforcing device |
| CN203194298U (en) * | 2012-11-15 | 2013-09-18 | 浙江海洋学院 | Squid intensification label |
Also Published As
| Publication number | Publication date |
|---|---|
| CN107372272A (en) | 2017-11-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Voets | From ice-binding proteins to bio-inspired antifreeze materials | |
| Xu et al. | Anti-freezing multiphase gel materials: bioinspired design strategies and applications | |
| Friedman et al. | Fine structure and composition of the zoogloeal matrix surrounding Zoogloea ramigera | |
| Pearson et al. | Thermoregulation of lizards and toads at high altitudes in Peru | |
| Litzgus et al. | Phenology and ecology of hibernation in spotted turtles (Clemmys guttata) near the northern limit of their range | |
| CN101548671B (en) | Method for keeping color of dried flower and keeping color solution | |
| KR890004721A (en) | Lyophilized, stable formulation containing growth factors | |
| JP2004505024A5 (en) | ||
| CN107372272B (en) | Long-acting physical sign device of cuttlefish based on endoskeleton cuttlebone | |
| Adler et al. | Orientation in a desert lizard (Uma notata): time-compensated compass movement and polarotaxis | |
| ES2316348T3 (en) | COMPOSITIONS TO PROTECT FROZEN PLANTS AND / OR FREEZES AND METHODS FOR APPLICATION. | |
| Stone et al. | Structural and biochemical changes in loblolly pine (Pinus taeda L.) seeds during germination and early-seedling growth. I. Storage protein reserves | |
| Reinhoud et al. | Cryopreservation of undifferentiated plant cells | |
| Suh et al. | Feasibility of red tide detection around Korean waters using satellite remote sensing | |
| Goszczyński et al. | Activity of badgers (Meles meles) in Central Poland | |
| CN104982456B (en) | Method for delaying blossoming of kernel-apricots as well as blossoming-delaying solution and preparation method of blossoming-delaying solution | |
| Jensen et al. | Chloroplast membrane damage during freezing: the lipid phase | |
| CN107156105A (en) | A kind of small insects external genital organs persistence method | |
| CN101228867B (en) | Human body cryoprotectant resurrection liquid | |
| Bagni et al. | Polyamines as growth substances in higher plants | |
| CN107439452A (en) | One kind is used for tuna metal magnetic line mark | |
| Juang et al. | Direct evidence of the symplastic pathway in the trap of the bladderwort Utricularia gibba L. | |
| CN108143744A (en) | A kind of low-temperature resistance stress protective agent for amphibian animal artificial hibernation | |
| CN107318739A (en) | A kind of abyssal fishes metal magnetic line mark | |
| Parsons et al. | Microsprinkler irrigation for cold protection of Florida citrus |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant |