CN105440117B - 1 function region variants JG55 of ray Angiostatin and its application - Google Patents
1 function region variants JG55 of ray Angiostatin and its application Download PDFInfo
- Publication number
- CN105440117B CN105440117B CN201610017409.3A CN201610017409A CN105440117B CN 105440117 B CN105440117 B CN 105440117B CN 201610017409 A CN201610017409 A CN 201610017409A CN 105440117 B CN105440117 B CN 105440117B
- Authority
- CN
- China
- Prior art keywords
- ray
- functional areas
- ray angiostatin
- variant
- angiostatin
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 108010079709 Angiostatins Proteins 0.000 title claims abstract description 18
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 title claims abstract description 18
- 102000012936 Angiostatins Human genes 0.000 title claims abstract 3
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 16
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 12
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 12
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 10
- 239000003814 drug Substances 0.000 claims abstract description 7
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 2
- 201000005202 lung cancer Diseases 0.000 claims description 2
- 208000020816 lung neoplasm Diseases 0.000 claims description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 claims 2
- 208000009565 Pharyngeal Neoplasms Diseases 0.000 claims 1
- 239000002253 acid Substances 0.000 claims 1
- 229910021529 ammonia Inorganic materials 0.000 claims 1
- 230000000259 anti-tumor effect Effects 0.000 claims 1
- 201000008006 pharynx cancer Diseases 0.000 claims 1
- 229940079593 drug Drugs 0.000 abstract description 6
- 230000005764 inhibitory process Effects 0.000 abstract description 5
- 201000011510 cancer Diseases 0.000 abstract description 3
- 230000004614 tumor growth Effects 0.000 abstract description 3
- 102400000068 Angiostatin Human genes 0.000 description 15
- 238000000034 method Methods 0.000 description 11
- 229920001184 polypeptide Polymers 0.000 description 8
- 108090000765 processed proteins & peptides Proteins 0.000 description 8
- 102000004196 processed proteins & peptides Human genes 0.000 description 8
- 230000000694 effects Effects 0.000 description 6
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 210000003711 chorioallantoic membrane Anatomy 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 4
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 4
- 230000029087 digestion Effects 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 230000035772 mutation Effects 0.000 description 4
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 230000033115 angiogenesis Effects 0.000 description 3
- 239000007789 gas Substances 0.000 description 3
- 230000006698 induction Effects 0.000 description 3
- 210000001161 mammalian embryo Anatomy 0.000 description 3
- 235000016709 nutrition Nutrition 0.000 description 3
- 230000035764 nutrition Effects 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- 208000006552 Lewis Lung Carcinoma Diseases 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 208000002454 Nasopharyngeal Carcinoma Diseases 0.000 description 2
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 2
- 239000002390 adhesive tape Substances 0.000 description 2
- 125000003275 alpha amino acid group Chemical group 0.000 description 2
- 230000005260 alpha ray Effects 0.000 description 2
- 239000002870 angiogenesis inducing agent Substances 0.000 description 2
- 229940120638 avastin Drugs 0.000 description 2
- 210000004204 blood vessel Anatomy 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 229960004397 cyclophosphamide Drugs 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 229960002949 fluorouracil Drugs 0.000 description 2
- 238000003304 gavage Methods 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 239000007928 intraperitoneal injection Substances 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 201000001441 melanoma Diseases 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 201000011216 nasopharynx carcinoma Diseases 0.000 description 2
- 238000011580 nude mouse model Methods 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- PXFBZOLANLWPMH-UHFFFAOYSA-N 16-Epiaffinine Natural products C1C(C2=CC=CC=C2N2)=C2C(=O)CC2C(=CC)CN(C)C1C2CO PXFBZOLANLWPMH-UHFFFAOYSA-N 0.000 description 1
- 238000011729 BALB/c nude mouse Methods 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 108010058905 CD44v6 antigen Proteins 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 208000017897 Carcinoma of esophagus Diseases 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 108010000912 Egg Proteins Proteins 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 description 1
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- 238000012449 Kunming mouse Methods 0.000 description 1
- 206010061523 Lip and/or oral cavity cancer Diseases 0.000 description 1
- 206010062038 Lip neoplasm Diseases 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 206010027457 Metastases to liver Diseases 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 108010074506 Transfer Factor Proteins 0.000 description 1
- 231100000215 acute (single dose) toxicity testing Toxicity 0.000 description 1
- 238000011047 acute toxicity test Methods 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 230000003527 anti-angiogenesis Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 201000001531 bladder carcinoma Diseases 0.000 description 1
- 229930189065 blasticidin Natural products 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 208000025085 carcinoma of parotid gland Diseases 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 210000001136 chorion Anatomy 0.000 description 1
- 238000011098 chromatofocusing Methods 0.000 description 1
- 238000004140 cleaning Methods 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 210000003278 egg shell Anatomy 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 239000006052 feed supplement Substances 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003292 glue Substances 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000002055 immunohistochemical effect Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000009655 industrial fermentation Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 238000001155 isoelectric focusing Methods 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 201000006721 lip cancer Diseases 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 208000029565 malignant colon neoplasm Diseases 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 210000004088 microvessel Anatomy 0.000 description 1
- 231100000219 mutagenic Toxicity 0.000 description 1
- 230000003505 mutagenic effect Effects 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 208000020717 oral cavity carcinoma Diseases 0.000 description 1
- 229940126701 oral medication Drugs 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 208000020615 rectal carcinoma Diseases 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000007789 sealing Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 238000010563 solid-state fermentation Methods 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 238000001694 spray drying Methods 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000002110 toxicologic effect Effects 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 208000010570 urinary bladder carcinoma Diseases 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/461—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
The invention discloses a kind of 1 functional areas albumen of ray Angiostatin and its variants, and its application in preparing the drug for inhibiting tumour growth.So that the protein variant of the present invention is passed through eukaryotic expression, the inhibition of cancer cell can be significantly improved relative to original protein.
Description
Technical field
The invention belongs to biotechnologies, specifically, the present invention relates to the changes of 1 functional areas of ray Angiostatin
Body.
Background technology
1 functional areas of ray Angiostatin hereinafter referred to as ray functional areas, ray Angiostatin 1 are from the South Sea
The protein (molecular weight 42KD) separated in a kind of ray tissue in marine site.Result of study is shown：Ray Angiostatin 1
Significantly inhibit chick chorioallantoic membrane itself and KB cell's induction chick chorioallantoic membrane angiogenesis；Either
Intraperitoneal injection or gavage all significantly inhibit the growth and transfer of nude mouse Lewis lung cancer, reduce tumor tissues microvessel density,
Lower the expression of angiogenic factors VEGF；Also there is high inhibition effect to the transfer of nude mouse Melanoma B16 cell；It lowers
Promote the expression of transfer factor CD44v6 and ErBb2；It is more notable with effect when 5 FU 5 fluorouracil (5-FU) use in conjunction.Ray blood vessel is given birth to
It is different from the anti-cancer drugs Avastin that gene technology research institute of the U.S. develops at the action target spot of inhibiting factor 1.Avastin
It is gene engineering product, is the antibody of VEGF, action target spot is VEGF；Ray Angiostatin 1 is natural products, it
VEGF is acted not only on, bFGF and PDGF are also acted on.
In the prior art, in order to improve the activity of albumen, for albumen specific site carry out specificity mutation and
Substitution, to find the way that the higher variant of activity is conventional.In order to further increase the bioactivity of the albumen, applicant
Through a large number of experiments, for specific site in 1 function region amino acid sequence of ray Angiostatin a little dash forward
Become, to obtain the variant that there is higher inhibitory activity than 1 functional areas of ray Angiostatin itself.
Invention content
The present invention relates to the variants of the separation of Parent Protease, correspond to SEQ ID NO at least one:1 functional areas
Position 9R, 17F, 42H, 57S, 62R, 71K, 80N, 89P, 100G, 101R, 129A, 134E, 151Q, 163P, 189K or 217R
Position include modification.Specifically, the variant of the present invention has improved inhibitory activity.
Preferably, the method for being applied to the present invention, the protein variant that improved inhibitory activity is presented are following any modification：
9R/G、17F/S、42H/D、57S/L、62R/V、71K/R、80N/W、89P/V、100G/E、101R/C、129A/G、134E/S、
151Q/N, 163P/K, 189K/R or 217R/ T.
The invention further relates to the method for the protein variant for generating the present invention, include (a) cultivating host cell；(b) it recycles
The protein variant.
In the production method of the present invention, trained in the nutrition for being suitable for generating the polypeptide using method well known in the art
It supports in base and cultivates cell.For example, can be by suitable culture medium and under conditions of allowing to express and/or detach the polypeptide
In the shaking flask culture of progress and laboratory or industrial fermentation tank small-scale or large scale fermentation (including it is continuous, in batches, feed supplement
In batches or solid state fermentation) cultivate cell.It is cultivated in suitable nutrient medium using methods known in the art, institute
It includes carbon source and nitrogen source and inorganic salts to state nutrient medium.Suitable culture medium can obtain from commercial supplier or can basis
Disclosed composition is prepared (for example, in catalogue of American type culture collection).If polypeptide is secreted into nutrition culture
In base, which can directly recycle from the culture medium.It, can be from cell lysate if polypeptide is not secreted
(lysate) it recycles.
Gained polypeptide can be recycled using methods known in the art.For example, polypeptide can be by conventional method from nutrition
It is recycled in culture medium, the conventional method includes but not limited to centrifugation, filtering, extraction, spray drying, evaporation or precipitates.
The present invention polypeptide can be purified by a variety of methods known in the art, the method includes but be not limited to chromatograph
(for example, ion exchange, affine, hydrophobic, chromatofocusing and size exclusion), electrophoresis method are (for example, preparative
(preparative) isoelectric focusing), differential solubility (for example, ammonium sulfate precipitation), SDS-PAGE or extraction (see, e.g.,
Protein Purification, J.-C.Janson and Lars Ryden is compiled, VCH Publishers, New York, and 1989).
The polypeptide of the present invention is used to prepare corresponding drug, goes for inhibiting cancer.
Specific implementation mode
Embodiment 1
1. the acquisition of 1 functional areas of ray Angiostatin
Ray functional areas are made of in the following order following amino acid residue：
TLD1YKQLRDKETPSGFTLDDV1QTGVDNPGHPF1MTVGCVAGDEESYEVFKALFDPV1QDRHGGYKPTDKHKTDLN
HENLKGGDDLDPNYVLSSRVRTGRS1KG1ALPPHCSRGERRLVEKLCLEGLATLTGEFQGKYYPLTTMSDAEQQQL1
DDHFLFDKPVSPLLLASGMARDWPDARG1WHNNDKTFLVWVNEEDHLRV1SMQKGGNMKEVFRRFCVGLKK
2, the structure of 1 function region variants of ray Angiostatin
The introducing of catastrophe point
(1), corresponding mutagenic primer is designed according to corresponding mutational site, is given birth in ray blood vessel using PCR fixed-point mutation methods
The corresponding amino acid sites of wild type are mutated on the gene corresponding to 1 functional areas of inhibiting factor；
(2), above-mentioned PCR product carries out digestion after glue recovery purifying with restriction enzyme, digestion identical as process
After the connection of plasmid pmD-18T carrier segments, bacillus coli DH 5 alpha competent cell is converted；
（3）, identification recombinant plasmid：Recombinant plasmid is identified with digestion, PCR method, and inspection is sequenced, is thus obtained
Nucleotide sequence after mutation.These nucleotide sequences say corresponding amino acid sequence respectively in SEQ ID NO：1 basis
On, 9R/G, 17F/S, 42H/D, 57S/L, 62R/V, 71K/R, 80N/W, 89P/V, 100G/E, 101R/C, 129A/G,
134E/S, 151Q/N, 163P/K, 189K/R or 217R/ T location have carried out corresponding mutation.
（4）, 1 function region variants of pPIC6 α-ray Angiostatin expression
The both ends for the 1 functional areas variant gene of ray Angiostatin that above-mentioned steps structure obtains are introduced into digestion position
Signal peptide sequence is added in upstream in point, and structure obtains 1 functional areas variant vector of pPIC6 α-ray Angiostatin, identifies
Afterwards, by plasmid transfection Pichia pastoris, and eukaryotic expression is carried out, using Blasticidin as selection markers.Induce it
Secreting, expressing destination protein finds that methanol concentration is that 0.5%, 4 days obtained expressing quantities of continuous induction are higher.Through SDS-
The protein band that PAGE is separated by electrophoresis can react in Westernblot detections with the antiserum of rabbit-anti hCG.Experiment
The result shows that recombinant plasmid pPIC6 α -1 function region variants of ray Angiostatin that we build finish red ferment in Pasteur
It is about 140 mg/ L that average expression quantity, which is expression quantity, in mother.
3,1 function region variants of ray Angiostatin inhibit the growth and transfer of tumour
BALB/c nude mices are randomly divided into control group, the positive (cyclophosphamide) control group and experimental group, and every group 8, male and female are each
Half.It is inoculated with 0.2ml Lewis lung carcinoma cells suspension (4 × 106 cell) Lewis lung carcinoma cells per mouse dorsal sc.Tumor inoculation
The 7th day afterwards, various dose ray functional areas solution, 1 time a day, totally 14 times was injected intraperitoneally in experimental group；Equivalent is injected intraperitoneally in control group
Solvent；Positive controls intraperitoneal injection of cyclophosphamide, 1 times a week, totally 2 times.Mouse is sacrificed within 21st day, stripping tumour, which is weighed, (to be used
10% neutral formalin is fixed for immunohistochemical experiment), it dissects, observe and record hepatic metastases nodule number.It is calculated as follows
Inhibition rate of tumor growth and metastases inhibiting rate：
Concrete outcome is as follows：
4, the chick chorioallantoic membrane angiogenesis experiment of nasopharyngeal carcinoma cell (CNE-2Z) induction
Uniform kind of cleaning, eggshell homogeneous, gas chamber egg are selected, is hatched 1 week in 19200 type intelligence incubators, it is sterile
Under the conditions of in embryo head end open a diameter 1cm apertures, form false gas chamber.CNE-2Z cells (1.9 × 106/ embryo) are inoculated with, transparent adhesive tape is used
Band sealing.It sets after being cultivated 4 days in incubator, the filter paper that center is made a call to an aperture is placed on the indoor chorioallantoic membrane of gas, adds ray respectively
In on filter paper, control group then adds equivalent solvent by functional areas albumen and its 100 μ l of misfolded proteins liquid, 1 time a day, is administered 4 times altogether.
Then remove adhesive tape, 12 minutes are fixed respectively with acetone and absolute ethyl alcohol.It cuts and is placed with the chorioallantoic membrane of filter paper and sets glass slide
On, filter paper is abandoned or adopted, the branch that 5 visuals field counting visible vessels are randomly selected under microscope counts and takes a picture.Blood is calculated as follows
Pipe generates inductivity and Agiogenesis inhibition rate：
| Group | Chicken embryo number（Only） | Dosage（μ g/ * days） | Vessel branch is counted（X pulls out+S） | Inhibiting rate |
| Control group | 5 | — | 83.5 | — |
| SEQ ID NO:1 albumen | 5 | 100 | 42.2 | 49.5% |
| JG1 (9R/G) | 5 | 100 | 34.0 | 59.3% |
| JG2 (9R/W) | 5 | 100 | 71.2 | 14.7% |
| JG16 (17F/S) | 5 | 100 | 28.3 | 66.1% |
| JG20 (42H/R) | 5 | 100 | 83.5 | 0.0% |
| JG23 (42H/D) | 5 | 100 | 34.0 | 59.3% |
| JG30 (57S/P) | 5 | 100 | 68.1 | 18.4% |
| JG36 (57S/L) | 5 | 100 | 28.2 | 66.2% |
| JG42 (62R/V) | 5 | 100 | 39.4 | 52.8% |
| JG50 (71K/R) | 5 | 100 | 36.1 | 56.8% |
| JG55 (80N/W) | 5 | 100 | 29.7 | 64.4% |
| JG60 (89P/V) | 5 | 100 | 34.3 | 58.9% |
| JG63 (100G/E) | 5 | 100 | 35.3 | 57.7% |
| JG70 （101R/C) | 5 | 100 | 37.3 | 55.3% |
| JG80 （129A/S) | 5 | 100 | 63.2 | 24.3% |
| JG89 （129A/G) | 5 | 100 | 38.1 | 54.4% |
| JG121 （134E/S) | 5 | 100 | 26.7 | 68.0% |
| JG135 （151Q/N) | 5 | 100 | 36.0 | 56.9% |
| JG164 （163P/K) | 5 | 100 | 25.0 | 70.1% |
| JG175 （189K/R) | 5 | 100 | 37.1 | 55.6% |
| JG196 （134E/S and 80N/W） | 5 | 100 | 27.8 | 66.7% |
| JG217 （217R/ T） | 5 | 100 | 38.6 | 53.8% |
From 3 and 4 experimental result can be seen that 9R/G, 17F/S, 42H/D, 57S/L, 62R/V, 71K/R, 80N/W,
The variant of 89P/V, 100G/E, 101R/C, 129A/G, 134E/S, 151Q/N, 163P/K, 189K/R or 217R/ T both with respect to
Original ray functional areas albumen is all significantly improved in cancer inhibition rate and vascular study rate, therefore achieves very well
Effect.
Toxicological experiment
Acute toxicity test
Using healthy Kunming mouse, 19~22 grams of weight, half male and half female.Fasting 4h before administration (po), use are interior for 24 hours more
Secondary dose regimen takes the circumstances into consideration supply feed, can't help water therebetween.Dosage is the effective agent of ray functional areas original series and variant sequence thereof
100 times of (1p, 20mg/kg of amount；Po, 40mg/kg), give observation post administration 7 days.Day by day the toxic reaction of animal is recorded during observation
The distribution of situation and dead animal.Because not finding dead mouse, LD50 is not measured, changes then and does " mtd test ", one
300 times of (1p, 60mg/kg of secondary property ray functional areas and its effective dose of variant；Po, 120mg/kg) 0.5ml and 0.8ml points
Not Gei the injection of 20 mouse peritoneals or gavage, observe 14 days, as a result find mouse toxicity reaction or dead yet.
Stability
Ray functional areas and its variant sample are made using Freeze Drying Technique, are preserved 12 months in -20 DEG C of refrigerators, are given birth to
Object activity (inhibits angiogenesis, inhibits in vitro culture oncocyte and mice transplanted tumor growth) nothing to be substantially reduced.
Ray functional areas and its variant can mix or dissolve with pharmaceutical carrier, and the drug of the various tumours for the treatment of, packet is made
Include various dosage forms, which can be used for leukaemia, also can be used for various entity tumors, as cancer of the esophagus, liver cancer, gastric cancer, cancer of pancreas,
Colon and rectum carcinoma, cervical carcinoma, oophoroma, breast cancer, nasopharyngeal carcinoma, carcinoma of mouth, lip cancer, cutaneum carcinoma, carcinoma of urinary bladder, on chorion
The treatment of skin cancer, carcinoma of parotid gland, lymthoma, myomata, melanoma and various intracranial tumors etc., and its in the people for needing this treatment
In application.In made various combination of oral medication, the content of ray functional areas and its variant is daily big per Kg weight
About 0.001-100mg, preferably from about 0.01-50mg, more excellent about 0.05-30mg, most preferably about 0.1-10mg.Make for 2-4 times per bu
With, 10-30 days as a treatment course, 3-6 course for the treatment of of general medication, each course for the treatment of interval 10-30 days.Made injectable drug group
Close object, for intramuscular injection or intravenous drip, wherein the content of ray functional areas and its variant be it is daily per Kg weight about
0.001-50mg, preferably from about 0.01-25mg, more excellent about 0.05-15mg, most preferably about 0.1-3mg.Per 1-3 use of bu,
10-30 days as a treatment course, 3-6 course for the treatment of of general medication, each course for the treatment of interval 10-30 days.However, accurate dosage should be by doctor
It determines, depends primarily on age, weight, the state of an illness, reaction of patient etc..
Sequence table
< 110 > is brave
120 > rays Anti-angiogenesis factors of <, 1 function region variants JG55 and its application
〈160〉1
〈210〉1
〈211〉225
〈212〉PRT
213 > rays of <
〈400〉1
TLDIYKQLRD KETPSGFTLD DVIQTGVDNP GHPFIMTVGC VAGDEESYEV FKALFDPVIQ 60
DRHGGYKPTD KHKTDLNHEN LKGGDDLDPN YVLSSRVRTG RSIKGIALPP HCSRGERRLV 120
EKLCLEGLAT LTGEFQGKYY PLTTMSDAEQ QQLIDDHFLF DKPVSPLLLA SGMARDWPDA 180
RGIWHNNDKT FLVWVNEEDH LRVISMQKGG NMKEVFRRFC VGLKK 225
Claims (3)
1. a kind of 1 functional areas protein variant of ray Angiostatin, which is characterized in that in SEQ ID NO：Ammonia shown in 1
On the basis of base acid, replaced accordingly in 80N/W.
2. protein variant as described in claim 1 is lung cancer or nose preparing the purposes in inhibiting tumour medicine, the tumour
Pharynx cancer.
3. a kind of anti-tumor medicinal preparation, it contains protein variant described in claim 1 and pharmaceutically suitable carrier.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201610017409.3A CN105440117B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG55 of ray Angiostatin and its application |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201410249736.2A CN104031136B (en) | 2014-06-06 | 2014-06-06 | Ray Angiostatin 1 functional areas variant and application thereof |
| CN201610017409.3A CN105440117B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG55 of ray Angiostatin and its application |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201410249736.2A Division CN104031136B (en) | 2014-06-06 | 2014-06-06 | Ray Angiostatin 1 functional areas variant and application thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN105440117A CN105440117A (en) | 2016-03-30 |
| CN105440117B true CN105440117B (en) | 2018-10-26 |
Family
ID=51462152
Family Applications (16)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201610017414.4A Active CN105481965B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG63 of ray Angiostatin and its application |
| CN201610017442.6A Active CN105418752B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG89 of ray Angiostatin and its application |
| CN201610017470.8A Expired - Fee Related CN105418742B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG135 of ray Angiostatin and its application |
| CN201610017459.1A Active CN105541985B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG121 of ray Angiostatin and its application |
| CN201610017478.4A Active CN105418753B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG217 of ray Angiostatin and its application |
| CN201410249736.2A Expired - Fee Related CN104031136B (en) | 2014-06-06 | 2014-06-06 | Ray Angiostatin 1 functional areas variant and application thereof |
| CN201610017406.XA Expired - Fee Related CN105481963B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG50 of ray Angiostatin and its application |
| CN201610017409.3A Active CN105440117B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG55 of ray Angiostatin and its application |
| CN201610017475.0A Active CN105481966B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG175 of ray Angiostatin and its application |
| CN201610017393.6A Pending CN105481961A (en) | 2014-06-06 | 2014-06-06 | Ray angiogenesis inhibiting factor (1) functional domain variant JG23 and application thereof |
| CN201610017473.1A Active CN105461792B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG164 of ray Angiostatin and its application |
| CN201610017419.7A Active CN105440118B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG70 of ray Angiostatin and its application |
| CN201610017401.7A Pending CN105541984A (en) | 2014-06-06 | 2014-06-06 | Manta-angiogenesis-inhibitor-1 functional-area variant JG36 and application thereof |
| CN201610017404.0A Active CN105481962B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG42 of ray Angiostatin and its application |
| CN201610017410.6A Active CN105481964B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG60 of ray Angiostatin and its application |
| CN201610037005.0A Active CN105481967B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG16 of ray Angiostatin and its application |
Family Applications Before (7)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201610017414.4A Active CN105481965B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG63 of ray Angiostatin and its application |
| CN201610017442.6A Active CN105418752B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG89 of ray Angiostatin and its application |
| CN201610017470.8A Expired - Fee Related CN105418742B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG135 of ray Angiostatin and its application |
| CN201610017459.1A Active CN105541985B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG121 of ray Angiostatin and its application |
| CN201610017478.4A Active CN105418753B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG217 of ray Angiostatin and its application |
| CN201410249736.2A Expired - Fee Related CN104031136B (en) | 2014-06-06 | 2014-06-06 | Ray Angiostatin 1 functional areas variant and application thereof |
| CN201610017406.XA Expired - Fee Related CN105481963B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG50 of ray Angiostatin and its application |
Family Applications After (8)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201610017475.0A Active CN105481966B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG175 of ray Angiostatin and its application |
| CN201610017393.6A Pending CN105481961A (en) | 2014-06-06 | 2014-06-06 | Ray angiogenesis inhibiting factor (1) functional domain variant JG23 and application thereof |
| CN201610017473.1A Active CN105461792B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG164 of ray Angiostatin and its application |
| CN201610017419.7A Active CN105440118B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG70 of ray Angiostatin and its application |
| CN201610017401.7A Pending CN105541984A (en) | 2014-06-06 | 2014-06-06 | Manta-angiogenesis-inhibitor-1 functional-area variant JG36 and application thereof |
| CN201610017404.0A Active CN105481962B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG42 of ray Angiostatin and its application |
| CN201610017410.6A Active CN105481964B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG60 of ray Angiostatin and its application |
| CN201610037005.0A Active CN105481967B (en) | 2014-06-06 | 2014-06-06 | 1 function region variants JG16 of ray Angiostatin and its application |
Country Status (1)
| Country | Link |
|---|---|
| CN (16) | CN105481965B (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104774898B (en) * | 2015-04-24 | 2020-07-14 | 浙江海洋学院 | Application of tuna dark meat protein anti-cervical cancer polypeptide |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101260151A (en) * | 2007-03-05 | 2008-09-10 | 广东海洋大学 | Separation and primary structure of sea purse blood vessel generation inhibitive factor 1, and application thereof in preparing blood vessel generation inhibiting medicament and antineoplastic medicam |
| CN101724631A (en) * | 2008-11-03 | 2010-06-09 | 广东海洋大学 | Preparation of functional area of sea purse blood vessel growth inhibition factor 1 and use of the functional area of sea purse blood vessel growth inhibition factor 1 in medicaments for preventing and curing tumors |
| CN102167725A (en) * | 2010-12-07 | 2011-08-31 | 浙江海洋学院 | Method for preparing Raja porosa angiogenesis inhibiting factor RCAIF-I |
-
2014
- 2014-06-06 CN CN201610017414.4A patent/CN105481965B/en active Active
- 2014-06-06 CN CN201610017442.6A patent/CN105418752B/en active Active
- 2014-06-06 CN CN201610017470.8A patent/CN105418742B/en not_active Expired - Fee Related
- 2014-06-06 CN CN201610017459.1A patent/CN105541985B/en active Active
- 2014-06-06 CN CN201610017478.4A patent/CN105418753B/en active Active
- 2014-06-06 CN CN201410249736.2A patent/CN104031136B/en not_active Expired - Fee Related
- 2014-06-06 CN CN201610017406.XA patent/CN105481963B/en not_active Expired - Fee Related
- 2014-06-06 CN CN201610017409.3A patent/CN105440117B/en active Active
- 2014-06-06 CN CN201610017475.0A patent/CN105481966B/en active Active
- 2014-06-06 CN CN201610017393.6A patent/CN105481961A/en active Pending
- 2014-06-06 CN CN201610017473.1A patent/CN105461792B/en active Active
- 2014-06-06 CN CN201610017419.7A patent/CN105440118B/en active Active
- 2014-06-06 CN CN201610017401.7A patent/CN105541984A/en active Pending
- 2014-06-06 CN CN201610017404.0A patent/CN105481962B/en active Active
- 2014-06-06 CN CN201610017410.6A patent/CN105481964B/en active Active
- 2014-06-06 CN CN201610037005.0A patent/CN105481967B/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101260151A (en) * | 2007-03-05 | 2008-09-10 | 广东海洋大学 | Separation and primary structure of sea purse blood vessel generation inhibitive factor 1, and application thereof in preparing blood vessel generation inhibiting medicament and antineoplastic medicam |
| CN101724631A (en) * | 2008-11-03 | 2010-06-09 | 广东海洋大学 | Preparation of functional area of sea purse blood vessel growth inhibition factor 1 and use of the functional area of sea purse blood vessel growth inhibition factor 1 in medicaments for preventing and curing tumors |
| CN102167725A (en) * | 2010-12-07 | 2011-08-31 | 浙江海洋学院 | Method for preparing Raja porosa angiogenesis inhibiting factor RCAIF-I |
Non-Patent Citations (2)
| Title |
|---|
| 血管生成抑制因子抗癌研究进展;苏东晓等;《海南大学学报自然科学版》;20091231;第27卷(第3期);第297-301页 * |
| 赤魟软骨血管生成抑制因子的纯化及抗血管生成活性验证;罗红宇等;《水产学报》;20071130;第31卷(第6期);第813-817页 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN105440118A (en) | 2016-03-30 |
| CN105481967A (en) | 2016-04-13 |
| CN105481963A (en) | 2016-04-13 |
| CN105461792A (en) | 2016-04-06 |
| CN105481964A (en) | 2016-04-13 |
| CN105541985B (en) | 2019-08-16 |
| CN105418752A (en) | 2016-03-23 |
| CN105481965B (en) | 2019-04-26 |
| CN105418753A (en) | 2016-03-23 |
| CN105418742A (en) | 2016-03-23 |
| CN105440117A (en) | 2016-03-30 |
| CN105481965A (en) | 2016-04-13 |
| CN105418742B (en) | 2018-12-25 |
| CN105481962B (en) | 2019-08-20 |
| CN105481963B (en) | 2019-08-16 |
| CN105541984A (en) | 2016-05-04 |
| CN105481966A (en) | 2016-04-13 |
| CN105481967B (en) | 2019-08-13 |
| CN105481966B (en) | 2019-05-28 |
| CN105461792B (en) | 2019-08-20 |
| CN105481961A (en) | 2016-04-13 |
| CN105440118B (en) | 2018-10-16 |
| CN105541985A (en) | 2016-05-04 |
| CN104031136A (en) | 2014-09-10 |
| CN104031136B (en) | 2016-08-17 |
| CN105481964B (en) | 2018-10-09 |
| CN105481962A (en) | 2016-04-13 |
| CN105418753B (en) | 2018-12-21 |
| CN105418752B (en) | 2018-12-25 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN104592356A (en) | Anti-tumor peptide variant NC5 and application thereof | |
| CN105440117B (en) | 1 function region variants JG55 of ray Angiostatin and its application | |
| CN113583095B (en) | Antitumor polypeptide and application thereof | |
| CN107488734B (en) | MiR-19a-3p is preparing the application in prostate cancer with osseous metastasis diagnostic reagent and therapeutic agent | |
| CN105112391B (en) | A kind of people source arginase mutant and its preparation method and application | |
| CN109666064A (en) | SALL4-RBBp4 complex blocks polypeptide and derivative antineoplastic polypeptide and its application | |
| CN104592353A (en) | Anti-tumor peptide variant NC2 and application thereof | |
| CN104672303A (en) | Anti-tumor peptide variant NC6 and application thereof | |
| CN106349371A (en) | Human SFRP1 varient and application thereof | |
| CN106349368A (en) | Human SFRP1 varient and application thereof | |
| CN106349369A (en) | Human SFRP1 varient and application thereof | |
| CN106349370A (en) | Human SFRP1 varient and application thereof | |
| CN104592358A (en) | Anti-tumor peptide variant NC9 and application thereof | |
| CN104592357A (en) | Anti-tumor peptide variant NC8 and application thereof | |
| CN104592355A (en) | Anti-tumor peptide variant NC3 and application thereof | |
| CN104610429A (en) | Anti-tumor peptide variant NC13 and application thereof | |
| CN104610428A (en) | Anti-tumor peptide variant NC12 and application thereof | |
| CN104610427A (en) | Anti-tumor peptide variant NC10 and application thereof | |
| CN104672304A (en) | Anti-tumor peptide variant NC7 and application thereof | |
| CN104672305A (en) | Anti-tumor peptide variant NC11 and application thereof | |
| CN106349376A (en) | Human SFRP1 (secreted frizzled-related protein 1) variant and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| CB03 | Change of inventor or designer information |
Inventor after: Fu Qingxia Inventor after: Zhang Lei Inventor after: Zhang Yong Inventor before: Zhang Lei Inventor before: Zhang Yong |
|
| CB03 | Change of inventor or designer information | ||
| TA01 | Transfer of patent application right |
Effective date of registration: 20180913 Address after: 272000 Jining Second People's Hospital, Shandong Applicant after: Fu Qingxia Address before: 311200 Zhejiang Hangzhou Xiaoshan District North dry Street 48 yuan 3 yuan 201 rooms. Applicant before: Zhang Yong |
|
| TA01 | Transfer of patent application right | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant | ||
| CP02 | Change in the address of a patent holder |
Address after: 272000 Middle Section of Taizhong Road, Taierzhuang Economic Development Zone, Zaozhuang City, Shandong Province Patentee after: Fu Qingxia Address before: 272000 Jining Second People's Hospital, Shandong Patentee before: Fu Qingxia |
|
| CP02 | Change in the address of a patent holder | ||
| CP02 | Change in the address of a patent holder |
Address after: 272000 Jining Second People's Hospital, Shandong Patentee after: Fu Qingxia Address before: 272000 Middle Section of Taizhong Road, Taierzhuang Economic Development Zone, Zaozhuang City, Shandong Province Patentee before: Fu Qingxia |
|
| CP02 | Change in the address of a patent holder | ||
| CP02 | Change in the address of a patent holder |
Address after: 236000 room 602, unit 3, building 11, jinhupan, thinking road, Yingshang County, Fuyang City, Anhui Province Patentee after: Fu Qing Xia Address before: 272000 Jining Second People's Hospital of Shandong Province Patentee before: Fu Qing Xia |
|
| CP02 | Change in the address of a patent holder | ||
| CP02 | Change in the address of a patent holder |
Address after: 1501 Beixin West Road, Tengzhou City, Zaozhuang City, Shandong Province Patentee after: Fu Qing Xia Address before: Room 602, unit 3, building 11, Golden Lake, thinking road, Yingshang County, Fuyang City, Anhui Province Patentee before: Fu Qing Xia |
|
| CP02 | Change in the address of a patent holder | ||
| TR01 | Transfer of patent right |
Effective date of registration: 20201225 Address after: 1501 Beixin West Road, Tengzhou City, Zaozhuang City, Shandong Province Patentee after: TENGZHOU INSTITUTE OF PRODUCT QUALITY SUPERVISION AND INSPECTION Address before: 1501 Beixin West Road, Tengzhou City, Zaozhuang City, Shandong Province Patentee before: Fu Qing Xia |
|
| TR01 | Transfer of patent right |