CN105418753A - Sea purse angiogenesis inhibiting factor 1 functional zone variant JG217 and application thereof - Google Patents
Sea purse angiogenesis inhibiting factor 1 functional zone variant JG217 and application thereof Download PDFInfo
- Publication number
- CN105418753A CN105418753A CN201610017478.4A CN201610017478A CN105418753A CN 105418753 A CN105418753 A CN 105418753A CN 201610017478 A CN201610017478 A CN 201610017478A CN 105418753 A CN105418753 A CN 105418753A
- Authority
- CN
- China
- Prior art keywords
- functional zone
- variant
- ray
- application
- inhibiting factor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 230000002401 inhibitory effect Effects 0.000 title abstract description 6
- 230000033115 angiogenesis Effects 0.000 title abstract description 3
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 17
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 13
- 239000003814 drug Substances 0.000 claims abstract description 7
- 108010079709 Angiostatins Proteins 0.000 claims description 19
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 claims description 19
- 235000018102 proteins Nutrition 0.000 claims description 8
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 3
- 238000002360 preparation method Methods 0.000 claims description 3
- 235000001014 amino acid Nutrition 0.000 claims description 2
- 150000001413 amino acids Chemical class 0.000 claims description 2
- 230000005760 tumorsuppression Effects 0.000 claims description 2
- 102000012936 Angiostatins Human genes 0.000 claims 2
- 230000000259 anti-tumor effect Effects 0.000 claims 1
- 206010028980 Neoplasm Diseases 0.000 abstract description 9
- 201000011510 cancer Diseases 0.000 abstract description 3
- 230000004614 tumor growth Effects 0.000 abstract description 3
- 102400000068 Angiostatin Human genes 0.000 description 17
- 238000000034 method Methods 0.000 description 13
- 229920001184 polypeptide Polymers 0.000 description 9
- 108090000765 processed proteins & peptides Proteins 0.000 description 9
- 102000004196 processed proteins & peptides Human genes 0.000 description 9
- 230000000694 effects Effects 0.000 description 7
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- 210000003711 chorioallantoic membrane Anatomy 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000002609 medium Substances 0.000 description 5
- 235000016709 nutrition Nutrition 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 4
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 4
- 230000037396 body weight Effects 0.000 description 4
- 230000003203 everyday effect Effects 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 230000003187 abdominal effect Effects 0.000 description 3
- 230000005260 alpha ray Effects 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 238000011081 inoculation Methods 0.000 description 3
- 210000001161 mammalian embryo Anatomy 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 230000004862 vasculogenesis Effects 0.000 description 3
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- 241000235058 Komagataella pastoris Species 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 208000002454 Nasopharyngeal Carcinoma Diseases 0.000 description 2
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000002870 angiogenesis inducing agent Substances 0.000 description 2
- 229940120638 avastin Drugs 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 238000005520 cutting process Methods 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 229960002949 fluorouracil Drugs 0.000 description 2
- 238000003304 gavage Methods 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 201000001441 melanoma Diseases 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 201000011216 nasopharynx carcinoma Diseases 0.000 description 2
- 238000011580 nude mouse model Methods 0.000 description 2
- 238000012797 qualification Methods 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- PXFBZOLANLWPMH-UHFFFAOYSA-N 16-Epiaffinine Natural products C1C(C2=CC=CC=C2N2)=C2C(=O)CC2C(=CC)CN(C)C1C2CO PXFBZOLANLWPMH-UHFFFAOYSA-N 0.000 description 1
- 238000011729 BALB/c nude mouse Methods 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 108010058905 CD44v6 antigen Proteins 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 108010000912 Egg Proteins Proteins 0.000 description 1
- 241000620209 Escherichia coli DH5[alpha] Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 description 1
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 238000012449 Kunming mouse Methods 0.000 description 1
- 206010061523 Lip and/or oral cavity cancer Diseases 0.000 description 1
- 206010062038 Lip neoplasm Diseases 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 206010027457 Metastases to liver Diseases 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 108010074506 Transfer Factor Proteins 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 231100000215 acute (single dose) toxicity testing Toxicity 0.000 description 1
- 238000011047 acute toxicity test Methods 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 230000003527 anti-angiogenesis Effects 0.000 description 1
- 229930189065 blasticidin Natural products 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 208000025085 carcinoma of parotid gland Diseases 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 238000011098 chromatofocusing Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 229960000935 dehydrated alcohol Drugs 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 210000003278 egg shell Anatomy 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 208000021045 exocrine pancreatic carcinoma Diseases 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003292 glue Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000012447 hatching Effects 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000002055 immunohistochemical effect Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 238000009655 industrial fermentation Methods 0.000 description 1
- 229910017053 inorganic salt Inorganic materials 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 1
- 201000006721 lip cancer Diseases 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 210000004088 microvessel Anatomy 0.000 description 1
- 231100000219 mutagenic Toxicity 0.000 description 1
- 230000003505 mutagenic effect Effects 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 229940126701 oral medication Drugs 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 208000020615 rectal carcinoma Diseases 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000012807 shake-flask culturing Methods 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 201000008261 skin carcinoma Diseases 0.000 description 1
- 238000010563 solid-state fermentation Methods 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 238000005507 spraying Methods 0.000 description 1
- 201000000498 stomach carcinoma Diseases 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000002110 toxicologic effect Effects 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/461—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
The invention discloses sea purse angiogenesis inhibiting factor 1 functional zone protein and a variant thereof, and an application of the variant in preparing medicine for suppressing tumor growth. The protein variant is expressed eukaryotically, and the inhibiting effect on cancer cells can be remarkably improved relative to original protein.
Description
Technical field
The invention belongs to biological technical field, specifically, the present invention relates to ray Angiostatin 1 functional zone variant.
Background technology
Ray Angiostatin 1 functional zone are hereinafter referred to as ray functional zone, and ray Angiostatin 1 is the protein (molecular weight 42KD) separated from a kind of ray tissue of South China Sea.Result of study shows: that ray Angiostatin 1 significantly suppresses chick chorioallantoic membrane itself and that KB cell is induced chick chorioallantoic membrane vasculogenesis; Be growth and the transfer that abdominal injection or gavage all significantly suppress nude mouse Lewis lung cancer, reduce tumor tissues microvessel density, lower the expression of angiogenic factors VEGF; Also high inhibition effect is had to the transfer of nude mouse Melanoma B16 cell; Lower the expression of short transfer factor CD44v6 and ErBb2; With more remarkable effect during 5 FU 5 fluorouracil (5-FU) combined utilization.The action target spot of ray Angiostatin 1 is different from the PTS Avastin that gene engineering institute of the U.S. develops.Avastin is gene engineering product, and be the antibody of VEGF, its action target spot is VEGF; Ray Angiostatin 1 is natural product, and it not only acts on VEGF, also acts on bFGF and PDGF.
In the prior art, in order to improve the activity of albumen, the specific site for albumen carries out specific sudden change and replacement, thus finds the way that active higher variant is routine.In order to improve the biological activity of this albumen further, applicant is by a large amount of experiments, carry out point mutation for site specific in the aminoacid sequence of ray Angiostatin 1 functional zone, thus obtain the variant than ray Angiostatin 1 functional zone itself with higher inhibit activities.
Summary of the invention
The present invention relates to the variant of the separation of Parent Protease, its position corresponding to position 9R, 17F, 42H, 57S, 62R, 71K, 80N, 89P, 100G, 101R, 129A, 134E, 151Q, 163P, 189K or 217R of the functional zone of SEQIDNO:1 at least one comprises modification.Specifically, variant of the present invention has the inhibit activities of improvement.
Preferably, being applied to method of the present invention, presenting the protein variant of the inhibit activities of improvement is following arbitrary modification: 9R/G, 17F/S, 42H/D, 57S/L, 62R/V, 71K/R, 80N/W, 89P/V, 100G/E, 101R/C, 129A/G, 134E/S, 151Q/N, 163P/K, 189K/R or 217R/T.
The invention still further relates to the method producing protein variant of the present invention, comprise (a) and cultivate host cell; (b) described protein variant is reclaimed.
In production method of the present invention, use method well known in the art culturing cell in the nutritional medium being suitable for producing described polypeptide.Such as; can by suitable culture medium and allow expression and/or the shake-flask culture that carries out under being separated the condition of described polypeptide, and small-scale in laboratory or industrial fermentation tank or large scale fermentation (comprise continuously, in batches, fed-batch or solid state fermentation) carry out culturing cell.Use methods known in the art to cultivate in suitable nutritional medium, described nutritional medium comprises Carbon and nitrogen sources and inorganic salt.Suitable substratum can obtain from commercial supplier or can according to disclosed composition preparation (such as, in the catalogue of American type culture collection).If polypeptide is secreted in nutritional medium, this polypeptide directly can reclaim from described substratum.If polypeptide is not secreted, it can reclaim from cell lysate (lysate).
Gained polypeptide can use methods known in the art to reclaim.Such as, polypeptide can be reclaimed from nutritional medium by ordinary method, and described ordinary method includes but not limited to centrifugal, filtration, extraction, spraying dry, evaporation or precipitation.
Polypeptide of the present invention can by multiple methods known in the art purifying, described method includes but not limited to that chromatography (such as, ion-exchange, affine, hydrophobic, chromatofocusing and size exclusion), electrophoresis method (such as, preparative (preparative) isoelectrofocusing), differential solubility (such as, ammonium sulfate precipitation), SDS-PAGE or extraction (see, such as, ProteinPurification, J.-C.Janson and LarsRyden compiles, VCHPublishers, NewYork, 1989).
Polypeptide of the present invention, for the preparation of corresponding medicine, goes for suppressing cancer.
Embodiment
embodiment 1
1. the acquisition of ray Angiostatin 1 functional zone
Ray functional zone are made up of in the following order following amino-acid residue:
TLD1YKQLRDKETPSGFTLDDV1QTGVDNPGHPF1MTVGCVAGDEESYEVFKALFDPV1QDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRS1KG1ALPPHCSRGERRLVEKLCLEGLATLTGEFQGKYYPLTTMSDAEQQQL1DDHFLFDKPVSPLLLASGMARDWPDARG1WHNNDKTFLVWVNEEDHLRV1SMQKGGNMKEVFRRFCVGLKK
2, the structure of ray Angiostatin 1 functional zone variant
The introducing of catastrophe point
(1), according to corresponding mutational site design corresponding mutagenic primer, adopt PCR fixed-point mutation method on the gene corresponding to ray Angiostatin 1 functional zone, amino acid sites corresponding for wild-type to be suddenlyd change;
(2), above-mentioned PCR primer reclaims after purifying through glue, carries out enzyme cut with restriction enzyme, after being connected with the plasmid pmD-18T carrier segments of cutting through same enzyme, and transformation of E. coli DH5 α competent cell;
(3), qualification recombinant plasmid: with enzyme cut, PCR method identifies recombinant plasmid, and order-checking inspection, obtains the nucleotide sequence after suddenling change thus.These nucleotide sequences say that corresponding aminoacid sequence is respectively on the basis of SEQIDNO:1, has carried out corresponding sudden change in 9R/G, 17F/S, 42H/D, 57S/L, 62R/V, 71K/R, 80N/W, 89P/V, 100G/E, 101R/C, 129A/G, 134E/S, 151Q/N, 163P/K, 189K/R or 217R/T position.
(4) expression of, pPIC6 α-ray Angiostatin 1 functional zone variant
Restriction enzyme site is introduced at two ends above-mentioned steps being built the ray Angiostatin 1 functional zone variant gene obtained, signal peptide sequence is added in upstream, structure obtains pPIC6 α-ray Angiostatin 1 functional zone variant vector, after qualification, by plasmid transfection Pichia pastoris, and carry out eukaryotic expression, adopt Blasticidin as selection markers.Induce its secreting, expressing target protein, find that the expressing quantity that methanol concentration is 0.5%, continuous induction obtains for 4 days is higher.The protein band obtained through SDS-PAGE electrophoretic separation can react with the antiserum(antisera) of the anti-hCG of rabbit in Westernblot detects.Experimental result shows that the expression amount average in pichia pastoris phaff of recombinant plasmid pPIC6 α-ray Angiostatin 1 functional zone variant that we build is that expression amount is about 140mg/L.
3, the growth of ray Angiostatin 1 functional zone variant Tumor suppression and transfer
BALB/c nude mice is divided into control group, the positive (endoxan) control group and experimental group at random, often organizes 8, male and female half and half.Every mouse dorsal sc inoculation 0.2mlLewis lung carcinoma cell suspension (4 × 106 cell) Lewis lung cancer cell.After tumor inoculation the 7th day, experimental group abdominal injection various dose ray functional zone solution, every day 1 time, totally 14 times; Control group abdominal injection equivalent solvent; Positive controls intraperitoneal injection of cyclophosphamide, 1 time weekly, totally 2 times.Within 21st day, sacrifice mouse, peel off tumour and weigh (being fixed for immunohistochemical experiment by 10% neutral formalin), dissect, observe and record hepatic metastases joint footing.Be calculated as follows inhibition rate of tumor growth and metastases inhibiting rate:
Concrete outcome is as follows:
4, the chick chorioallantoic membrane vasculogenesis that nasopharyngeal carcinoma cell (CNE-2Z) is induced is tested
Selection is clean, eggshell homogeneous, air chamber plant egg uniformly, and in 19200 types intelligence incubators, hatching 1 week, opens a diameter 1cm aperture at embryo head end under aseptic condition, form false air chamber.Inoculation CNE-2Z cell (1.9 × 106/ embryo), seals with scotch tape.Put in incubator and cultivate after 4 days, filter paper central authorities being made a call to an aperture is placed on the chorioallantoic membrane in air chamber, and add ray functional zone albumen and misfolded proteins liquid 100 μ l thereof respectively on filter paper, control group then adds equivalent solvent, every day 1 time, altogether administration 4 times.Then remove scotch tape, fix 12 minutes respectively with acetone and dehydrated alcohol.Cutting the chorioallantoic membrane being placed with filter paper puts on slide glass, abandons or adopts filter paper, and under microscope, the branch of random selecting 5 visual field counting visible vessels counts and takes a picture.Be calculated as follows vasculogenesis inductivity and Agiogenesis inhibition rate:
| Group | Chicken embryo number (only) | Dosage (a μ g/ * days) | Vessel branch is counted (X pulls out+S) | Inhibiting rate |
| Control group | 5 | — | 83.5 | — |
| SEQ ID NO:1 albumen | 5 | 100 | 42.2 | 49.5% |
| JG1 (9R/G) | 5 | 100 | 34.0 | 59.3% |
| JG2 (9R/W) | 5 | 100 | 71.2 | 14.7% |
| JG16 (17F/S) | 5 | 100 | 28.3 | 66.1% |
| JG20 (42H/R) | 5 | 100 | 83.5 | 0.0% |
| JG23 (42H/D) | 5 | 100 | 34.0 | 59.3% |
| JG30 (57S/P) | 5 | 100 | 68.1 | 18.4% |
| JG36 (57S/L) | 5 | 100 | 28.2 | 66.2% |
| JG42 (62R/V) | 5 | 100 | 39.4 | 52.8% |
| JG50 (71K/R) | 5 | 100 | 36.1 | 56.8% |
| JG55 (80N/W) | 5 | 100 | 29.7 | 64.4% |
| JG60 (89P/V) | 5 | 100 | 34.3 | 58.9% |
| JG63 (100G/E) | 5 | 100 | 35.3 | 57.7% |
| JG70 （101R/C) | 5 | 100 | 37.3 | 55.3% |
| JG80 （129A/S) | 5 | 100 | 63.2 | 24.3% |
| JG89 （129A/G) | 5 | 100 | 38.1 | 54.4% |
| JG121 （134E/S) | 5 | 100 | 26.7 | 68.0% |
| JG135 （151Q/N) | 5 | 100 | 36.0 | 56.9% |
| JG164 （163P/K) | 5 | 100 | 25.0 | 70.1% |
| JG175 （189K/R) | 5 | 100 | 37.1 | 55.6% |
| JG196 (134E/S and 80N/W) | 5 | 100 | 27.8 | 66.7% |
| JG217 （217R/ T） | 5 | 100 | 38.6 | 53.8% |
As can be seen from the experimental result of 3 and 4, the variant of 9R/G, 17F/S, 42H/D, 57S/L, 62R/V, 71K/R, 80N/W, 89P/V, 100G/E, 101R/C, 129A/G, 134E/S, 151Q/N, 163P/K, 189K/R or 217R/T is all significantly improved in inhibition of cancer cell rate and vascular study rate relative to original ray functional zone albumen, therefore achieves good effect.
Toxicological experiment
Acute toxicity test
Adopt healthy Kunming mouse, body weight 19 ~ 22 grams, male and female half and half.The front fasting 4h of administration (po), adopts multiple dosing method in 24h, takes the circumstances into consideration therebetween to supply feed, can't help water.Dosage is 100 times of (1p, 20mg/kg of the effective dose of ray functional zone original series and variant sequence thereof; Po, 40mg/kg), to observation post administration 7 days.Viewing duration records the toxic reaction situation of animal and the distribution of dead animal day by day.Because do not find dead mouse, do not measure LD50, then change and do " mtd test ", disposable 300 times of (1p, the 60mg/kg using the effective dose of ray functional zone and variant thereof; Po, 120mg/kg) 0.5ml and 0.8ml give the injection of 20 mouse peritoneals or gavage respectively, observe 14 days, result does not find mouse toxicity reaction or death yet.
Stability
Adopt Freeze Drying Technique to make ray functional zone and variant sample thereof, preserve 12 months in-20 DEG C of refrigerators, its biological activity (inhibiting angiogenesis, suppression vitro culture oncocyte and mice transplanted tumor growth) is without obviously reducing.
Ray functional zone and variant thereof can mix with pharmaceutically useful carrier or dissolve, the medicine of the various tumour of obtained treatment, comprise various formulation, this medicine can be used for leukemia, also can be used for various noumenal tumour, as the treatment of esophagus cancer, liver cancer, cancer of the stomach, carcinoma of the pancreas, colon and rectum carcinoma, cervical cancer, ovarian cancer, mammary cancer, nasopharyngeal carcinoma, oral carcinoma, lip cancer, skin carcinoma, bladder cancer, chorioepithelioma, carcinoma of parotid gland, lymphoma, myomata, melanoma and various intracranial tumorss etc., and the application in the people needing this treatment.In made various combination of oral medication, the content of ray functional zone and variant thereof is the about 0.001-100mg of every Kg body weight every day, preferably about 0.01-50mg, is more excellently about 0.05-30mg, and the best is 0.1-10mg about.Every bu 2-4 time uses, and within 10-30 days, is a course for the treatment of, general medication 3-6 course for the treatment of, each course for the treatment of interval 10-30 days.Made medicinal composition for injections, can supply intramuscular injection or intravenous drip, wherein the content of ray functional zone and variant thereof is the about 0.001-50mg of every Kg body weight every day, preferably about 0.01-25mg, is more excellently about 0.05-15mg, and the best is 0.1-3mg about.Every bu 1-3 time uses, and within 10-30 days, is a course for the treatment of, general medication 3-6 course for the treatment of, each course for the treatment of interval 10-30 days.But accurate dosage should be determined by doctor, depend primarily on the age of patient, body weight, the state of an illness, reaction etc.
Sequence table
< 110 > opens bravely
< 120 > ray Anti-angiogenesis factors 1 functional zone variant JG217 and application thereof
〈160〉1
〈210〉1
〈211〉225
〈212〉PRT
< 213 > ray
〈400〉1
TLDIYKQLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKALFDPVIQ60
DRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGIALPPHCSRGERRLV120
EKLCLEGLATLTGEFQGKYYPLTTMSDAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDA180
RGIWHNNDKTFLVWVNEEDHLRVISMQKGGNMKEVFRRFCVGLKK225
Claims (4)
1. a ray Angiostatin 1 functional zone albumen, its aminoacid sequence is for shown in SEQIDNO:1.
2. a ray Angiostatin 1 functional zone protein variant, is characterized in that, on the amino acid whose basis shown in SEQIDNO:1, replaces accordingly at 217R/T.
3. protein variant as claimed in claim 2 is preparing the purposes in Tumor suppression medicine.
4. an anti-tumor medicinal preparation, it contains protein variant according to claim 2 and pharmaceutically suitable carrier.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201610017478.4A CN105418753B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG217 of ray Angiostatin and its application |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201610017478.4A CN105418753B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG217 of ray Angiostatin and its application |
| CN201410249736.2A CN104031136B (en) | 2014-06-06 | 2014-06-06 | Ray Angiostatin 1 functional areas variant and application thereof |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201410249736.2A Division CN104031136B (en) | 2014-06-06 | 2014-06-06 | Ray Angiostatin 1 functional areas variant and application thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN105418753A true CN105418753A (en) | 2016-03-23 |
| CN105418753B CN105418753B (en) | 2018-12-21 |
Family
ID=51462152
Family Applications (16)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201610017478.4A Active CN105418753B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG217 of ray Angiostatin and its application |
| CN201610017475.0A Active CN105481966B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG175 of ray Angiostatin and its application |
| CN201610037005.0A Active CN105481967B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG16 of ray Angiostatin and its application |
| CN201610017409.3A Active CN105440117B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG55 of ray Angiostatin and its application |
| CN201610017404.0A Active CN105481962B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG42 of ray Angiostatin and its application |
| CN201610017401.7A Pending CN105541984A (en) | 2014-06-06 | 2014-06-06 | Manta-angiogenesis-inhibitor-1 functional-area variant JG36 and application thereof |
| CN201610017419.7A Active CN105440118B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG70 of ray Angiostatin and its application |
| CN201610017470.8A Expired - Fee Related CN105418742B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG135 of ray Angiostatin and its application |
| CN201610017414.4A Active CN105481965B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG63 of ray Angiostatin and its application |
| CN201610017442.6A Active CN105418752B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG89 of ray Angiostatin and its application |
| CN201610017473.1A Active CN105461792B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG164 of ray Angiostatin and its application |
| CN201610017410.6A Active CN105481964B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG60 of ray Angiostatin and its application |
| CN201610017393.6A Pending CN105481961A (en) | 2014-06-06 | 2014-06-06 | Ray angiogenesis inhibiting factor (1) functional domain variant JG23 and application thereof |
| CN201610017459.1A Active CN105541985B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG121 of ray Angiostatin and its application |
| CN201610017406.XA Expired - Fee Related CN105481963B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG50 of ray Angiostatin and its application |
| CN201410249736.2A Expired - Fee Related CN104031136B (en) | 2014-06-06 | 2014-06-06 | Ray Angiostatin 1 functional areas variant and application thereof |
Family Applications After (15)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201610017475.0A Active CN105481966B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG175 of ray Angiostatin and its application |
| CN201610037005.0A Active CN105481967B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG16 of ray Angiostatin and its application |
| CN201610017409.3A Active CN105440117B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG55 of ray Angiostatin and its application |
| CN201610017404.0A Active CN105481962B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG42 of ray Angiostatin and its application |
| CN201610017401.7A Pending CN105541984A (en) | 2014-06-06 | 2014-06-06 | Manta-angiogenesis-inhibitor-1 functional-area variant JG36 and application thereof |
| CN201610017419.7A Active CN105440118B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG70 of ray Angiostatin and its application |
| CN201610017470.8A Expired - Fee Related CN105418742B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG135 of ray Angiostatin and its application |
| CN201610017414.4A Active CN105481965B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG63 of ray Angiostatin and its application |
| CN201610017442.6A Active CN105418752B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG89 of ray Angiostatin and its application |
| CN201610017473.1A Active CN105461792B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG164 of ray Angiostatin and its application |
| CN201610017410.6A Active CN105481964B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG60 of ray Angiostatin and its application |
| CN201610017393.6A Pending CN105481961A (en) | 2014-06-06 | 2014-06-06 | Ray angiogenesis inhibiting factor (1) functional domain variant JG23 and application thereof |
| CN201610017459.1A Active CN105541985B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG121 of ray Angiostatin and its application |
| CN201610017406.XA Expired - Fee Related CN105481963B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG50 of ray Angiostatin and its application |
| CN201410249736.2A Expired - Fee Related CN104031136B (en) | 2014-06-06 | 2014-06-06 | Ray Angiostatin 1 functional areas variant and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (16) | CN105418753B (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104774898B (en) * | 2015-04-24 | 2020-07-14 | 浙江海洋学院 | Application of tuna dark meat protein anti-cervical cancer polypeptide |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101260151A (en) * | 2007-03-05 | 2008-09-10 | 广东海洋大学 | Separation and primary structure of sea purse blood vessel generation inhibitive factor 1, and application thereof in preparing blood vessel generation inhibiting medicament and antineoplastic medicam |
| CN101724631A (en) * | 2008-11-03 | 2010-06-09 | 广东海洋大学 | Preparation of functional area of sea purse blood vessel growth inhibition factor 1 and use of the functional area of sea purse blood vessel growth inhibition factor 1 in medicaments for preventing and curing tumors |
| CN102167725A (en) * | 2010-12-07 | 2011-08-31 | 浙江海洋学院 | Method for preparing Raja porosa angiogenesis inhibiting factor RCAIF-I |
-
2014
- 2014-06-06 CN CN201610017478.4A patent/CN105418753B/en active Active
- 2014-06-06 CN CN201610017475.0A patent/CN105481966B/en active Active
- 2014-06-06 CN CN201610037005.0A patent/CN105481967B/en active Active
- 2014-06-06 CN CN201610017409.3A patent/CN105440117B/en active Active
- 2014-06-06 CN CN201610017404.0A patent/CN105481962B/en active Active
- 2014-06-06 CN CN201610017401.7A patent/CN105541984A/en active Pending
- 2014-06-06 CN CN201610017419.7A patent/CN105440118B/en active Active
- 2014-06-06 CN CN201610017470.8A patent/CN105418742B/en not_active Expired - Fee Related
- 2014-06-06 CN CN201610017414.4A patent/CN105481965B/en active Active
- 2014-06-06 CN CN201610017442.6A patent/CN105418752B/en active Active
- 2014-06-06 CN CN201610017473.1A patent/CN105461792B/en active Active
- 2014-06-06 CN CN201610017410.6A patent/CN105481964B/en active Active
- 2014-06-06 CN CN201610017393.6A patent/CN105481961A/en active Pending
- 2014-06-06 CN CN201610017459.1A patent/CN105541985B/en active Active
- 2014-06-06 CN CN201610017406.XA patent/CN105481963B/en not_active Expired - Fee Related
- 2014-06-06 CN CN201410249736.2A patent/CN104031136B/en not_active Expired - Fee Related
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101260151A (en) * | 2007-03-05 | 2008-09-10 | 广东海洋大学 | Separation and primary structure of sea purse blood vessel generation inhibitive factor 1, and application thereof in preparing blood vessel generation inhibiting medicament and antineoplastic medicam |
| CN101724631A (en) * | 2008-11-03 | 2010-06-09 | 广东海洋大学 | Preparation of functional area of sea purse blood vessel growth inhibition factor 1 and use of the functional area of sea purse blood vessel growth inhibition factor 1 in medicaments for preventing and curing tumors |
| CN102167725A (en) * | 2010-12-07 | 2011-08-31 | 浙江海洋学院 | Method for preparing Raja porosa angiogenesis inhibiting factor RCAIF-I |
Non-Patent Citations (2)
| Title |
|---|
| 罗红宇等: "赤魟软骨血管生成抑制因子的纯化及抗血管生成活性验证", 《水产学报》 * |
| 苏东晓等: "血管生成抑制因子抗癌研究进展", 《海南大学学报自然科学版》 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN105481967A (en) | 2016-04-13 |
| CN105481964A (en) | 2016-04-13 |
| CN105541985A (en) | 2016-05-04 |
| CN105461792A (en) | 2016-04-06 |
| CN105481961A (en) | 2016-04-13 |
| CN105418753B (en) | 2018-12-21 |
| CN105481966B (en) | 2019-05-28 |
| CN105440117B (en) | 2018-10-26 |
| CN105481965B (en) | 2019-04-26 |
| CN105418742A (en) | 2016-03-23 |
| CN105541985B (en) | 2019-08-16 |
| CN105461792B (en) | 2019-08-20 |
| CN105440118B (en) | 2018-10-16 |
| CN105418742B (en) | 2018-12-25 |
| CN105481962B (en) | 2019-08-20 |
| CN105481964B (en) | 2018-10-09 |
| CN105418752A (en) | 2016-03-23 |
| CN105481962A (en) | 2016-04-13 |
| CN104031136B (en) | 2016-08-17 |
| CN105440118A (en) | 2016-03-30 |
| CN105541984A (en) | 2016-05-04 |
| CN105481966A (en) | 2016-04-13 |
| CN105418752B (en) | 2018-12-25 |
| CN105440117A (en) | 2016-03-30 |
| CN105481963A (en) | 2016-04-13 |
| CN105481967B (en) | 2019-08-13 |
| CN105481963B (en) | 2019-08-16 |
| CN105481965A (en) | 2016-04-13 |
| CN104031136A (en) | 2014-09-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2024002149A1 (en) | Recombinant type-iii collagen and method for preparing same | |
| Pang et al. | Expression and characterization of recombinant human lactoferrin in edible alga Chlamydomonas reinhardtii | |
| CN105056250B (en) | A kind of applications of microRNA in the medicine for preparing treatment prostate cancer | |
| WO2021134512A1 (en) | New function and use of cryptoid crab antimicrobial peptide scyreprocin | |
| CN101643511B (en) | Fusion protein for inhibiting telomerase activity, preparation and application thereof | |
| CN105418753A (en) | Sea purse angiogenesis inhibiting factor 1 functional zone variant JG217 and application thereof | |
| CN104945490A (en) | Separated plant defensin polypeptide as well as preparation method and application thereof in treatment of lung cancer | |
| CN107446024A (en) | It is a kind of can antagonism DDX3 protein rna binding activity polypeptide DIP 13 and its application | |
| CN101260151B (en) | Sea purse blood vessel generation inhibitive factor 1, and application thereof in preparing medicament | |
| CN109666064A (en) | SALL4-RBBp4 complex blocks polypeptide and derivative antineoplastic polypeptide and its application | |
| CN103421103B (en) | Lichiyong peptide, application thereof in preparation of drug for treating tumor, and preparation method of Lichiyong peptide | |
| CN104357466A (en) | Herpesvirus hominis thymidine kinase mutant as well as preparation method and use thereof | |
| CN104672303A (en) | Anti-tumor peptide variant NC6 and application thereof | |
| CN104610428A (en) | Anti-tumor peptide variant NC12 and application thereof | |
| CN104610427A (en) | Anti-tumor peptide variant NC10 and application thereof | |
| CN104610429A (en) | Anti-tumor peptide variant NC13 and application thereof | |
| CN104592354A (en) | Anti-tumor peptide variant NC4 and application thereof | |
| CN104592358A (en) | Anti-tumor peptide variant NC9 and application thereof | |
| CN104672305A (en) | Anti-tumor peptide variant NC11 and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| TA01 | Transfer of patent application right |
Effective date of registration: 20181029 Address after: 311225 Hangzhou, Zhejiang, east of the Yangtze River Industrial Zone, Linjiang Road, six road 1128, 8 floor, 812 room. Applicant after: Hangzhou Jinjian Environmental Protection Technology Co., Ltd. Address before: 311200 Zhejiang Hangzhou Xiaoshan District North dry Street 48 yuan 3 yuan 201 rooms. Applicant before: Zhang Yong |
|
| TA01 | Transfer of patent application right | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant | ||
| TR01 | Transfer of patent right |
Effective date of registration: 20201201 Address after: 9 Jianshe East Road, Babu District, Hezhou City, Guangxi Zhuang Autonomous Region Patentee after: Market supervision and Administration Bureau of Babu District, Hezhou City Address before: 311225 Hangzhou, Zhejiang, east of the Yangtze River Industrial Zone, Linjiang Road, six road 1128, 8 floor, 812 room. Patentee before: HANGZHOU JINJIAN ENVIRONMENTAL PROTECTION TECHNOLOGY Co.,Ltd. |
|
| TR01 | Transfer of patent right |