CN105481962B - 1 function region variants JG42 of ray Angiostatin and its application - Google Patents

1 function region variants JG42 of ray Angiostatin and its application Download PDF

Info

Publication number
CN105481962B
CN105481962B CN201610017404.0A CN201610017404A CN105481962B CN 105481962 B CN105481962 B CN 105481962B CN 201610017404 A CN201610017404 A CN 201610017404A CN 105481962 B CN105481962 B CN 105481962B
Authority
CN
China
Prior art keywords
ray
functional areas
ray angiostatin
variant
angiostatin
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
CN201610017404.0A
Other languages
Chinese (zh)
Other versions
CN105481962A (en
Inventor
张垒
张勇
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Xinchang Yanghui Network Technology Co ltd
Original Assignee
Shengzhou Fake Machinery Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Shengzhou Fake Machinery Co Ltd filed Critical Shengzhou Fake Machinery Co Ltd
Priority to CN201610017404.0A priority Critical patent/CN105481962B/en
Publication of CN105481962A publication Critical patent/CN105481962A/en
Application granted granted Critical
Publication of CN105481962B publication Critical patent/CN105481962B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/461Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

The invention discloses a kind of 1 functional areas albumen of ray Angiostatin and its variants, and its application in the drug that preparation inhibits tumour growth.Make protein variant of the invention by eukaryotic expression, the inhibitory effect of cancer cell can be significantly improved relative to original protein.

Description

1 function region variants JG42 of ray Angiostatin and its application
Technical field
The invention belongs to field of biotechnology, specifically, the present invention relates to the changes of 1 functional areas of ray Angiostatin Body.
Background technique
1 functional areas of ray Angiostatin hereinafter referred to as ray functional areas, ray Angiostatin 1 are from the South Sea The protein (molecular weight 42KD) separated in a kind of ray tissue in sea area.Result of study is shown: ray Angiostatin 1 Significantly inhibit chick chorioallantoic membrane itself and KB cell's induction chick chorioallantoic membrane angiogenesis;Either Intraperitoneal injection or stomach-filling all significantly inhibit the growth and transfer of nude mouse Lewis lung cancer, reduce tumor tissues microvessel density, Lower the expression of angiogenic factors VEGF;Also there is high inhibition effect to the transfer of nude mouse Melanoma B16 cell;It lowers Promote the expression of transfer factor CD44v6 and ErBb2;It is more significant with effect when 5 FU 5 fluorouracil (5-FU) use in conjunction.Ray blood vessel is raw It is different from the anti-cancer drugs Avastin that gene technology research institute, the U.S. develops at the action target spot of inhibiting factor 1.Avastin It is gene engineering product, is the antibody of VEGF, action target spot is VEGF;Ray Angiostatin 1 is natural products, it VEGF is acted not only on, bFGF and PDGF are also acted on.
In the prior art, in order to improve the activity of albumen, for albumen specific site carry out specificity mutation and Replace, so that finding the higher variant of activity is conventional way.In order to further increase the bioactivity of the albumen, applicant Through a large number of experiments, a little dash forward for site specific in 1 function region amino acid sequence of ray Angiostatin Become, to obtain the variant that there is higher inhibitory activity than 1 functional areas of ray Angiostatin itself.
Summary of the invention
The present invention relates to the isolated variants of Parent Protease, in the functional areas that at least one corresponds to SEQ ID NO:1 Position 9R, 17F, 42H, 57S, 62R, 71K, 80N, 89P, 100G, 101R, 129A, 134E, 151Q, 163P, 189K or 217R Position include modification.Specifically, variant of the invention has improved inhibitory activity.
Preferably, the protein variant of the inhibitory activity improved applied to method of the invention, presentation is following any modification: 9R/G、17F/S、42H/D、57S/L、62R/V、71K/R、80N/W、89P/V、100G/E、101R/C、129A/G、134E/S、 151Q/N, 163P/K, 189K/R or 217R/ T.
The invention further relates to the method for generating protein variant of the invention, include (a) cultivating host cell;(b) it recycles The protein variant.
In production method of the invention, trained using method well known in the art in the nutrition for being suitable for generating the polypeptide It supports in base and cultivates cell.For example, can be by suitable culture medium and under conditions of allowing to express and/or separate the polypeptide In the shaking flask culture of progress and laboratory or industrial fermentation tank small-scale or large scale fermentation (including it is continuous, in batches, feed supplement In batches or solid state fermentation) cultivate cell.It is cultivated in suitable nutrient medium using methods known in the art, institute Stating nutrient medium includes carbon source and nitrogen source and inorganic salts.Suitable culture medium can obtain from commercial supplier or can basis Disclosed composition prepares (for example, in catalogue of American type culture collection).If polypeptide is secreted into nutrition culture In base, which can directly recycle from the culture medium.It, can be from cell lysate if polypeptide is not secreted (lysate) it recycles.
Methods known in the art recycling can be used in gained polypeptide.For example, polypeptide can be by conventional method from nutrition It is recycled in culture medium, the conventional method includes but is not limited to centrifugation, filtering, extraction, spray drying, evaporation or precipitates.
Polypeptide of the invention can be purified by a variety of methods known in the art, the method includes but be not limited to chromatograph (for example, ion exchange, affine, hydrophobic, chromatofocusing and size exclusion), electrophoresis method are (for example, preparative (preparative) isoelectric focusing), differential solubility (for example, ammonium sulfate precipitation), SDS-PAGE or extract (see, e.g., Protein Purification, J.-C.Janson and Lars Ryden is compiled, VCH Publishers, New York, and 1989).
Polypeptide of the invention is used to prepare corresponding drug, goes for inhibiting cancer.
Specific embodiment
Embodiment 1
1. the acquisition of 1 functional areas of ray Angiostatin
Ray functional areas are made of in the following order following amino acid residue:
TLD1YKQLRDKETPSGFTLDDV1QTGVDNPGHPF1MTVGCVAGDEESYEVFKALFDPV1QDRHGGYKP TDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRS1KG1ALPPHCSRGERRLVEKLCLEGLATLTGEFQGKYYPLTT MSDAEQQQL1DDHFLFDKPVSPLLLASGMARDWPDARG1WHNNDKTFLVWVNEEDHLRV1SMQKGGNMKEVFRRFC VGLKK
2, the building of 1 function region variants of ray Angiostatin
The introducing of catastrophe point
(1), corresponding mutagenic primer is designed according to corresponding mutational site, it is raw in ray blood vessel using PCR fixed-point mutation method The corresponding amino acid sites of wild type are mutated on gene corresponding to 1 functional areas of inhibiting factor;
(2), above-mentioned PCR product after purification by gel, carries out digestion with restriction enzyme, digestion identical as process After the connection of plasmid pmD-18T carrier segments, bacillus coli DH 5 alpha competent cell is converted;
(3), it identifies recombinant plasmid: recombinant plasmid being identified with digestion, PCR method, and inspection is sequenced, is thus obtained Nucleotide sequence after mutation.These nucleotide sequences say corresponding amino acid sequence respectively on the basis of SEQ ID NO:1 On, 9R/G, 17F/S, 42H/D, 57S/L, 62R/V, 71K/R, 80N/W, 89P/V, 100G/E, 101R/C, 129A/G, 134E/S, 151Q/N, 163P/K, 189K/R or 217R/ T location have carried out corresponding mutation.
(4), the expression of 1 function region variants of pPIC6 α-ray Angiostatin
The both ends for the 1 functional areas variant gene of ray Angiostatin that above-mentioned steps building obtains are introduced into digestion position Signal peptide sequence is added in upstream in point, and building obtains 1 functional areas variant vector of pPIC6 α-ray Angiostatin, identifies Afterwards, by plasmid transfection Pichia pastoris, and eukaryotic expression is carried out, using Blasticidin as selection markers.Induce it Secreting, expressing destination protein, discovery methanol concentration are that 0.5%, 4 days obtained expressing quantities of continuous induction are higher.Through SDS- The protein band that PAGE is separated by electrophoresis can react in Westernblot detection with the antiserum of rabbit-anti hCG.Experiment The result shows that recombinant plasmid pPIC6 α -1 function region variants of ray Angiostatin that we construct finish red ferment in Pasteur It is about 140 mg/ L that average expression quantity, which is expression quantity, in mother.
3,1 function region variants of ray Angiostatin inhibit the growth and transfer of tumour
BALB/c nude mice is randomly divided into control group, the positive (cyclophosphamide) control group and experimental group, and every group 8, male and female are each Half.Every mouse dorsal sc is inoculated with 0.2ml Lewis lung carcinoma cell suspension (4 × 106 cell) Lewis lung carcinoma cell.Tumor inoculation The 7th day afterwards, various dose ray functional areas solution, 1 time a day, totally 14 times was injected intraperitoneally in experimental group;Equivalent is injected intraperitoneally in control group Solvent;Positive controls intraperitoneal injection of cyclophosphamide, 1 times a week, totally 2 times.21st day sacrifice mouse, removing tumour weighing (are used 10% neutral formalin is fixed for immunohistochemical experiment), it dissects, observe and record hepatic metastases nodule number.It is calculated as follows Inhibition rate of tumor growth and metastases inhibiting rate:
Concrete outcome is as follows:
4, the chick chorioallantoic membrane angiogenesis test of nasopharyngeal carcinoma cell (CNE-2Z) induction
Cleaning, uniform kind of eggshell homogeneous, gas chamber egg are selected, is hatched 1 week in 19200 type intelligence incubators, it is sterile Under the conditions of in embryo head end open a diameter 1cm aperture, form false gas chamber.It is inoculated with CNE-2Z cell (1.9 × 106/ embryo), uses transparent adhesive tape Band sealing.It sets after being cultivated 4 days in incubator, the filter paper of an aperture is played into center and is placed on the indoor chorioallantoic membrane of gas, respectively plus ray In on filter paper, control group then adds equivalent solvent by functional areas albumen and its 100 μ l of misfolded proteins medical fluid, 1 time a day, is administered 4 times altogether. Then remove adhesive tape, fix 12 minutes respectively with acetone and dehydrated alcohol.It cuts and is placed with the chorioallantoic membrane of filter paper and sets glass slide On, filter paper is abandoned or adopted, the branch that 5 visuals field counting visible vessels are randomly selected under microscope counts and takes a picture.Blood is calculated as follows Pipe generates inductivity and Agiogenesis inhibition rate:
Group Chicken embryo number (only) Dosage (μ g/ * days) Vessel branch counts (X pulls out+S) Inhibiting rate
Control group 5 83.5
SEQ ID NO:1 albumen 5 100 42.2 49.5%
JG1 (9R/G) 5 100 34.0 59.3%
JG2 (9R/W) 5 100 71.2 14.7%
JG16 (17F/S) 5 100 28.3 66.1%
JG20 (42H/R) 5 100 83.5 0.0%
JG23 (42H/D) 5 100 34.0 59.3%
JG30 (57S/P) 5 100 68.1 18.4%
JG36 (57S/L) 5 100 28.2 66.2%
JG42 (62R/V) 5 100 39.4 52.8%
JG50 (71K/R) 5 100 36.1 56.8%
JG55 (80N/W) 5 100 29.7 64.4%
JG60 (89P/V) 5 100 34.3 58.9%
JG63 (100G/E) 5 100 35.3 57.7%
JG70 (101R/C) 5 100 37.3 55.3%
JG80 (129A/S) 5 100 63.2 24.3%
JG89 (129A/G) 5 100 38.1 54.4%
JG121 (134E/S) 5 100 26.7 68.0%
JG135 (151Q/N) 5 100 36.0 56.9%
JG164 (163P/K) 5 100 25.0 70.1%
JG175 (189K/R) 5 100 37.1 55.6%
JG196 (134E/S and 80N/W) 5 100 27.8 66.7%
JG217 (217R/ T) 5 100 38.6 53.8%
From 3 and 4 experimental result can be seen that 9R/G, 17F/S, 42H/D, 57S/L, 62R/V, 71K/R, 80N/W, The variant of 89P/V, 100G/E, 101R/C, 129A/G, 134E/S, 151Q/N, 163P/K, 189K/R or 217R/ T both with respect to Original ray functional areas albumen is all significantly improved in cancer inhibition rate and vascular study rate, therefore achieves very well Effect.
Toxicological experiment
Acute toxicity test
Using healthy Kunming mouse, 19~22 grams of weight, half male and half female.Fasting 4h before administration (po), use are interior for 24 hours more Secondary dose regimen takes the circumstances into consideration supply feed therebetween, can't help water.Dosage is the effective agent of ray functional areas original series and variant sequence thereof 100 times of (1p, 20mg/kg of amount;Po, 40mg/kg), it is observed 7 days after administration.Day by day the toxic reaction of animal is recorded during observation The distribution of situation and dead animal.Because not finding dead mouse, LD50 is not measured, changes then and does " mtd test ", one 300 times of (1p, 60mg/kg of secondary property ray functional areas and its effective dose of variant;Po, 120mg/kg) 0.5ml and 0.8ml points Not Gei the injection of 20 mouse peritoneals or stomach-filling, observe 14 days, as a result discovery mouse toxicity reaction or dead yet.
Stability
Ray functional areas and its variant sample are made using Freeze Drying Technique, are saved 12 months in -20 DEG C of refrigerators, are given birth to Object activity (inhibits angiogenesis, inhibits in vitro culture oncocyte and mice transplanted tumor growth) nothing to be substantially reduced.
Ray functional areas and its variant can be mixed or be dissolved with pharmaceutical carrier, and the drug of the various tumours for the treatment of, packet is made Include various dosage forms, which can be used for leukaemia, also can be used for various entity tumors, as cancer of the esophagus, liver cancer, gastric cancer, cancer of pancreas, Colon and rectum carcinoma, cervical carcinoma, oophoroma, breast cancer, nasopharyngeal carcinoma, carcinoma of mouth, lip cancer, cutaneum carcinoma, bladder cancer, on chorion The treatment of skin cancer, carcinoma of parotid gland, lymthoma, myomata, melanoma and various intracranial tumors etc., and its in the people for needing this treatment In application.In made various combination of oral medication, the content of ray functional areas and its variant is that daily every Kg weight is big About 0.001-100mg, preferably from about 0.01-50mg, more excellent about 0.05-30mg, most preferably about 0.1-10mg.Make for every bu 2-4 times With, 10-30 days as a treatment course, 3-6 course for the treatment of of general medication, each course for the treatment of interval 10-30 days.Made injectable drug group Close object, for intramuscular injection or intravenous drip, wherein the content of ray functional areas and its variant be daily every Kg weight about 0.001-50mg, preferably from about 0.01-25mg, more excellent about 0.05-15mg, most preferably about 0.1-3mg.Every bu 1-3 times use, 10-30 days as a treatment course, 3-6 course for the treatment of of general medication, each course for the treatment of interval 10-30 days.However, accurate dosage should be by doctor It determines, depends primarily on age, weight, the state of an illness, reaction of patient etc..
Sequence table
110 > of < brave
120 > ray Anti-angiogenesis factors of <, 1 function region variants JG42 and its application
〈160〉1
〈210〉1
〈211〉225
〈212〉PRT
213 > ray of <
〈400〉1
TLDIYKQLRD KETPSGFTLD DVIQTGVDNP GHPFIMTVGC VAGDEESYEV FKALFDPVIQ 60
DRHGGYKPTD KHKTDLNHEN LKGGDDLDPN YVLSSRVRTG RSIKGIALPP HCSRGERRLV 120
EKLCLEGLAT LTGEFQGKYY PLTTMSDAEQ QQLIDDHFLF DKPVSPLLLA SGMARDWPDA 180
RGIWHNNDKT FLVWVNEEDH LRVISMQKGG NMKEVFRRFC VGLKK 225

Claims (3)

1. a kind of 1 functional areas protein variant of ray Angiostatin, which is characterized in that the ammonia shown in SEQ ID NO:1 On the basis of base acid, the 62nd amino acids R is replaced by V.
2. protein variant as described in claim 1 inhibits the purposes in tumour medicine in preparation, the tumour is lung cancer or nose Pharynx cancer.
3. a kind of anti-tumor medicinal preparation, it contains protein variant described in claim 1 and pharmaceutically suitable carrier.
CN201610017404.0A 2014-06-06 2014-06-06 1 function region variants JG42 of ray Angiostatin and its application Active CN105481962B (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN201610017404.0A CN105481962B (en) 2014-06-06 2014-06-06 1 function region variants JG42 of ray Angiostatin and its application

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
CN201410249736.2A CN104031136B (en) 2014-06-06 2014-06-06 Ray Angiostatin 1 functional areas variant and application thereof
CN201610017404.0A CN105481962B (en) 2014-06-06 2014-06-06 1 function region variants JG42 of ray Angiostatin and its application

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
CN201410249736.2A Division CN104031136B (en) 2014-06-06 2014-06-06 Ray Angiostatin 1 functional areas variant and application thereof

Publications (2)

Publication Number Publication Date
CN105481962A CN105481962A (en) 2016-04-13
CN105481962B true CN105481962B (en) 2019-08-20

Family

ID=51462152

Family Applications (16)

Application Number Title Priority Date Filing Date
CN201610037005.0A Active CN105481967B (en) 2014-06-06 2014-06-06 1 function region variants JG16 of ray Angiostatin and its application
CN201610017406.XA Expired - Fee Related CN105481963B (en) 2014-06-06 2014-06-06 1 function region variants JG50 of ray Angiostatin and its application
CN201610017410.6A Active CN105481964B (en) 2014-06-06 2014-06-06 1 function region variants JG60 of ray Angiostatin and its application
CN201610017442.6A Active CN105418752B (en) 2014-06-06 2014-06-06 1 function region variants JG89 of ray Angiostatin and its application
CN201610017470.8A Expired - Fee Related CN105418742B (en) 2014-06-06 2014-06-06 1 function region variants JG135 of ray Angiostatin and its application
CN201610017393.6A Pending CN105481961A (en) 2014-06-06 2014-06-06 Ray angiogenesis inhibiting factor (1) functional domain variant JG23 and application thereof
CN201610017401.7A Pending CN105541984A (en) 2014-06-06 2014-06-06 Manta-angiogenesis-inhibitor-1 functional-area variant JG36 and application thereof
CN201610017404.0A Active CN105481962B (en) 2014-06-06 2014-06-06 1 function region variants JG42 of ray Angiostatin and its application
CN201610017473.1A Active CN105461792B (en) 2014-06-06 2014-06-06 1 function region variants JG164 of ray Angiostatin and its application
CN201610017478.4A Active CN105418753B (en) 2014-06-06 2014-06-06 1 function region variants JG217 of ray Angiostatin and its application
CN201610017409.3A Active CN105440117B (en) 2014-06-06 2014-06-06 1 function region variants JG55 of ray Angiostatin and its application
CN201610017419.7A Active CN105440118B (en) 2014-06-06 2014-06-06 1 function region variants JG70 of ray Angiostatin and its application
CN201610017475.0A Active CN105481966B (en) 2014-06-06 2014-06-06 1 function region variants JG175 of ray Angiostatin and its application
CN201610017459.1A Active CN105541985B (en) 2014-06-06 2014-06-06 1 function region variants JG121 of ray Angiostatin and its application
CN201410249736.2A Expired - Fee Related CN104031136B (en) 2014-06-06 2014-06-06 Ray Angiostatin 1 functional areas variant and application thereof
CN201610017414.4A Active CN105481965B (en) 2014-06-06 2014-06-06 1 function region variants JG63 of ray Angiostatin and its application

Family Applications Before (7)

Application Number Title Priority Date Filing Date
CN201610037005.0A Active CN105481967B (en) 2014-06-06 2014-06-06 1 function region variants JG16 of ray Angiostatin and its application
CN201610017406.XA Expired - Fee Related CN105481963B (en) 2014-06-06 2014-06-06 1 function region variants JG50 of ray Angiostatin and its application
CN201610017410.6A Active CN105481964B (en) 2014-06-06 2014-06-06 1 function region variants JG60 of ray Angiostatin and its application
CN201610017442.6A Active CN105418752B (en) 2014-06-06 2014-06-06 1 function region variants JG89 of ray Angiostatin and its application
CN201610017470.8A Expired - Fee Related CN105418742B (en) 2014-06-06 2014-06-06 1 function region variants JG135 of ray Angiostatin and its application
CN201610017393.6A Pending CN105481961A (en) 2014-06-06 2014-06-06 Ray angiogenesis inhibiting factor (1) functional domain variant JG23 and application thereof
CN201610017401.7A Pending CN105541984A (en) 2014-06-06 2014-06-06 Manta-angiogenesis-inhibitor-1 functional-area variant JG36 and application thereof

Family Applications After (8)

Application Number Title Priority Date Filing Date
CN201610017473.1A Active CN105461792B (en) 2014-06-06 2014-06-06 1 function region variants JG164 of ray Angiostatin and its application
CN201610017478.4A Active CN105418753B (en) 2014-06-06 2014-06-06 1 function region variants JG217 of ray Angiostatin and its application
CN201610017409.3A Active CN105440117B (en) 2014-06-06 2014-06-06 1 function region variants JG55 of ray Angiostatin and its application
CN201610017419.7A Active CN105440118B (en) 2014-06-06 2014-06-06 1 function region variants JG70 of ray Angiostatin and its application
CN201610017475.0A Active CN105481966B (en) 2014-06-06 2014-06-06 1 function region variants JG175 of ray Angiostatin and its application
CN201610017459.1A Active CN105541985B (en) 2014-06-06 2014-06-06 1 function region variants JG121 of ray Angiostatin and its application
CN201410249736.2A Expired - Fee Related CN104031136B (en) 2014-06-06 2014-06-06 Ray Angiostatin 1 functional areas variant and application thereof
CN201610017414.4A Active CN105481965B (en) 2014-06-06 2014-06-06 1 function region variants JG63 of ray Angiostatin and its application

Country Status (1)

Country Link
CN (16) CN105481967B (en)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN104774898B (en) * 2015-04-24 2020-07-14 浙江海洋学院 Application of tuna dark meat protein anti-cervical cancer polypeptide

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101260151A (en) * 2007-03-05 2008-09-10 广东海洋大学 Separation and primary structure of sea purse blood vessel generation inhibitive factor 1, and application thereof in preparing blood vessel generation inhibiting medicament and antineoplastic medicam
CN101724631A (en) * 2008-11-03 2010-06-09 广东海洋大学 Preparation of functional area of sea purse blood vessel growth inhibition factor 1 and use of the functional area of sea purse blood vessel growth inhibition factor 1 in medicaments for preventing and curing tumors
CN102167725A (en) * 2010-12-07 2011-08-31 浙江海洋学院 Method for preparing Raja porosa angiogenesis inhibiting factor RCAIF-I

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101260151A (en) * 2007-03-05 2008-09-10 广东海洋大学 Separation and primary structure of sea purse blood vessel generation inhibitive factor 1, and application thereof in preparing blood vessel generation inhibiting medicament and antineoplastic medicam
CN101724631A (en) * 2008-11-03 2010-06-09 广东海洋大学 Preparation of functional area of sea purse blood vessel growth inhibition factor 1 and use of the functional area of sea purse blood vessel growth inhibition factor 1 in medicaments for preventing and curing tumors
CN102167725A (en) * 2010-12-07 2011-08-31 浙江海洋学院 Method for preparing Raja porosa angiogenesis inhibiting factor RCAIF-I

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
赤魟软骨血管生成抑制因子的纯化及抗血管生成活性验证;罗红宇等;《水产学报》;20071130;第31卷(第6期);第813-817页

Also Published As

Publication number Publication date
CN105461792B (en) 2019-08-20
CN105481963A (en) 2016-04-13
CN105440117A (en) 2016-03-30
CN105440118B (en) 2018-10-16
CN105481966B (en) 2019-05-28
CN105440118A (en) 2016-03-30
CN105418752B (en) 2018-12-25
CN105481964B (en) 2018-10-09
CN105481967A (en) 2016-04-13
CN104031136B (en) 2016-08-17
CN105481966A (en) 2016-04-13
CN105541984A (en) 2016-05-04
CN105481965A (en) 2016-04-13
CN105481962A (en) 2016-04-13
CN105481961A (en) 2016-04-13
CN105418742B (en) 2018-12-25
CN105481965B (en) 2019-04-26
CN104031136A (en) 2014-09-10
CN105541985A (en) 2016-05-04
CN105418752A (en) 2016-03-23
CN105440117B (en) 2018-10-26
CN105481964A (en) 2016-04-13
CN105481967B (en) 2019-08-13
CN105418742A (en) 2016-03-23
CN105541985B (en) 2019-08-16
CN105418753B (en) 2018-12-21
CN105418753A (en) 2016-03-23
CN105461792A (en) 2016-04-06
CN105481963B (en) 2019-08-16

Similar Documents

Publication Publication Date Title
CN105481965B (en) 1 function region variants JG63 of ray Angiostatin and its application
CN105112391B (en) A kind of people source arginase mutant and its preparation method and application
CN107488734B (en) MiR-19a-3p is preparing the application in prostate cancer with osseous metastasis diagnostic reagent and therapeutic agent
CN113583095B (en) Antitumor polypeptide and application thereof
CN104130311B (en) A kind of natineoplaston variant and application thereof
CN109666064A (en) SALL4-RBBp4 complex blocks polypeptide and derivative antineoplastic polypeptide and its application
CN104672303A (en) Anti-tumor peptide variant NC6 and application thereof
CN106349371A (en) Human SFRP1 varient and application thereof
CN106349372A (en) Human SFRP1 varient and application thereof
CN106349368A (en) Human SFRP1 varient and application thereof
CN106349369A (en) Human SFRP1 varient and application thereof
CN106349370A (en) Human SFRP1 varient and application thereof
CN106349367A (en) Human SFRP1 varient and application thereof
CN106349373A (en) Human SFRP1 (secreted frizzled-related protein 1) variant and application thereof
CN106349376A (en) Human SFRP1 (secreted frizzled-related protein 1) variant and application thereof
CN104610427A (en) Anti-tumor peptide variant NC10 and application thereof
CN104610429A (en) Anti-tumor peptide variant NC13 and application thereof
CN104610428A (en) Anti-tumor peptide variant NC12 and application thereof
CN104592355A (en) Anti-tumor peptide variant NC3 and application thereof
CN104672305A (en) Anti-tumor peptide variant NC11 and application thereof
CN104672304A (en) Anti-tumor peptide variant NC7 and application thereof

Legal Events

Date Code Title Description
C06 Publication
PB01 Publication
C10 Entry into substantive examination
SE01 Entry into force of request for substantive examination
TA01 Transfer of patent application right

Effective date of registration: 20190719

Address after: 312400 Room 1419-1, 1002 Xingsheng Street, Sanjiang Street, Shengzhou City, Shaoxing City, Zhejiang Province

Applicant after: Shengzhou Fake Machinery Co.,Ltd.

Address before: Room 201, Room 3, 48 Blocks, Beigan Yiyuan, Beigan Street, Xiaoshan District, Hangzhou City, Zhejiang Province

Applicant before: Zhang Yong

TA01 Transfer of patent application right
GR01 Patent grant
GR01 Patent grant
TR01 Transfer of patent right

Effective date of registration: 20211123

Address after: 312500 No. 1, Hongqi Road, Xinchang Industrial Park (dashiju town), Shaoxing City, Zhejiang Province

Patentee after: ZHEJIANG ZENTAX MACHINERY CO.,LTD.

Address before: Room 1419-1, 1002 Xingsheng street, Sanjiang street, Shengzhou City, Shaoxing City, Zhejiang Province

Patentee before: Shengzhou Fake Machinery Co.,Ltd.

TR01 Transfer of patent right
PE01 Entry into force of the registration of the contract for pledge of patent right

Denomination of invention: Ray angiogenesis inhibitor 1 functional region variant jg42 and its application

Effective date of registration: 20211224

Granted publication date: 20190820

Pledgee: Xinchang Zhejiang rural commercial bank Limited by Share Ltd.

Pledgor: ZHEJIANG ZENTAX MACHINERY CO.,LTD.

Registration number: Y2021330002639

PE01 Entry into force of the registration of the contract for pledge of patent right
PC01 Cancellation of the registration of the contract for pledge of patent right

Date of cancellation: 20230103

Granted publication date: 20190820

Pledgee: Xinchang Zhejiang rural commercial bank Limited by Share Ltd.

Pledgor: ZHEJIANG ZENTAX MACHINERY CO.,LTD.

Registration number: Y2021330002639

PC01 Cancellation of the registration of the contract for pledge of patent right
PE01 Entry into force of the registration of the contract for pledge of patent right

Denomination of invention: The functional region variant JG42 of ray angiogenic inhibitor 1 and its application

Effective date of registration: 20230113

Granted publication date: 20190820

Pledgee: Xinchang Zhejiang rural commercial bank Limited by Share Ltd.

Pledgor: ZHEJIANG ZENTAX MACHINERY CO.,LTD.

Registration number: Y2023330000174

PE01 Entry into force of the registration of the contract for pledge of patent right
PC01 Cancellation of the registration of the contract for pledge of patent right

Date of cancellation: 20230328

Granted publication date: 20190820

Pledgee: Xinchang Zhejiang rural commercial bank Limited by Share Ltd.

Pledgor: ZHEJIANG ZENTAX MACHINERY CO.,LTD.

Registration number: Y2023330000174

PC01 Cancellation of the registration of the contract for pledge of patent right
TR01 Transfer of patent right

Effective date of registration: 20240711

Address after: 312500 no.7-3, daguinian village, jingling Town, Xinchang County, Shaoxing City, Zhejiang Province

Patentee after: Xinchang Yanghui Network Technology Co.,Ltd.

Country or region after: China

Address before: 312500 No. 1, Hongqi Road, Xinchang Industrial Park (dashiju town), Shaoxing City, Zhejiang Province

Patentee before: ZHEJIANG ZENTAX MACHINERY CO.,LTD.

Country or region before: China

TR01 Transfer of patent right