CN101077889A - Polypeptide similar to growth factor and maintenance product - Google Patents
Polypeptide similar to growth factor and maintenance product Download PDFInfo
- Publication number
- CN101077889A CN101077889A CN 200610089898 CN200610089898A CN101077889A CN 101077889 A CN101077889 A CN 101077889A CN 200610089898 CN200610089898 CN 200610089898 CN 200610089898 A CN200610089898 A CN 200610089898A CN 101077889 A CN101077889 A CN 101077889A
- Authority
- CN
- China
- Prior art keywords
- growth factor
- polypeptide compound
- care products
- amino acid
- skin care
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Images
Landscapes
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The present invention is one kind of growth factor-like polypeptide and the health product therewith. The growth factor-like polypeptide includes has the amino acid segment of DQAKSMSKDESVDYVCPLCMYIEALYRSCEKHRLPMLNPDMIVRSC KCS, can promote the growth of fibroblast and the secretion of collagen and tissue interstitium, and has functions similar to that of growth factor. The health product comprising skin acceptable medium and the growth factor-like polypeptide has the health functions of lightening line crack and wrinkle, raising skin elasticity, reducing skin melanin and strengthening skin moisture keeping capacity.
Description
Technical field
The present invention relates to a kind growth factor polypeptide and a skin care products thereof, especially refer to a kind of fibroblast growth that can promote fast in the skin skin corium, also promote simultaneously excretory class growth factor polypeptide and skin care products thereof between collagen protein and tissue, it makes an addition in the skin care products, to the desalination wrinkle and increase skin elasticity, improve dermal melanin, strengthen skin and independently lock outlet capacity suitable effect is arranged.
Background technology
The mankind make great efforts after solving health problem, and the life-span constantly prolongs, and therefore, what next must face is the aged problem; Skin care products is constantly weeded out the old and bring forth the new, and left-handed C, Hyaluronic Acid are constantly emerged like emerging rapidly in large numbersBamboo shoots after a spring rain, and become the period of the Warring States of a skin care products.
Though the skin care products of chemosynthesis is quite in vogue, utilizing biotechnology to extract effective skin care products composition from natural product is the leading role of skin care products, especially somatomedin skin care products in recent years, and the personage that more likes to be beautiful continues saying it with interest.At present on the market the somatomedin skin care products with Urogastron (Epidermal Growth Factor, EGF) with fiber mother cell growth factor (Fibroblast Growth Factors, FGF) be main, mainly come from fermentation, extractions such as cattle and sheep placenta, serum extraction, baby's foreskin or intestinal bacteria, purity is generally less than 70%, the more easy allergy of impurity, and the source is not clear, and the residual risk of disease infection and intracellular toxin is easily arranged.In addition, the protein that somatomedin is made up of amino acid, general molecular weight is all greater than 5.6kD, most more than 16～30kD, its molecular weight has surpassed the acceptable scope of human body pore (about 3kD), at present existing experiment confirm just can enter epiderm skin less than the material of 10kD and play a role, and the molecule of experiment confirm less than 3kD also arranged, and is easier to by skin absorption.Therefore, the somatomedin that comprises fiber mother cell growth factor major parts such as (FGF) all can't enter skin corium because molecular weight is too big and plays a role.Urogastron mainly is to promote epidermal growth, does not then have too big improvement ability for the skin wrinkle.
The skin care products of biotechnology gained, for instance, on the market at prevention or improve that skin is lax to have two big class effect products with wrinkle, a kind of is to reach by the physical property composition to allow skin consolidation immediately, but this mode can't really solve the lax problem of skin ageing, and it is quite short therefore to keep the time that skin compacts.Basic solution is still replenished the major ingredient-collagen protein of skin corium.The oligopeptides or the polypeptide composition of present skin care products circle hot topic, it promptly is a kind of promotion composition of collagenic protein, two above sequences of being formed of Amino acid are called oligopeptides, the sequence that Amino acid more than ten is formed is called polypeptide, synthetic by professional instrument, effect is different with putting in order according to the Amino acid classification of forming; Generally speaking, Amino acid quantity is few more, and easy more synthetic, cost is also lower, less than the oligopeptides of 10 Amino acids, can't form three-dimensional arrangement though molecule is little, does not therefore have protein active, and three oligopeptides, five oligopeptides or six oligopeptides are not always the case.Two kinds of more well known in the market oligopeptides are five oligopeptides (Matrixyl
TM) and six oligopeptides (Argireline
), five oligopeptides are the raw material that French SEDERMA company is produced, and mainly are to form a fat-soluble oligopeptides by five Amino acids and palmitinic acid, experiment in vitro shows the function of strengthening the 4th type (Type IV) collagen protein synthesis.Six oligopeptides then are the raw materials that Spain LIPOTEC company is produced, and are called the Argireline element again, so its effect of name Si Yi is similar to the Botox (BOTOX of injection
), the mechanism of utilizing its block nerves transmitter substance (Acetylcholine acetylcholine) to discharge suppresses the contraction of muscle, reaches the effect of eliminating dynamic lines.No matter be five oligopeptides or six oligopeptides, it not existing Amino acid sequential structure in the human body, but by the molecule of the synthetic gained of science and technology, five oligopeptides whether can be single-minded to skin corium fibroblast (fibroblast) and effectively produce excitation and six oligopeptides whether can the block nerves conduction, still lack complete experiment at present and clinical trial proves its effect.According to above-mentioned, having the desalination microgroove concurrently and increasing the elastic skin care products of skin is the problem that beauty treatment industry desire solves always.
Summary of the invention
Because it is the problem of the existence of above-mentioned prior art the object of the present invention is to provide a kind growth factor polypeptide, synthetic with the Amino acid that human body is necessary; This polypeptide compound can promote the fibroblast growth, promotes secretion between collagen protein and tissue simultaneously; The function that analog growth factor is arranged.It adds the made skin care products of this polypeptide compound, to desalination microgroove and wrinkle and increase skin elasticity, improve dermal melanin, the reinforcement skin is independently locked outlet capacity that suitable effect is arranged.
Moreover, the object of the present invention is to provide a kind growth factor polypeptide, utilize effective fragment of the spontaneous growth factor to be made up, its molecular weight is moderate, being about about 2～3kD, is 1/10th to 1/18th of general somatomedin, helps to enter the human body skin post-absorption.
For reaching above-mentioned purpose, embodiments of the invention provide a kind growth factor polypeptide, and it is selected from as follows, comprises:
The polypeptide compound that the arbitrary fragment of DQAKSMSKDESVDYVCPLCMYIEALYRSCEKHRLPMLNPDMIVRSCKCS Amino acid sequence is formed, wherein the contained Amino acid number of this polypeptide is between 15 to 49.
For reaching above-mentioned purpose, embodiments of the invention provide a kind of skin care products that adds the class growth factor polypeptide, and it is selected from as follows, comprises:
The acceptable medium of polypeptide compound that the arbitrary fragment of DQAKSMSKDESVDYVCPLCMYIEALYRSCEKHRLPMLNPDMIVRSCKCS Amino acid sequence is formed and skin mixes.
This type of growth factor polypeptide is similar to the important structure of the interior spontaneous growth factor that exists originally of human body skin, effect then with human body in the complete spontaneous growth factor close, with present common on the market somatomedin EGF, FGF by comparison, the molecule of disclosed class growth factor polypeptide is less, so when the skin care products of interpolation class growth factor polypeptide was applied in skin surface, the easier absorption also by skin entered skin corium effectively fast, so can see wrinkle improvement effect at short notice.
For making purpose of the present invention, structural attitude and function are had further understanding, conjunction with figs. and related embodiment are described in detail as follows now.
Description of drawings
Fig. 1 is the class growth factor polypeptide compound cytoactive test comparison diagram of the embodiment one of according to the present invention.
Fig. 2 A, 2B, 2C, 2D are 72 hours the figure as a result of class growth factor polypeptide compound cytoactive test experience of the embodiment one of according to the present invention.
Fig. 3 is the case clinical trial-left decree line of the class growth factor polypeptide skin care products of embodiment one of according to the present invention.
Fig. 4 A and Fig. 4 B are the case clinical trial-left temporal wrinkle of the class growth factor polypeptide skin care products of embodiment one of according to the present invention.
Fig. 5 A and Fig. 5 B are the case clinical trial-forehead wrinkle of the class growth factor polypeptide skin care products of embodiment one of according to the present invention.
Fig. 6 is that the clinical trial melanochrome of the class growth factor polypeptide skin care products of embodiment one of according to the present invention reduces the ratio comparison diagram.
Fig. 7 is the clinical trial skin elasticity velocity of variation comparison diagram of the class growth factor polypeptide skin care products of embodiment one of according to the present invention.
Fig. 8 divides the scatter ratio, scatter and disappear ratio comparison diagram for the clinical trial of the class growth factor polypeptide skin care products of the embodiment one of according to the present invention through the severe edema due to hypofunction of the spleen.
Embodiment
Class growth factor polypeptide of the present invention, being selected from human body must synthesize by Amino acid, the effect of this polypeptide is similar to the complete spontaneous growth factor, but the complete spontaneous growth factor is because molecular weight is bigger, be not easy when being applied in skin to absorb, effective fragment of the spontaneous growth factor is made up, but can obtain the effect class growth factor polypeptide compound less to the complete similar molecular weight of the spontaneous growth factor, this polypeptide compound is few at people's in-vivo content, necessary the Amino acid of part even can only be by external complement, so must make by professional instrument synthetic mode.
The spontaneous growth factor of being utilized in one embodiment of the invention comprises: insulin-like growth factor-1 (Insulin-like growth factor 1, IGF-1), fiber mother cell growth factor (FGF), epithelical cell growth factor (EGF), transforming growth factor-beta (Transforming growth factor β, TGF-β), thrombocyte derivation somatomedin (Platelet-derived growth factor, PDGF), keratinocyte growth factor (Keratinocyte growth factor, but be not limited to above-mentioned natural factor composition KGF).
Effective fragment of above-mentioned somatomedin mostly is the polypeptide compound that 15～80 specific Amino acids combine, though the general somatomedin of its molecule is little many, functions such as its cell growth all have equal effect.
In this embodiment, these class growth factor polypeptides are taken from the polypeptide compound that the part fragment of DQAKSMSKDESVDYVCPLCMYIEALYRSCEKHRLPMLNPDMIVRSCKCS Amino acid sequence is formed, and synthesize the polypeptide compound of different Amino acid numbers via professional instrument.Following table is the Amino acid full name of announcement and single-letter and the trigram and the corresponding Chinese of abbreviation, is described as follows:
| Abbreviation | Full name | Chinese translation | |
| G | Gly | Glycine | Glycine |
| A | Ala | Alanine | Beta Alanine |
| V | Val | Valine | The figured silk fabrics amino acid |
| L | Leu | Leucine | White amino acid |
| I | Ile | Isoleucine | Different white amino acid |
| F | Phe | Phenylalanine | Phenylalanine |
| W | Trp | Tryptophan | Tryptophane |
| Y | Tyr | Tyrosine | Tyrosine |
| D | Asp | Aspartic acid | The asparagus fern amino acid |
| H | His | Histidine | Histidine |
| N | Asn | Asparagine | Asparagus fern vinegar amino acid |
| E | Glu | Glutamic acid | Vetsin |
| K | Lys | Lysine | From amino acid |
| Q | Gln | Glutamine | Bran vinegar amino acid |
| M | Met | Methionine | MET |
| R | Arg | Arginine | Spermine acid |
| S | Ser | Serine | The silk amino acid |
| T | Thr | Threonine | Soviet Union's amino acid |
| C | Cys | Cysteine | Cystinic acid |
| P | Pro | Proline | Proline |
Wherein, the polypeptide compound with effect can comprise the polypeptide compound that reaches 49 Amino acids, should have the polypeptide compound of 15 Amino acids the most at least, because Amino acid quantity polypeptide compound does not very little reach the disclosed effect of the present invention.In a preferred embodiment, 15 peptide growth factors that comprise MSKDESVDYVCPLCM Amino acid sequence have preferable effect, and desalination wrinkle and increase skin elasticity are also had effect more fast.
The disclosed class growth factor polypeptide of the present invention can promote the fibroblast (fibroblast) in the skin skin corium to grow to produce a large amount of collagen proteins fast, also can promote simultaneously matter between tissue (ECM) growth, directly carry out activation, quick smoothing wrinkle, desalinate microgroove and increase skin elasticity and water retaining function at the dermis of skin confluent monolayer cells.
The related genera somatomedin the more cytoactive of peptide compounds is tested as follows:
Test and Selection is with 5 * 10
4Fibroblast begins to test in the Tissue Culture Dish (6-wellplate) of 6-grid space, implants fibroblast and begins to carry out cell cycle synchronization (cell starvation) after 18 hours; (phosphate buffersaline, PBS) flushing use the cell culture medium that does not contain serum to cultivate after 8 hours afterwards, change substratum with phosphoric acid buffer then; And adding the polypeptide compound (18 μ g/L) of 15 Amino acids and the polypeptide compound (18 μ g/L) of 30 Amino acids respectively in experimental group, control group then adds general substratum and natural EGF.See also Fig. 1, every group of test is 3 repetitions, observes respectively 0 hour, 24 hours, 48 hours and 72 hours.Compared to control group, add the obvious growth of experimental group of polypeptide compound and more only add the control group of general substratum for quick, but the polypeptide compound that adds 30 Amino acids is slower slightly than the control group that only adds natural EGF, wherein the fastest experimental group with the polypeptide compound that adds 15 Amino acids of fibroblast growth.
See also Fig. 2 A, 2B, 2C and 2D, be respectively control group, 30 polypeptide, natural EGF and 15 polypeptide, add its fibroblast of experimental group of the polypeptide compound of 15 Amino acids with Fig. 2 D and grow the fastest through fibroblast number in 72 hours the culture dish.
Skin care products embodiment
Disclosed class growth factor polypeptide skin care products further specifies with reference to following examples, but be not limited to the following example, the skin care products of natural such as extraction or organic synthesis is all suitable, disclosed skin care products is with the cold-working processing mode person of being reached, the skin care products that makes under the high temperature also is not suitable for adding disclosed class growth factor polypeptide, therefore preferable its material temperature of service temperature must be controlled at below 40 ℃, in addition, the skin care products that mixes disclosed class growth factor polypeptide must remain on its effect of the following competence exertion of pH7.0:
The moisture-keeping crease-shedding skin-active reveals
Prescription: deionized water (88%), glycerine (5%), propylene glycol (5%), Tween 80 (1%), pro-vitamin B5 (0.5%), class growth factor polypeptide compound (0.0000025%), water-soluble fungistat (0.3%), vitamins D (0.1%), vitamin-E (0.1%).
Method for making: under room temperature state (temperature is not higher than 37 ℃) earlier deionized water is filled part with Tween 80 and mixes, again vitamins D and vitamin-E are added, evenly stir and make it to become water white liquid, and then get final product to such an extent that the moisture-keeping crease-shedding skin-active reveals mixing after the adding of compositions such as glycerine, propylene glycol, pro-vitamin B5, class growth factor polypeptide compound, water-soluble fungistat.
Moisture-keeping crease-shedding eye glue
Prescription: (A) butyleneglycol (5%), fungistat (0.25%), (B) glutinous Polysaccharides macromolecule glue (Polyglucan) (1.0%), (C) deionized water (80%), (D) lactic acid (1.5%), (E) witch hazel extraction (3%), Minor centaury extraction (3%), Williams Elder Twig extraction (3%), (F) candy aldehydic acid sodium (3%), collagen protein (0.25%), class growth factor polypeptide compound (0.000005%)
Method for making: earlier (A) filled a part mixed dissolution, (B) being added mix in (A) again becomes (A+B).Then (C) is heated to 80 ℃, will stirs in (A+B) adding (C) again, when treating that its temperature is reduced to about 50 ℃, add (D) and stir.When treating that temperature is reduced to about 40 ℃ (E) added and stir, again will (F) when treating at last that temperature is reduced to below 35 ℃ adding stirs afterwards get final product moisture-keeping crease-shedding eye glue.
The full anti-wrinkle cream of imitating
Prescription: (A) glycerine stearic acid (Glyceryl stearate) emulsifying agent (2.5%), PEG-100 stearic acid emulsifying agent (6%), oleyl alcohol (1.7%), PEG-30 stearic acid emulsifying agent (1%), synthetic ester (9.5%), mineral oil (5.5%), silicon spirit (Dimethicone) (3%), oil soluble fungistat (0.2%), (B) deionized water (60.85%), propylene glycol (3%), water-soluble fungistat (0.2%), neusilin (Magnesium aluminium silicate) (0.8%), (C) candy aldehydic acid sodium (3%), collagen protein (0.25%), class growth factor polypeptide compound (0.00001%), (D) macromolecule glue (1.6%), (E) triethanol ammonium (0.9%).
Method for making: all compositions in (A) are mixed, and be heated to 85 ℃ standby.Secondly all compositions in (A) are mixed, and be heated to 85 ℃.With (A) and (B) in the vacuum emulsification machine, fill down at a high speed then and part mix, will (C) when treating that temperature is reduced to below 35 ℃ add and mix in the state of vacuumizing, add again (D) and (E) the adjustment denseness get final product after moderate to such an extent that imitate anti-wrinkle cream entirely.
Class growth factor polypeptide skin care products effect clinical trial
The clinical trial case
See also Fig. 3, decree line place, the left side uses class growth factor polypeptide skin care products, and does not then use on the right, and decree line place, the left side, week back decree line obviously shoals.
See also Fig. 4 A and Fig. 4 B, Fig. 4 A is for using the preceding left side temporal wrinkle situation of class growth factor polypeptide skin care products, and Fig. 4 B is the situation for using the left side, three week backs temporal wrinkle obviously to shoal then.
See also Fig. 5 A and Fig. 5 B, Fig. 5 A obviously shoals for forehead wrinkle after using for three weeks for the preceding forehead wrinkle situation of use class growth factor polypeptide skin care products, Fig. 5 B.
The average conclusion of clinical trial
Carry out 15 peptide growth factor Firm through the women of 19 Taiwans and whiten after the series product clinical efficacy evaluation test, whole skin elasticity, melanochrome and divide scatter and disappear (skin is independently locked outlet capacity) that significant improvement is all arranged through the severe edema due to hypofunction of the spleen.
Skin elasticity:
See also Fig. 6, use three all backs skin elasticity that significant improvement is promptly arranged, continue to use to nine weeks, especially before " eye tail " located than use, increased by 42%.
Melanochrome improves:
See also Fig. 7, use three all backs melanochrome obviously to reduce, continue to use to nine weeks, especially locate before using, to have reduced 48% at " forehead ".
Divide scatter and disappear (skin is independently locked outlet capacity) through the severe edema due to hypofunction of the spleen:
See also Fig. 8, used for three weeks, continue to use to nine weeks, especially locate before using, to have reduced 25%, also refer to that locating skin at " left cheekbone " independently locks outlet capacity and promoted 25% at " left cheekbone " after the speed that the severe edema due to hypofunction of the spleen divide to scatter and disappear obviously descends manyly.
In sum, utilize the disclosed class growth factor polypeptide of the present invention compound obvious effects to be arranged for the hyperplasia activation of fibroblast, add the skin care products of this polypeptide compound, the effect that then manifests quite superior anti-aging and smoothing wrinkle, be the polypeptide skin care products of prior art or natural somatomedin skin care products can't reach, have suitable progressive.
The above, it only is preferred embodiment of the present invention, when not limiting the scope of the invention with this, promptly the equalization of being done according to the present patent application claim generally changes and modifies, will not lose main idea of the present invention place, also do not break away from the spirit and scope of the present invention, the former capital should be considered as further enforcement situation of the present invention.
Claims (13)
1. a kind growth factor polypeptide compound, it comprises:
An arbitrary segmental polypeptide compound of DQAKSMSKDESVDYVCPLCMYIEALYRSCEKHRLPMLNPDMIVRSCKCS Amino acid sequence.
2. class growth factor polypeptide compound as claimed in claim 1, wherein the contained Amino acid number of the Amino acid sequence of this polypeptide compound is between 15 to 49.
3. class growth factor polypeptide compound as claimed in claim 1, wherein the contained Amino acid number of the Amino acid sequence of this polypeptide compound is preferably 15.
4. class growth factor polypeptide compound as claimed in claim 1, wherein the Amino acid sequence of this polypeptide compound the best is the Amino acid fragment of MSKDESVDYVCPLCM sequence.
5. class growth factor polypeptide compound as claimed in claim 1, wherein the molecular weight of this polypeptide compound is between between the 1kD to 5kD.
6. skin care products that adds class growth factor polypeptide compound, it comprises:
An arbitrary segmental polypeptide compound of DQAKSMSKDESVDYVCPLCMYIEALYRSCEKHRLPMLNPDMIVRSCKCS Amino acid sequence mixes with the acceptable medium of skin.
7. the skin care products of interpolation class growth factor polypeptide compound as claimed in claim 6, wherein this polypeptide compound is in 0.001% with respect to the full weight amount.
8. the skin care products of interpolation class growth factor polypeptide compound as claimed in claim 6, wherein the pH value is below 7.0.
9. the skin care products of interpolation class growth factor polypeptide compound as claimed in claim 6, the material temperature control is below 40 ℃ when wherein adding this polypeptide compound.
10. the skin care products of interpolation class growth factor polypeptide compound as claimed in claim 6, wherein this medium comprises VITAMIN.
11. the skin care products of interpolation class growth factor polypeptide compound as claimed in claim 6, wherein this medium comprises collagen protein.
12. the skin care products of interpolation class growth factor polypeptide compound as claimed in claim 6, wherein this medium comprises the composition of natural extraction.
13. the skin care products of interpolation class growth factor polypeptide compound as claimed in claim 6, wherein this medium comprises organic synthetic composition.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN 200610089898 CN101077889A (en) | 2006-05-25 | 2006-05-25 | Polypeptide similar to growth factor and maintenance product |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN 200610089898 CN101077889A (en) | 2006-05-25 | 2006-05-25 | Polypeptide similar to growth factor and maintenance product |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN101077889A true CN101077889A (en) | 2007-11-28 |
Family
ID=38905574
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN 200610089898 Withdrawn CN101077889A (en) | 2006-05-25 | 2006-05-25 | Polypeptide similar to growth factor and maintenance product |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN101077889A (en) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102988193A (en) * | 2011-09-19 | 2013-03-27 | 鼎翔生医科技有限公司 | Medical beautifying polypeptide capable of promoting cell regeneration and delaying skin aging |
| CN106137785A (en) * | 2016-08-03 | 2016-11-23 | 夏献民 | A kind of skin care item promoting skin repair to regenerate |
| CN111206017A (en) * | 2019-04-30 | 2020-05-29 | 浙江大学 | Serum-free culture medium for stem cells and application thereof |
| CN111888279A (en) * | 2020-09-02 | 2020-11-06 | 北京瀚梅生物科技有限公司 | Method for promoting collagen production and corresponding medicine or cosmetic |
| CN111961119A (en) * | 2020-09-02 | 2020-11-20 | 北京瀚梅生物科技有限公司 | Application of polypeptide in preparation of medicine or cosmetic for promoting collagen secretion |
-
2006
- 2006-05-25 CN CN 200610089898 patent/CN101077889A/en not_active Withdrawn
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102988193A (en) * | 2011-09-19 | 2013-03-27 | 鼎翔生医科技有限公司 | Medical beautifying polypeptide capable of promoting cell regeneration and delaying skin aging |
| CN102988193B (en) * | 2011-09-19 | 2014-07-30 | 康立为生医科技股份有限公司 | Medical beautifying polypeptide capable of promoting cell regeneration and delaying skin aging |
| CN106137785A (en) * | 2016-08-03 | 2016-11-23 | 夏献民 | A kind of skin care item promoting skin repair to regenerate |
| CN106137785B (en) * | 2016-08-03 | 2019-05-17 | 夏献民 | A kind of regenerated skin care item of promotion skin repair |
| CN111206017A (en) * | 2019-04-30 | 2020-05-29 | 浙江大学 | Serum-free culture medium for stem cells and application thereof |
| CN111888279A (en) * | 2020-09-02 | 2020-11-06 | 北京瀚梅生物科技有限公司 | Method for promoting collagen production and corresponding medicine or cosmetic |
| CN111961119A (en) * | 2020-09-02 | 2020-11-20 | 北京瀚梅生物科技有限公司 | Application of polypeptide in preparation of medicine or cosmetic for promoting collagen secretion |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2421551B2 (en) | Silk fibroin hydrogels and uses thereof | |
| US9458197B2 (en) | Elastin digest compositions and methods utilizing same | |
| US9393186B2 (en) | Synthetic peptides useful in the treatment of the skin and use thereof in cosmetic or dermopharmaceutical compositions | |
| US8877713B2 (en) | Anti-aging peptides and cosmetic and/or pharmaceutical composition containing same | |
| KR101093685B1 (en) | Novel palmitoyltripeptide and anti-wrinkle cosmetic composition containing it | |
| US20110269694A1 (en) | Novel anti-aging peptides and cosmetic and/or pharmaceutical composition containing same | |
| CN101077889A (en) | Polypeptide similar to growth factor and maintenance product | |
| KR101933685B1 (en) | Drug Coated Microneedle and Manufacturing Method Thereof | |
| CN111888279B (en) | Method for promoting collagen production and corresponding medicine or cosmetic | |
| KR20050059003A (en) | Compositions containing peptide copper complexes and soft tissue fillers | |
| JP2004501976A (en) | Peptide composition | |
| CN111961119B (en) | Application of polypeptide in preparation of medicine or cosmetic for promoting collagen secretion | |
| CN116440250A (en) | Use of recombinant calreticulin for promoting hair growth, nourishing hair, protecting hair or preventing hair loss and related products | |
| US20230233738A1 (en) | Compositions and methods for augmenting autologous fat grafts | |
| KR101348096B1 (en) | Polypeptide with chondrogenic activity of stem cell | |
| KR101796678B1 (en) | Tripeptide with activities of growth and activation of skin keratinocyte stem cell and use thereof | |
| EP3973948A2 (en) | Cosmetic composition with combined filler and skin regenerative effect | |
| KR20220150018A (en) | Composition for improving scars and keloid comprising zag protein-derived peptides | |
| WO2023081711A1 (en) | Cosmetic and personal care compositions comprising recombinant silk | |
| KR102077984B1 (en) | Composition for preventing and improving skin wrinkles |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C04 | Withdrawal of patent application after publication (patent law 2001) | ||
| WW01 | Invention patent application withdrawn after publication |