CN105541990A - Aptamers K15 of skate angiogenesis inhibitor 1 and screening method and application of aptamers K15 - Google Patents
Aptamers K15 of skate angiogenesis inhibitor 1 and screening method and application of aptamers K15 Download PDFInfo
- Publication number
- CN105541990A CN105541990A CN201610102329.8A CN201610102329A CN105541990A CN 105541990 A CN105541990 A CN 105541990A CN 201610102329 A CN201610102329 A CN 201610102329A CN 105541990 A CN105541990 A CN 105541990A
- Authority
- CN
- China
- Prior art keywords
- aptamers
- functional zone
- albumen
- aptamer
- ray angiostatin
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108091023037 Aptamer Proteins 0.000 title claims abstract description 33
- 238000012216 screening Methods 0.000 title claims description 18
- VEEGZPWAAPPXRB-BJMVGYQFSA-N (3e)-3-(1h-imidazol-5-ylmethylidene)-1h-indol-2-one Chemical compound O=C1NC2=CC=CC=C2\C1=C/C1=CN=CN1 VEEGZPWAAPPXRB-BJMVGYQFSA-N 0.000 title abstract 3
- 229940121369 angiogenesis inhibitor Drugs 0.000 title abstract 3
- 239000004037 angiogenesis inhibitor Substances 0.000 title abstract 3
- 238000000034 method Methods 0.000 title description 8
- 108091034117 Oligonucleotide Proteins 0.000 claims abstract description 25
- 102000012936 Angiostatins Human genes 0.000 claims description 35
- 108010079709 Angiostatins Proteins 0.000 claims description 35
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 claims description 35
- 108090000623 proteins and genes Proteins 0.000 abstract description 15
- 102000004169 proteins and genes Human genes 0.000 abstract description 13
- 238000002360 preparation method Methods 0.000 abstract description 8
- 108020004414 DNA Proteins 0.000 description 36
- 102000053602 DNA Human genes 0.000 description 19
- 239000012148 binding buffer Substances 0.000 description 11
- 239000007788 liquid Substances 0.000 description 11
- 230000003321 amplification Effects 0.000 description 8
- 238000003199 nucleic acid amplification method Methods 0.000 description 8
- 239000006228 supernatant Substances 0.000 description 8
- 238000007846 asymmetric PCR Methods 0.000 description 7
- 238000005516 engineering process Methods 0.000 description 7
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 7
- 239000000243 solution Substances 0.000 description 5
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 4
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 4
- 239000012153 distilled water Substances 0.000 description 4
- PXFBZOLANLWPMH-UHFFFAOYSA-N 16-Epiaffinine Natural products C1C(C2=CC=CC=C2N2)=C2C(=O)CC2C(=CC)CN(C)C1C2CO PXFBZOLANLWPMH-UHFFFAOYSA-N 0.000 description 3
- SHIBSTMRCDJXLN-UHFFFAOYSA-N Digoxigenin Natural products C1CC(C2C(C3(C)CCC(O)CC3CC2)CC2O)(O)C2(C)C1C1=CC(=O)OC1 SHIBSTMRCDJXLN-UHFFFAOYSA-N 0.000 description 3
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- QONQRTHLHBTMGP-UHFFFAOYSA-N digitoxigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C1=CC(=O)OC1 QONQRTHLHBTMGP-UHFFFAOYSA-N 0.000 description 3
- SHIBSTMRCDJXLN-KCZCNTNESA-N digoxigenin Chemical compound C1([C@@H]2[C@@]3([C@@](CC2)(O)[C@H]2[C@@H]([C@@]4(C)CC[C@H](O)C[C@H]4CC2)C[C@H]3O)C)=CC(=O)OC1 SHIBSTMRCDJXLN-KCZCNTNESA-N 0.000 description 3
- 238000001556 precipitation Methods 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- LTMHDMANZUZIPE-AMTYYWEZSA-N Digoxin Natural products O([C@H]1[C@H](C)O[C@H](O[C@@H]2C[C@@H]3[C@@](C)([C@@H]4[C@H]([C@]5(O)[C@](C)([C@H](O)C4)[C@H](C4=CC(=O)OC4)CC5)CC3)CC2)C[C@@H]1O)[C@H]1O[C@H](C)[C@@H](O[C@H]2O[C@@H](C)[C@H](O)[C@@H](O)C2)[C@@H](O)C1 LTMHDMANZUZIPE-AMTYYWEZSA-N 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 102000001554 Hemoglobins Human genes 0.000 description 2
- 108010054147 Hemoglobins Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 229940120638 avastin Drugs 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 210000003711 chorioallantoic membrane Anatomy 0.000 description 2
- 230000004087 circulation Effects 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- LTMHDMANZUZIPE-PUGKRICDSA-N digoxin Chemical compound C1[C@H](O)[C@H](O)[C@@H](C)O[C@H]1O[C@@H]1[C@@H](C)O[C@@H](O[C@@H]2[C@H](O[C@@H](O[C@@H]3C[C@@H]4[C@]([C@@H]5[C@H]([C@]6(CC[C@@H]([C@@]6(C)[C@H](O)C5)C=5COC(=O)C=5)O)CC4)(C)CC3)C[C@@H]2O)C)C[C@@H]1O LTMHDMANZUZIPE-PUGKRICDSA-N 0.000 description 2
- 229960005156 digoxin Drugs 0.000 description 2
- LTMHDMANZUZIPE-UHFFFAOYSA-N digoxine Natural products C1C(O)C(O)C(C)OC1OC1C(C)OC(OC2C(OC(OC3CC4C(C5C(C6(CCC(C6(C)C(O)C5)C=5COC(=O)C=5)O)CC4)(C)CC3)CC2O)C)CC1O LTMHDMANZUZIPE-UHFFFAOYSA-N 0.000 description 2
- 230000000694 effects Effects 0.000 description 2
- 229960002949 fluorouracil Drugs 0.000 description 2
- 238000010438 heat treatment Methods 0.000 description 2
- 238000011580 nude mouse model Methods 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- YRNWIFYIFSBPAU-UHFFFAOYSA-N 4-[4-(dimethylamino)phenyl]-n,n-dimethylaniline Chemical compound C1=CC(N(C)C)=CC=C1C1=CC=C(N(C)C)C=C1 YRNWIFYIFSBPAU-UHFFFAOYSA-N 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 108010058905 CD44v6 antigen Proteins 0.000 description 1
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 description 1
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- IOVCWXUNBOPUCH-UHFFFAOYSA-M Nitrite anion Chemical compound [O-]N=O IOVCWXUNBOPUCH-UHFFFAOYSA-M 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 108010006785 Taq Polymerase Proteins 0.000 description 1
- 108010074506 Transfer Factor Proteins 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 239000002870 angiogenesis inducing agent Substances 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- 238000013016 damping Methods 0.000 description 1
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 1
- 229960005542 ethidium bromide Drugs 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 238000003304 gavage Methods 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000031700 light absorption Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 210000004088 microvessel Anatomy 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 229940005654 nitrite ion Drugs 0.000 description 1
- -1 nitrite ions Chemical class 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- LCCNCVORNKJIRZ-UHFFFAOYSA-N parathion Chemical compound CCOP(=S)(OCC)OC1=CC=C([N+]([O-])=O)C=C1 LCCNCVORNKJIRZ-UHFFFAOYSA-N 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 239000012460 protein solution Substances 0.000 description 1
- 238000012207 quantitative assay Methods 0.000 description 1
- 238000004153 renaturation Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M sodium chloride Inorganic materials [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 230000004862 vasculogenesis Effects 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/461—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/115—Aptamers, i.e. nucleic acids binding a target molecule specifically and with high affinity without hybridising therewith ; Nucleic acids binding to non-nucleic acids, e.g. aptamers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/16—Aptamers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/10—Applications; Uses in screening processes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/10—Applications; Uses in screening processes
- C12N2320/13—Applications; Uses in screening processes in a process of directed evolution, e.g. SELEX, acquiring a new function
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2330/00—Production
- C12N2330/30—Production chemically synthesised
- C12N2330/31—Libraries, arrays
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Wood Science & Technology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Toxicology (AREA)
- Plant Pathology (AREA)
- Gastroenterology & Hepatology (AREA)
- Microbiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention provides a set of aptamers capable of recognizing protein in a functional zone of a skate angiogenesis inhibitor 1 and a preparation method of the aptamers. Oligonucleotide sequences comprise SEQ ID No.2-11. The aptamers have high affinity specificity and can be used for detecting the protein in the functional zone of the skate angiogenesis inhibitor 1.
Description
Technical field
The invention belongs to biological technical field, specifically, the present invention relates to a kind of ray Angiostatin 1 aptamer and screening method thereof and application.
Background technology
In the last few years, oligonucleotide aptamer was as the promising alternative molecule of antibody molecule, and its research is comparatively noticeable.Oligonucleotide aptamer is obtained by SELEX technology (Systematicevolutionofligandsbyexponentialenrichment) biological libraries technology screening, the principle of this technology utilizes Protocols in Molecular Biology exactly, build the strand random oligonucleotide library of synthetic, its stochastic sequence length is about 20-100 base.Utilize the characteristic that single stranded oligonucleotide molecular configurations is flexible and changeable, random oligonucleotide library and target molecule are interacted, retain the oligonucleotide be combined with target molecule with spatial conformation, through repeated amplification, screen several circulation, can make to obtain enrichment with the oligonucleotide sequence of this target specific combination, specific oligonucleotide acid aptamer, the i.e. aptamer of the multiple target molecule of final acquisition.Pattern and the protein antibodies of the aptamer identification molecule utilizing SELEX technology screening to obtain are similar, but compared with protein antibody, nucleic acid aglucon has more superiority, if do not limited by immune condition and immunogenicity, can external synthetic, Denaturation and Renaturation is reversible, can modify and be conducive to long-term preservation and room temperature transport etc.The more important thing is, aptamer has higher specificity than antibody, even can identify the undistinguishable protein molecule of monoclonal antibody.And the target molecule of aptamer widely, little of dye molecule, large to complete virion and bacterial pathogens, even complete cell also can go out the oligonucleotide aptamer of high-affinity by abatement SELEX technology screening.
Ray Angiostatin 1 functional zone are hereinafter referred to as ray functional zone, and ray Angiostatin 1 is the protein (molecular weight 42KD) that we separate first from a kind of ray tissue of South China Sea.Result of study shows: that ray Angiostatin 1 significantly suppresses chick chorioallantoic membrane itself and that KB cell is induced chick chorioallantoic membrane vasculogenesis; Be growth and the transfer that abdominal injection or gavage all significantly suppress nude mouse Lewis lung cancer, reduce tumor tissues microvessel density, lower the expression of angiogenic factors VEGF; Also high inhibition effect is had to the transfer of nude mouse Melanoma B16 cell; Lower the expression of short transfer factor CD44v6 and ErBb2; With more remarkable effect during 5 FU 5 fluorouracil (5-FU) combined utilization.The action target spot of ray Angiostatin 1 is different from the PTS Avastin that gene engineering institute of the U.S. develops.Avastin is gene engineering product, and be the antibody of VEGF, its action target spot is VEGF; Ray Angiostatin 1 is natural product, and it not only acts on VEGF, also acts on bFGF and PDGF.Therefore, carrying out specific discriminating and screening for ray Angiostatin 1 functional zone is the consistent pursuit in this area.
Based on above consideration, the present invention is target protein for the purpose of the albumen of ray Angiostatin 1 functional zone, adopt SELEX technology to obtain the special aptamer of 10 ray Angiostatin 1 functional zone albumen, Combination application can rapidly, sensitivity, special ray Angiostatin 1 functional zone albumen detected.Due to the stable performance of single strand dna oligonucleotide aptamer, synthesis convenient and cheap, modified after can be directly used in fluorescence or chemoluminescence, chromophoric method detects target bandage, therefore simple to operate, direct.
Summary of the invention
The object of the present invention is to provide not only to have and detect quick, simple to operate, stability higher than features such as antibody, and preparation method easily, shorter one group of preparation cycle can identify oligonucleotide sequence of ray Angiostatin 1 functional zone albumen and preparation method thereof.
The described oligonucleotide sequence that can identify ray Angiostatin 1 functional zone albumen, comprises SEQIDNo.2-11, and an employing oligonucleotide sequence wherein just can complete the recognition detection to ray Angiostatin 1 functional zone albumen;
Described one group can identify that the preparation method of the oligonucleotide sequence of ray Angiostatin 1 functional zone albumen comprises the following steps:
1, the ssDNA oligonucleotide library (5 '-TCAGTCGCTTCGCCGTCTCCTTC----for screening is synthesized
N35----GCACAAGAGGGAGACCCCAGAGGG-3 '), wherein N35 is 35 random oligonucleotides;
2, carry out SELEX screening after being mixed with ray Angiostatin 1 functional zone albumen respectively by oligonucleotide library, obtain aptamer enriched library;
3, after SELEX has screened, cloning and sequencing is carried out to the aptamer enriched library obtained;
4, select the height copy ssDNA occurred in sequencing result, carry out affine specific checking, screening obtains the oligonucleotide sequence that can identify ray Angiostatin 1 functional zone albumen.
Embodiment
Embodiment 1
1, the preparation of ray Angiostatin 1 functional zone albumen
Adopt the recombinant expressed mode of yeast well known to those skilled in the art to obtain and have bioactive ray Angiostatin 1 functional zone identical with ray Angiostatin 1 functional zone albumen albumen, this protein sequence is as shown in SEQIDNO:1; The concentration of protein solution is 15mg/ml.
2, the synthesis of library and primer
2.1, the ssDNA oligonucleotide library (5 '-TCAGTCGCTTCGCCGTCTCCTTC----for screening is synthesized
N35----GCACAAGAGGGAGACCCCAGAGGG-3 '), wherein N35 is 35 random oligonucleotides;
Primer P1:TCAGTCGCTTCGCCGTCTCCTTC;
Primer P2:CCCTCTGGGGTCTCCCTCTTGTGC.
2.2, the SELEX screening of aptamer, concrete grammar is as follows:
2.2.1ssDNA with the combination of ray Angiostatin 1 functional zone albumen, be separated, concrete grammar is as follows:
Get the ssDNA oligonucleotide library 4 μ L of 100 μMs, 100 μ l are diluted to 2 × binding buffer liquid, 95 DEG C of sex change 5min, 100 μ l ray Angiostatin 1 functional zone albumen are added after ice bath 10min, shaking table is in conjunction with 30min, the more centrifugal 5min of 6000rpm, abandons supernatant, then use 1 × binding buffer liquid to wash precipitation, abandon supernatant; 1 × binding buffer liquid 100 μ L is added again, 96 DEG C of heating 5min, the then centrifugal 10min of 15000rpm in precipitation, get supernatant liquor, to precipitation heating centrifugal again, merge supernatant liquor, then separablely obtain ssDNA the level library having avidity with ray Angiostatin 1 functional zone albumen; Described 2 × binding buffer liquid is that 20 × binding buffer liquid distilled water dilutes the solution after 10 times, and described 1 × binding buffer liquid is that 20 × binding buffer liquid distilled water dilutes the solution after 20 times; Described 20 × binding buffer liquid formula is 1MNaCl, 50mMKCl, 500mMTris-HCl, 10mMMgCl2, pH7.4.
2.2.2ssDNA with the combination of ray Angiostatin 1 functional zone albumen, be separated, concrete grammar is as follows:
By step 2.2.1 be separated obtain can with the protein bound ssDNA in ray Angiostatin 1 functional zone, again with 100 μ l ray Angiostatin 1 functional zone albumen shaking tables in conjunction with 30min, subsequent step is with step 2.2.1, then separable have ssDNA level library of avidity to ray Angiostatin 1 functional zone albumen.
2.2.3 asymmetric PCR amplification ssDNA, concrete grammar is as follows:
Be separated to step 2.2.2 ssDNA the level library obtained and carry out asymmetric PCR amplification, to be the asymmetric PCR amplification system of 25 μ l be cumulative volume: 10 × PCR damping fluid: 2 μ l; P1 (10 μMs): 1 μ l; P2 (0.2 μM): 1 μ l; DNTP (each 2.5mM): 0.4 μ l; MgCl
2(25mM): 1.2 μ l; SsDNA template (0.2 μ g/ μ l): 2 μ l; Taq DNA polymerase (5u/ μ l): 0.2 μ l; DdH2O:17.2 μ l; PCR reaction parameter: 94 DEG C of denaturation 4min, then carries out 40 circulations, 94 DEG C of sex change 30s, 58 DEG C of annealing 30s, and 72 DEG C extend 20s, and last 72 DEG C extend 7min;
2.2.4 the mensuration of avidity, concrete grammar is as follows:
2.2.4.1 increase: to increase ssDNA the level library screened with the primer P1 asymmetric PCR with digoxigenin labeled, amplification condition is identical with parameter with the asymmetric PCR amplification system of step 2.2.3 with parameter;
2.2.4.2 with protein binding: get step 2.2.4.1 and to increase the PCR primer 100 μ L of gained, 95 DEG C of sex change 5min, add after ice bath 10min in 100 μ L albumen, fully mix, at room temperature in conjunction with 30min, then 6000rpm is centrifugal, protein isolate and supernatant liquor, includes and the ssDNA of band digoxigenin labeled that combines in albumen in albumen, unconjugated ssDNA in supernatant liquor, do the blank that does not add ssDNA simultaneously, namely use 2 × binding buffer liquid to replace PCR primer, carry out aforesaid operations equally;
2.2.4.3 wash: albumen 1 × binding buffer liquid 500 μ L is washed 1 time, and 6000rpm is centrifugal, abandons supernatant, gets albumen;
2.2.4.4 be combined with enzyme mark rabbit anti digoxin antibody: in albumen, add the excessive enzyme mark rabbit anti digoxin antibody that 100 μ L1: 900TBS dilute, fully after mixing, reaction 10min, the ssDNA making it the digoxigenin labeled in albumen is combined;
Described TBS is 0.5MTris-NaCl solution, and compound method is: first water-soluble 8.5 ~ 9gNaCl, then adds Tris-HCl (0.5M, pH7.6) solution 100ml, finally adds water and is settled to 1L; 0.5MTris-HCl (pH7.6,100ml) solution preparation method: take Tris6.06g, adds distilled water 40ml and dissolves, and drips dense HCl and adjusts pH to 7.6, be settled to 100ml.
2.2.4.5 wash: 6000rpm is centrifugal, removes supernatant, then uses 1 × binding buffer liquid 500 μ L to wash 3 times, obtains albumen;
2.2.4.6TMB (tetramethyl benzidine) colour developing: add the resuspended albumen of 400 μ L distilled water, add 200 μ LTMB nitrite ions again, after lucifuge colour developing 10min, with 2mol/LH2SO4200 μ L termination reaction, measure the light absorption value OD450 at 450nm place, namely this value reflects the avidity of the ssDNA be combined with bacterium, namely OD combines, and blank carries out above-mentioned steps 2.2.4.3,2.2.4.4 equally, 2.2.4.5 and 2.2.4.6, blank corresponding absorbancy OD is obtained blank;
Described TMB nitrite ion uses conventional compound method preparation.
2.2.4.7 the volumetric molar concentration of DNA in PCR primer is measured: the PCR primer of getting step 2.2.4.1 amplification gained, with the initial ssDNA library of concentration known gradient for standard substance, with Bandscan software as image analysis software, adopt the DNA content in ethidium bromide agarose gel electrophoretic method quantitative assay PCR primer, obtain the volumetric molar concentration of corresponding DNA, and then the DNA mole number in 100 μ LPCR products can be calculated.
2.2.4.8 the avidity in corresponding library is calculated:
2.3 repeat screening, concrete grammar is: the screening library of product as next round of taking turns asymmetric PCR using each, repeat above-mentioned SELEX and screen step 2.2, until avidity no longer rises, eventually pass the aptamer enriched library that 16 screenings taken turns obtain ssDNA.After asymmetric PCR amplification, condition is with step above, clone and check order, obtain 20 effective ssDNA that copy number is the highest, 20 aptamers are carried out affine specificity verification respectively, obtain 10 and have better affine specific oligonucleotide sequence (aptamer) to ray Angiostatin 1 functional zone albumen, concrete sequence is as follows:
The concrete data of avidity are as follows:
Aptamer title | Avidity | Aptamer title | Avidity |
K2 | 0.62 | K15 | 0.43 |
K6 | 0.53 | K16 | 0.51 |
K9 | 0.50 | K17 | 0.59 |
K10 | 0.47 | K19 | 0.62 |
K14 | 0.60 | K20 | 0.49 |
2.4, specificity and the affinity of 20 aptamers is analyzed
Fluorescently-labeled adaptor sequence and ray Angiostatin 1 functional zone albumen are hatched, carry out flow cytometry detection, wherein 10 sequences show high fluorescent, GraphPadPrism5.0 software is used to do nonlinear regression curve for saturation curve, respectively identical experimental implementation is adopted to 10 high-affinity adaptor sequence, obtains the Kd value that every bar is configuration:
Aptamer title | Kd value (nM) | Aptamer title | Kd value (nM) |
K2 | 35.27 | K15 | 59.23 |
K6 | 51.73 | K16 | 38.97 |
K9 | 43.81 | K17 | 44.83 |
K10 | 50.46 | K19 | 34.57 |
K14 | 35.89 | K20 | 47.81 |
Wherein the Kd value of K20 is minimum, illustrates can be combined fast with target protein and Stability Analysis of Structures is not easily separated.
Adopt the secondary structure of DNAMAN software building 10 aptamers and calculate their minimum free energy, its structure minimum free energy is also all less, and structure is also relatively stable.
2.5 aptamer specificity analyses
BSA, human hemoglobin, ray Angiostatin 1 functional zone albumen and 10 aptamers are adopted to carry out specific detection respectively, find through binding tests, these 10 sequences do not combine with BSA or human hemoglobin, and only keep higher specificity with ray Angiostatin 1 functional zone protein binding.
Sequence table
< 110 > opens bravely
The aptamer K15 of < 120 > ray Angiostatin 1 and screening method thereof and application
〈160〉13
〈210〉1
〈211〉225
〈212〉PRT
< 213 > ray
〈400〉1
TLDIYKQLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKALFDPVIQ60
DRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGIALPPHCSRGERRLV120
EKLCLEGLATLTGEFQGKYYPLTTMSDAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDA180
RGIWHNNDKTFLVWVNEEDHLRVISMQKGGNMKEVFRRFCVGLKK225
〈210〉2
<211〉84
〈212〉DNA
< 213 > artificial sequence
〈400〉K2
1TCAGTCGCTTCGCCGTCTCCTTCATGATCGCGCTGACAAATTAGGCCATTCAATCAGAGC
61ACAAGAGGGAGACCCCAGAGGG
〈210〉3
<211〉84
〈212〉DNA
< 213 > artificial sequence
〈400〉K6
1TCAGTCGCTTCGCCGTCTCCTTCCCGTGATGAATTGCTGATGAGCGCAGCATGGAGCTGC
61ACAAGAGGGAGACCCCAGAGGG
〈210〉4
<211〉84
〈212〉DNA
< 213 > artificial sequence
〈400〉K9
1TCAGTCGCTTCGCCGTCTCCTTCTGACGCATTCGGATCCAAGTTAATTAAATAACTGCGC
61ACAAGAGGGAGACCCCAGAGGG
〈210〉5
<211〉84
〈212〉DNA
< 213 > artificial sequence
〈400〉K10
1TCAGTCGCTTCGCCGTCTCCTTCATTGCAACCTGAGGCCATGGGACAGACCATGATAGGC
61ACAAGAGGGAGACCCCAGAGGG
〈210〉6
<211〉84
〈212〉DNA
< 213 > artificial sequence
〈400〉K14
1TCAGTCGCTTCGCCGTCTCCTTCAACTTGGACCCTTGAGCGATGAAGTAACGGTTTACGC
61ACAAGAGGGAGACCCCAGAGGG
〈210〉7
<211〉84
〈212〉DNA
< 213 > artificial sequence
〈400〉K15
1TCAGTCGCTTCGCCGTCTCCTTCGCACTGCTACCGATATTACATATATGGAGATACAGGC
61ACAAGAGGGAGACCCCAGAGGG
〈210〉8
<211〉84
〈212〉DNA
< 213 > artificial sequence
〈400〉K16
1TCAGTCGCTTCGCCGTCTCCTTCGGCCGAGTAACAGATTGGAACCCAACTGAGTGAGAGC
61ACAAGAGGGAGACCCCAGAGGG
〈210〉9
<211〉84
〈212〉DNA
< 213 > artificial sequence
〈400〉K17
1TCAGTCGCTTCGCCGTCTCCTTCTTATGGACGAGTAGAGGTACGATGACCCAATGATTGC
61ACAAGAGGGAGACCCCAGAGGG
〈210〉10
<211〉84
〈212〉DNA
< 213 > artificial sequence
〈400〉K19
1TCAGTCGCTTCGCCGTCTCCTTCCGATTGAGGGAGATTACGCATATGAGTACAACTGAGC
61ACAAGAGGGAGACCCCAGAGGG
〈210〉11
<211〉84
〈212〉DNA
< 213 > artificial sequence
〈400〉K20
1TCAGTCGCTTCGCCGTCTCCTTCTTTAGACCCGATAATGTTGTTTTGGTGACCGAATTGC
61ACAAGAGGGAGACCCCAGAGGG
〈210〉12
<211〉23
〈212〉DNA
< 213 > artificial sequence
〈400〉P1
TCAGTCGCTTCGCCGTCTCCTTC
〈210〉13
<211〉24
〈212〉DNA
< 213 > artificial sequence
〈400〉P2
CCCTCTGGGGTCTCCCTCTTGTGC
Claims (3)
1., for a ray Angiostatin 1 functional zone albumen for aptamer screening, its sequence is for shown in SEQIDNO:1.
2. identify an oligonucleotide sequence for ray Angiostatin 1 functional zone albumen, it is characterized in that its sequence is for shown in SEQIDNo.7.
3. the oligonucleotide sequence shown in claim 2 is for screening the application of ray Angiostatin 1 functional zone albumen.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201610102329.8A CN105541990B (en) | 2014-06-06 | 2014-06-06 | Aptamers K15 of skate angiogenesis inhibitor 1 and screening method and application thereof |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201610102329.8A CN105541990B (en) | 2014-06-06 | 2014-06-06 | Aptamers K15 of skate angiogenesis inhibitor 1 and screening method and application thereof |
CN201410249737.7A CN104031137B (en) | 2014-06-06 | 2014-06-06 | The aptamer of ray Angiostatin 1 and screening technique thereof and application |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201410249737.7A Division CN104031137B (en) | 2014-06-06 | 2014-06-06 | The aptamer of ray Angiostatin 1 and screening technique thereof and application |
Publications (2)
Publication Number | Publication Date |
---|---|
CN105541990A true CN105541990A (en) | 2016-05-04 |
CN105541990B CN105541990B (en) | 2020-05-15 |
Family
ID=51462153
Family Applications (6)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201610102089.1A Expired - Fee Related CN105541989B (en) | 2014-06-06 | 2014-06-06 | Aptamers K20 of skate angiogenesis inhibitor 1 and screening method and application thereof |
CN201610101224.0A Active CN105541988B (en) | 2014-06-06 | 2014-06-06 | Aptamers K14 of skate angiogenesis inhibitor 1 and screening method and application thereof |
CN201610102329.8A Active CN105541990B (en) | 2014-06-06 | 2014-06-06 | Aptamers K15 of skate angiogenesis inhibitor 1 and screening method and application thereof |
CN201610101377.5A Active CN105567698B (en) | 2014-06-06 | 2014-06-06 | The aptamer K19 and its screening technique of ray Angiostatin 1 and application |
CN201610099682.5A Active CN105541986B (en) | 2014-06-06 | 2014-06-06 | The aptamer K9 and its screening technique of ray Angiostatin 1 and application |
CN201410249737.7A Active CN104031137B (en) | 2014-06-06 | 2014-06-06 | The aptamer of ray Angiostatin 1 and screening technique thereof and application |
Family Applications Before (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201610102089.1A Expired - Fee Related CN105541989B (en) | 2014-06-06 | 2014-06-06 | Aptamers K20 of skate angiogenesis inhibitor 1 and screening method and application thereof |
CN201610101224.0A Active CN105541988B (en) | 2014-06-06 | 2014-06-06 | Aptamers K14 of skate angiogenesis inhibitor 1 and screening method and application thereof |
Family Applications After (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201610101377.5A Active CN105567698B (en) | 2014-06-06 | 2014-06-06 | The aptamer K19 and its screening technique of ray Angiostatin 1 and application |
CN201610099682.5A Active CN105541986B (en) | 2014-06-06 | 2014-06-06 | The aptamer K9 and its screening technique of ray Angiostatin 1 and application |
CN201410249737.7A Active CN104031137B (en) | 2014-06-06 | 2014-06-06 | The aptamer of ray Angiostatin 1 and screening technique thereof and application |
Country Status (1)
Country | Link |
---|---|
CN (6) | CN105541989B (en) |
Families Citing this family (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN105693847A (en) * | 2014-07-13 | 2016-06-22 | 马海龙 | Aptamer NKXA9 specifically for Neutrokine-alpha protein and application of aptamer NKXA9 |
CN105693849A (en) * | 2014-07-13 | 2016-06-22 | 马海龙 | Aptamer NKXA5 specifically for Neutrokine-alpha protein and application of aptamer NKXA5 |
CN105693848A (en) * | 2014-07-13 | 2016-06-22 | 马海龙 | Aptamer NKXA7 specifically for Neutrokine-alpha protein and application of aptamer NKXA7 |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2006096754A2 (en) * | 2005-03-07 | 2006-09-14 | Archemix Corp. | Stabilized aptamers to psma and their use as prostate cancer therapeutics |
CN101724631A (en) * | 2008-11-03 | 2010-06-09 | 广东海洋大学 | Preparation of functional area of sea purse blood vessel growth inhibition factor 1 and use of the functional area of sea purse blood vessel growth inhibition factor 1 in medicaments for preventing and curing tumors |
CN103060326A (en) * | 2012-12-17 | 2013-04-24 | 集美大学 | Six oligonucleotide sequences and application thereof |
-
2014
- 2014-06-06 CN CN201610102089.1A patent/CN105541989B/en not_active Expired - Fee Related
- 2014-06-06 CN CN201610101224.0A patent/CN105541988B/en active Active
- 2014-06-06 CN CN201610102329.8A patent/CN105541990B/en active Active
- 2014-06-06 CN CN201610101377.5A patent/CN105567698B/en active Active
- 2014-06-06 CN CN201610099682.5A patent/CN105541986B/en active Active
- 2014-06-06 CN CN201410249737.7A patent/CN104031137B/en active Active
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2006096754A2 (en) * | 2005-03-07 | 2006-09-14 | Archemix Corp. | Stabilized aptamers to psma and their use as prostate cancer therapeutics |
CN101724631A (en) * | 2008-11-03 | 2010-06-09 | 广东海洋大学 | Preparation of functional area of sea purse blood vessel growth inhibition factor 1 and use of the functional area of sea purse blood vessel growth inhibition factor 1 in medicaments for preventing and curing tumors |
CN103060326A (en) * | 2012-12-17 | 2013-04-24 | 集美大学 | Six oligonucleotide sequences and application thereof |
Also Published As
Publication number | Publication date |
---|---|
CN105541986B (en) | 2019-04-12 |
CN105567698B (en) | 2018-08-31 |
CN104031137B (en) | 2016-08-24 |
CN105541986A (en) | 2016-05-04 |
CN105541990B (en) | 2020-05-15 |
CN105541989A (en) | 2016-05-04 |
CN105541989B (en) | 2020-06-02 |
CN105541988A (en) | 2016-05-04 |
CN105567698A (en) | 2016-05-11 |
CN104031137A (en) | 2014-09-10 |
CN105541988B (en) | 2020-05-19 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN103966224B (en) | A kind of aptamer and screening technique thereof and application | |
CN104109194A (en) | Aptamer of SFRP1 protein, and screening method and application thereof | |
CN104293793B (en) | A kind of oligonucleotides aptamers of specific recognition T-2 toxin | |
CN106834295A (en) | The wide spectrum aptamer and its directed screening method of a kind of specific recognition bacteria lipopolysaccharide | |
CN105886512A (en) | A group of oligonucleotide aptamers for identifying clenbuterol hydrochloride, salbutamol and ractopamine with high specificity | |
CN102154528A (en) | Primer, probe and kit for detecting rotavirus and Norovirus liquid phase chips | |
CN102010865B (en) | Nucleic acid aptamer capable of specifically recognizing Listeria monocytogenes, screening method and application thereof | |
CN102952802A (en) | Group of oligonucleotides aptamers capable of specifically recognizing aflatoxin B1 | |
CN107058329B (en) | Aptamer specifically binding to Newcastle disease virus and screening method and application thereof | |
CN105541990A (en) | Aptamers K15 of skate angiogenesis inhibitor 1 and screening method and application of aptamers K15 | |
CN104498500A (en) | Aptamer for recognizing adriamycin-resistant breast cancer cells as well as screening method and application of aptamer | |
CN102329892A (en) | Hyper-branched rolling cycle amplification detection method of soft-shelled turtle iridovirus | |
CN106191319B (en) | A kind of multi-fluorescence immunoassay method of 6 kinds of fowl respiratory pathogens of quick differentiation | |
RU2019103083A (en) | Mutations of ErbB3 in Cancer | |
CN108387561B (en) | A kind of optimization method for realizing inexpensive high-throughput nucleic acid aptamers optimal sequence based on base quenching fluorescence principle | |
CN107858357B (en) | Bovine respiratory syncytial G protein specific aptamer | |
CN105669852A (en) | Aptamer K10 of sea purse angiogenesis inhibitor 1 and screening method and application of aptamer K10 | |
CN105646695B (en) | The aptamer K16 and its screening technique of ray Angiostatin 1 and application | |
CN105669851A (en) | Aptamers K6 of ray angiogenesis inhibitor 1 and screening method and application of aptamers | |
CN105713081A (en) | Aptamers K17 of ray angiogenesis inhibiting factor 1 and screening method and application thereof | |
CN102952848A (en) | Detection method of small non-messenger RNA | |
CN104278036B (en) | Set of oligonucleotide aptamers for specifically recognizing Sh.sonnei | |
CN105506150B (en) | A kind of preparation method of EMSA methods and its probe and the probe | |
CN104131106B (en) | The primer that the special quantitative PCR of transgenic corns 98140 structure precisely detects and probe and method | |
CN104818277A (en) | A group of oligonucleotide aptamers specifically recognizing staphylococcus aureus subsp.aureus |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
TA01 | Transfer of patent application right | ||
TA01 | Transfer of patent application right |
Effective date of registration: 20200417 Address after: No. 13-a17, 14th floor, aerospace building, 493 Chang'an South Road, Yanta District, Xi'an City, Shaanxi Province 710000 Applicant after: Xi'an kangpuli medical equipment Technology Co., Ltd Address before: 310027 Zhejiang University, 38 Zhejiang Road, Hangzhou, Zhejiang, Xihu District Applicant before: Zhang Yong |
|
GR01 | Patent grant | ||
GR01 | Patent grant |