CN101054412A - Pathogenic gene for far end arthrosis bend, detection method and application thereof - Google Patents
Pathogenic gene for far end arthrosis bend, detection method and application thereof Download PDFInfo
- Publication number
- CN101054412A CN101054412A CN 200610046295 CN200610046295A CN101054412A CN 101054412 A CN101054412 A CN 101054412A CN 200610046295 CN200610046295 CN 200610046295 CN 200610046295 A CN200610046295 A CN 200610046295A CN 101054412 A CN101054412 A CN 101054412A
- Authority
- CN
- China
- Prior art keywords
- pipe
- far end
- pathogenic gene
- glu
- primer
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Landscapes
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The invention relates to TNNI2 gene, more specificly a far end arthrogryposis pathogenic gene and its detection method and uses. The gene possesses the amino acid sequence of SEQ ID No:1. The pathogenic gene mutation of genetic 2B type far end arthrogryposis is firstly discovered in seven generation family line in which troponin subunit I2 (TNNI2) the eigth exon 175 point codon AAG for coding lysine is deleted. The present invention also relates to disease diagnosis kit which is convenient and quick , highly effective.
Description
Technical field
The present invention relates to the TNNI2 gene, specifically a kind of pathogenic gene for far end arthrosis bend and detection method and application.
Background technology
The function of TNNI2 gene coded protein: human myofilament is mainly by actotropomyosin (Tropomysin, TMP), troponin (Troponin, TNN) and Actin muscle (Actin) form, TPM-TNN-Actin mixture and actomyosin (Myosin) coordinative role is controlled the contraction and the diastole of muscle.(document 1.Sung SS, Brassington AME, Grannatt K, Rutherford A, WhitbyFG., Krakowiak PA, Jorde LB, Carey JC, Bamshad M.Mutations in genesencoding fast-twitch contractile proteins cause distal arthrogryposis syndromes.Am.J.Hum.Genet, 2003,72:681-690.), the troponin (Troponin of human body, TNN) spherical in shape, by TNNI, TNNT, three subunits of TNNC form, and TNNC has the binding site of the two negative charges of some bands, thereby the Ca to occurring in the sarcoplasm
2+Very big avidity is arranged, and the effect of TNNT is that whole troponin molecule is incorporated into TPM, TNNI with TNNC in conjunction with Ca
2+Information pass to TPM, cause the conformational change of TPM, remove it to the inhibition that muscle fibrin and cross-bridges mutually combine, make Muscle contraction.The mixture of TNN is Ca in the skeletal muscle
2+Transmitter and setter, TNNI stops Muscle contraction by stoping the moving actomyosin ATP enzyme of flesh to activate, therefore the carboxy moiety of amino-acid residue has determined Ca at least
2+Susceptibility.When the aminoacid deletion of forming TNNI2, replacement, changed Ca
2+Susceptibility, influence the contraction of muscle.(document 2.Stefancsik R, Randall JD, Mao C, Sarkar S.Structure and sequence of the human fast skeletaltroponin T (TNNT3) gene:insight into the evolution of the gene and the origin ofthe developmentally regulated isoforms.Comp.Funct.Genomics, 2003,4 (6): 609-625.)
The TNNI2 gene is crossed over 4KB, is made up of 8 exons, and exon length does not wait from 4~222bp, the long 701bp of mRNA, 182 amino acid of encoding.
8 exons, 422-425,1067-1096,1241-1247,1795-1836,1920-2048,2211-2300,2423-2599,2845-3066; 7 introns, 426-1065,1070-1240,1248-1794,1837-1919,2049-2210,2301-2422,2560-2844.
The TNNI2 structure of far end arthrosis bend family pathogenic mutation gene (underscore partly is an exon):
GCTGACCTCGGGTGAGATGGGCTGAGGCGAGGTGTGGATACTCGCAGCTACCCCTCAGCTGACCCGAGCTGTGTG
CCCGGCTGAGGCCACAGGCAAAGCCAGGCACACTGTCCTCAGGCTCCTTACGAGAACGACAGAGGCATCTCCAGC
GCGTCACCGAGCCCTAAATAGAGTAGCCCAGCCACGGCACCCCCCACCAAGACTTCTTGGACTGGGCGGCAGCAC
GCGGCCAGGCCAGGCGGCCGGACAGGTGGGGAGGTCTCTGTGGCTCTCCACGCCCCCATTGGTCTGAGGAGGACT
CTATGCCCTTTCTGAGCAGGGGCCCAGCCTGGGGGAGGCCATTTATACCCCTCCCCCTGGGCCCACCAGCCCAAC
TCGCCGCTGCCGGCCTGACCTCGCTCCCAGCCCTGCTGCCCAGATT
CTAGGTGAGGCCCAGCCCGGCCCGCCGAG
GCCGGGGGACAGGGCGTGGCTCGAGCTGGTTTGAGGGAGGACTTCCTGGGGCGGGGGTCTGGGGGCCTGGGGGAT
GCCACCAGCAGCCCCCTTTGGGGCCTGCACGGGTCCGGGAGTGAGAAGGAGAGGGTTTGGGGAGGCAGGTGTAGC
GAGAGGCAGGTATTAGACACTCCCTGACCACCAGGCTTCACCTCTGGGGACCCTGGAAGGAGAGTTTAGGGGTCA
AGAAGCCCCAGAACCTGAGCCCCCAGGCCAAACTGAGGAGGGATTTCTTCCATGCACTTAGGCCCAAAGCCAAAG
AGAGAGGGTTAAAAATAACAGCGTCACTCAGGCGGCCACCTGCGCTGGCCCATCCCACCCTCCCTCGGGGACAGC
TGCAGCTCCTCAGGCTATGCCTGGGACATTTTGGGAACACTTTCTCCTCTTACTTCTCACCCTGGGGAATTCCAA
GACATTGTCCTTGAAGGAGGTGAGAGTAGGGGGAGGAGGTGAGAGTAGGGGGTGGGCGGGAGGGGGCTGTCATCA
GGAGCCCTGAACCCCTCACCACCTACCTGATGGGCACAGGCATCACGGTGGCAAGGGCCTGGCCAACACCTCTGT
CTTCCTCTCCCCACAG
GCTCCAAGCTCAGGACCTCAGGATGGGAGAGTAAGTGGTACCCCTGTACCCCCATACAG
TGACCCTGCCCACCTCCTGCCCTGTCCACCCCATCACACACTCCGACCCCGCCAGCCATGGCCCTAACCTCTGTC
TTCTCTCCCCGTCCTGCCTGCGTCCTCCCTCCCTGGACAG
TGAGGAGGTAAGTAGTTGCTGGGGGCTCAAAACAT
GACGAGGAGGGGGCTCCCCCAACTCAGCATAGGTCATAGGTCACAGCCTCAAGGCCCTAAGGCCCAGAGAAGATG
GCCTGGCCCTCCCCGCTGGCAAAAGTGCCCCACCCAACCACCAAGACGCTGCTGAAAGAGAGGAAGTGGCTGCCC
CAAGCCTTCTGGGGCAGGGGAAGTGTGGCTGTGGCCTGGTCACAGGGGAATCACTTCTTCTTTCTGATTCCTGCA
CTTCCCGCCCCCACCTCACCGGCCGACCTGCCCCCAACTGGCCCTCCTCTCCCCCAGCCTCTGGCCTCCCAGCAC
CATGTGCCACCTGGCAAAGTGTCACACACCACACAGCACCATGTCCCAGTGCAAGGTCTGGGGCCAGGGAGGCCC
AGCCTGCCCATCATGGCCTCAGGAGCCCCCAGGCTCTGCTGGTCCCGGAGCCGGAGCCCCTGACCTGGCCAGGGA
GCGTGGAAGGGGGTGGGGGTGCTCCAGGCCTGGAGGCCCTGACTCGACCCCCTGTCCCCTGCCCTGCAG
AAGCGG
AACAGGGCCATCACGGCCCGCAGGCAGCACCTGAAGGTAGGTGTGGGCTCCCGGGGGGGTGGCCCAGGTGGGTCT
GCAGGGGAGCTGGCTGCAGCCCCTCACCGCCTGCCCCACCGCAG
AGCGTGATGCTGCAGATAGCGGCCACGGAGC
TGGAGAAGGAGGAGAGCCGCCGTGAGGCAGAGAAGCAGAACTACCTGGCGGAGCACTGCCCGCCGCTGCATATCC
CGGGCTCCATGTCTGAAGTGCAGGTACCAGCCCCTCCCCGGCCACCCCGCCTCCCCAGCAGCAGGCCTGCCTGCT
AACTCAGTTTCCCCACTTGTCAAGAGGGCCAGTGGGGTGGTCAGGGCAGGGGCAGGTGACCGTGGCTGCCAAGTG
TCAGGACGGCCGCCCGCCCCCACACCCACCCCTAG
GAGCTCTGCAAACAGCTGCACGCCAAGATCGATGCGGCTG
AAGAGGAGAAGTACGACATGGAGGTGAGGGTGCAGAAGACCAGCAAGGAGGTGAGTGGTGGCGGCGGGCCGGCGG
CAGGTGGGTAGGCGGTGGCCCAGCGGGCAGGCGGGGCGGGCCGGGGAGGCCGAGACCACCGGGACCTCGGGCTCC
CACCCGGCTCCCCTGCCCACAG
CTGGAGGACATGAACCAGAAGCTATTTGATCTGCGGGGCAAGTTCAAGCGGCC
CCCACTGCGGAGGGTGCGCATGTCGGCCGATGCCATGCTCAAGGCCCTGCTGGGCTCGAAGCACAAGGTGTGCAT
GGACCTGAGGGCCAACCTGAAGCAGGTCAAGAAGGAGGACACAGAGAAGGTGCGTGCCACGGGGGGAGCACCACC
ACACCTACCCTGCCGGGGAAGCACCTCCCACACCTGCCCCGCCTGGGACCACCTCCCACACCTGCCTGCCGGGGC
CCTGTACCACTGCCCCTCCAGGGTGCCATGCAGGGGACACTCCACTGCCCAATGCAGAGGGTAAACTGAGGCTGA
AGGTGGTGTGGACCAGGGTGCGTGCATAAGTGGGTGAGCCTGAGCTCTCTCCTGCCCTCTCCTCCACAG
GAGCGG
GACCTGCGAGACGTGGGTGACTGGAGGAAGAACATCGAGGAGAAGTCTGGCATGGAGGGCCGGAAGAAGATGTTT
GAGTCCGAGTCCTAGGCCACTCGCTGCCCCTACGCCTGCCCCGGTGCCCGGCTCCCAGCAGAACATACTAGGGAG
ATGCACCCAGAGCCTGCCAGGGAGGGCTGGCCTCACCACCACCGTCAATAAAGGATTTGAATCCCCATGGCTGGT
CTGGTCTGGCTCTCCCCAGCCTCTTGGGCCATGCTCTGGGCCCCCGCATCGGTGGCCTGCAGTGTGGTCAGTGGC
CAGCGGGGAAAGCCTGGGAGGAGGCCACACGGGGCCTGGGATTTCAGGTTGGGAGGGAAGCTGCTTCCAGCAAGG
AGGTGAGCCTGGGAAGGCCCCTACAGGGGAATCCACCCCAGGCTGCACGGGGCTGTTTGGTGAGGGCCCTGATAG
TGCCCCAGGCGTTCCTGGGGCTCGGCCTGGGCACATCCAACATGCAGGGCTGGGGATGGAGGCTGTGGGACCGAG
CCAGGTCTGGGTGGGAGTTCCTGAGATAAGTGGGTCTCACATTTGCACAGCCACGCAAAGGGCCTCCCGGGGCTC
CAGAGAGATCCACACATGTGACACACGTGTGGCCCCCGCAGTGCTGGGGGCAGCCCCCTATGCCTCCCAAGCTGC
CCCTCCTCAGGGAGCTCATCTGAGGCAGGAAGCCAAGGGCCACATTAGACCCCAGGCTGCTGTCCACGCGTGCCC
ACCCCCAGATCCTCCTGCTCATCCCCCTCCCACATCACTTTGGGACAGACCCCCAGCCCCGGGGCCTCCCTGCTT
TTCCTATCTGCCCCCTGCCCTGAGCACTGAGGCTGGGCACGGGGAGCGTGGAGGGGCGAGCCTGCACGGTGGGCC
ATGACCAGGCCAAATTGGCAGTCTCCGGGCTGGGGACCAGCATGGTGCTGGGGGTTGGCCAGCCTGGTCTCTGGT
CCTTACTGCCACCCTGAAAGGCAGGCTGTGTCACTCCTCACCATGCCAGGGGACCAAGAGACCTGTGCCCATCAG
GCAGGGGCTAGGCCTGGCCCTGACCTGGCTCCAGTGTGGCTCCCAAGTCTCGTTTCCACTCAGCCCCAAGACCCA
GCCCCATCTGGCCACCAAGGACAAGGCAGCTGACAGGTTCTGACAAGGCCGGTGACAGCAAGGCCACGTTATCAG
CCCTGCTCTTTGAAGGCTGACAGAGCAGGCACGCCAAGGTCCCTGTGCTCAGATCTGCGCTGGGGAGGCTGCCAG
CCTGCGCTGTGCCCTTGCCCCCGGGAGGTCCCATCGAT
Amino acid sequence coded (underscore partly is the 8th exons coding amino acid): MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPG SMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPL RRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTE
KERDLRDVGDWRKNIEEKSGMEGRKKMFESES
Summary of the invention
The object of the present invention is to provide a kind of pathogenic gene for far end arthrosis bend and detection method thereof and application.The applicant has found morbific transgenation first in the big family of 2B type far end arthrosis bend of one 7 generation heredity of China, 75 codings of troponin subunit I 2 (TNNI2) the 8th exons 1 Methionin codon AAG disappearance, and this sports the world and finds first.Simultaneously at such disease development diagnostic kit, this kit method is easy, quick, price is cheap, efficient, is suitable for promoting in scientific research and medical institutions.
For achieving the above object, the technical solution used in the present invention is:
A kind of pathogenic gene for far end arthrosis bend has aminoacid sequence among the sequence table SEQ ID No:1.
The detection method of described pathogenic gene for far end arthrosis bend, use nested PCR method and detect:
1) extracts person under inspection's blood template DNA;
2) design of primers and reaction conditions:
First round PCR:
Forward primer: TNNI2-1F:5 '-GGTGACCGTGGCTGCCAAGTGTC-3 '
Reverse primer: TNNI2-1R:5 '-AGCTCAGGCTCACCCACTTATGCA-3 ';
Reaction system: be total to 20ul, person under inspection's template DNA 1ng, 10 * buffer (damping fluid) 2ul/ pipe, Taqase (heat-resisting polymerase): 1U/ pipe, 2.5mMdNTP:2ul/ pipe, sterilized water: 14ul/ pipe;
With the aforesaid liquid mixing, moment is centrifugal, increases on the pcr amplification instrument, and amplification condition is: 95 ℃, and 4min; 94 ℃ of 40sec, 61 ℃ of 1min, 72 ℃ of 45sec, 35cycles, 72 ℃ of 8min; Separate the purpose band with the PAGE gel electrophoresis on electrophoresis apparatus, the purpose band is 885bp or 883bp, and normal people is 885bp sheet segment length, is 883bp sheet segment length unusually;
Second takes turns PCR: primer sequence: 5 '-TGGGTGACTGGAGGAAGAACAT-3 '
5’-AGCTCAGGCTCACCCACTTATGCA-3’
Reaction system: be total to 20ul, person under inspection first round PCR product is template DNA 10ng, 10 * buffer2ul/ pipe, Taqase:1U/ pipe, 2.5mMdNTP:2ul/ pipe, sterilized water: 14ul/ pipe;
With the aforesaid liquid mixing, moment is centrifugal, increases on the pcr amplification instrument, and amplification condition is: 95 ℃, and 4min; 94 ℃ of 40sec, 60 ℃ of 40sec, 72 ℃ of 45sec, 35cycles, 72 ℃ of 8min; On electrophoresis apparatus, separate the purpose band with the PAGE gel electrophoresis, the normal artificial 143bp band of purpose strap section, the patient is two band 140/143bp.
Described pathogenic gene for far end arthrosis bend is used to prepare the reagent or the test kit of diagnosis far end arthrosis bend 2B type, DAS, the crooked deformity of brothers, equinvoarus or talipes equinovalgus disease.
1. the applicant has found morbific transgenation first in the big family of 2B type far end arthrosis bend of one 7 generation heredity of China, 75 codings of troponin subunit I 2 (TNNI2) the 8th exons 1 Methionin codon AAG disappearance, this sports the world and finds first.
2. the applicant develops diagnostic kit at such disease, and this kit method is easy, quick, price is cheap, efficient, is widely used, and is suitable for promoting in scientific research and medical institutions.Can diagnose brothers' deformity disease easily and accurately.
3. brothers' deformity sickness rate height in the crowd, many so far causes of disease do not have clear and definite diagnosis.The applicant is in the far end arthrosis bend disease that China finds first, will definitely raise the secret of brothers' deformity disease, for the research of this disease provides methodological help.
Embodiment
Embodiment 1
Normal the 8th exon sequence:
GAGCGGGACCTGCGAGACGTGGGTGACTGGAGGAAGAACATCGAGGAGAAGTCTGG CATGGAGGGCCGG
AAGAAGATGTTTGAGTCCGAGTCCTAG wherein is with underscore partly to be deletion segment;
A kind of pathogenic gene for far end arthrosis bend has aminoacid sequence among the sequence table SEQ ID No:1.
The 8th exon SEQ ID No:1 sequence that the present invention has suddenlyd change is:
GAGCGGGACCTGCGAGACGTGGGTGACTGGAGGAAGAACATCGAGGAGAAGTCTGGCATGGAGGGCCGGAAGATGTTTGAGTCCGAGTCCTAG
(1) information of SEQ ID No:1 (referring to sequence table)
(A) sequence signature
* length: 93 base pairs
* type: nucleic acid
* chain: two strands
* topological framework: linearity
(b) molecule type: DNA
(C) suppose: not
(d) antisense: not
(e) initial source: troponin subunit I 2 (TNNI2) the 8th exon
(f) characteristic key words relevant: be " mutation " with nucleotide sequence
(2) preparation of gene:
Forward primer: 5 '-CTACAAGGAAAGCTGGGTC-3 ',
Reverse primer: 5 '-AAGGGCTGGAAGAGGTGG-3 '
Reaction system: be total to 20ul, person under inspection's template DNA 1ng, 10 * buffer 2ul/ pipe, Taqase:1U/ pipe, 2.5mMdNTP:2ul/ pipe, sterilized water: 14ul/ pipe;
Amplification condition: 95 ℃, 4min; 94 ℃ of 40sec, 61 ℃ of 1min, 72 ℃ of 45sec, 35cycles, 72 ℃ of 8min;
Embodiment 2
The 8th exon detection method that the present invention has suddenlyd change: use nested PCR method and detect,
(1) DNA extraction is adopted 5 milliliters of venous blood, and the Sodium Citrate anti-freezing is with conventional phenol chloroform extraction DNA, spectrophotometric instrumentation dna content, 10 sodium gram/microlitres;
(2) design of primers and reaction conditions:
First round PCR:
Primer sequence:
Forward primer: TNNI2-1F:5 '-GGTGACCGTGGCTGCCAAGTGTC-3 '
Reverse primer: TNNI2-1R:5 '-AGCTCAGGCTCACCCACTTATGCA-3 '
Reaction system: be total to 20ul
1. person under inspection's template DNA 10ng (1ul)
2. 10 * buffer 2ul/ manages
3. Taqase:1U/ manages (1ul)
4. 2.5mMdNTP:2ul/ manages
5. sterilized water: 14ul/ manages
With the aforesaid liquid mixing, moment is centrifugal, increases on the pcr amplification instrument, and amplification condition is: 95 ℃, and 4min; 94 ℃ of 40sec, 61 ℃ of 1min, 72 ℃ of 45sec, 35cycles, 72 ℃ of 8min.
Separate the purpose band with the PAGE gel electrophoresis on electrophoresis apparatus, the purpose band is 885bp or 883bp, and normal people is 885bp sheet segment length, is 883bp sheet segment length unusually.
Second takes turns PCR:
Primer sequence: 5 '-TGGGTGACTGGAGGAAGAACAT-3 '
5’-AGCTCAGGCTCACCCACTTATGCA-3’
Reaction system: be total to 20ul
1. person under inspection first round PCR product is template DNA 1ul
2. 10 * buffer 2ul/ manages
3. Taqase:1U/ manages
4. 2.5mMdNTP:2ul/ manages
5. sterilized water: 14ul/ manages
With the aforesaid liquid mixing, moment is centrifugal, increases on the pcr amplification instrument, and amplification condition is: 95 ℃, and 4min; 94 ℃ of 40sec, 60 ℃ of 40sec, 72 ℃ of 45sec, 35cycles, 72 ℃ of 8min.
On electrophoresis apparatus, separate the purpose band with the PAGE gel electrophoresis, the normal artificial 143bp band of purpose strap section, the patient is two band 140/143bp.
Embodiment 3
Test kit is formed:
(1) primer pipe
Forward primer | Reverse primer | |
First round primer | 5’-CTACAAGGAAAGCTGGGTC-3’ | 5’-AAGGGCTGGAAGAGGTGG-3’ |
Second takes turns primer | 5’-TGGGTGACTGGAGGAAGAACAT-3’ | 5’-GTGCATCTCCCTAGTATGTTCTGC-3’ |
First round amplifing reagent is formed:
Pipe 1 (18ul system): 2.5mMdNTP, 10 * buffer, 10mM first round primer;
Manage 2 whiterusss and Taqase mixed solution 4ul; (Taqase1U/ pipe)
First round amplification method: will manage 1 and 2 mix, add 1ul person under inspection template DNA with pipe, mixing, moment is centrifugal, increases on the pcr amplification instrument.Amplification condition is: 95 ℃, and 4min; 94 ℃ of 40sec, 61 ℃ of 1min, 72 ℃ of 45sec, 35cycles, 72 ℃ of 8min.
The product of amplification can be directly used in dna sequencing, also can be used for second and take turns pcr template.Order-checking can detect this segmental any sudden change.
Second takes turns amplifing reagent forms:
Pipe 3 (18ul systems): 2.5mMdNTP, 10 * buffer, 10mM second take turns primer;
Manage 4 whiterusss and Taqase mixed solution 4ul; (Taqase1U/ pipe)
Second takes turns amplification method: will manage 3 and 4 mix, add 1ul first round pcr amplification product with pipe, and mixing, moment is centrifugal, increases on the pcr amplification instrument.Amplification condition is: 95 ℃, and 4min; 94 ℃ of 40sec, 60 ℃ of 40sec, 72 ℃ of 45sec, 35cycles, 72 ℃ of 8min.
Carry out denaturing gel electrophoresis at the vertical slab electrophoresis instrument.8% gel, 7mol urea, 40% deionized formamide, 40 watts of electrophoresis 4~5 hours.Normal people is 143bp one band, and the patient is for being 140/143bp two bands.
The scope that test kit is used: to being diagnosed as the patient of far end arthrosis bend 2B type; To being diagnosed as the patient of DAS; To the crooked odd-shaped patient of brothers; Patient to equinvoarus or talipes equinovalgus.
Arthrogryposis
SEQUENCE LISTING
<110〉Liaoning Research Institute of Family Planning
<120〉a kind of pathogenic gene for far end arthrosis bend and detection method thereof and application
<130>
<160>9
<170>PatentIn version 3.1
<210>1
<211>93
<212>DNA
<213〉TNNI2 the 8th exon
<220>
<221>mutation
<222>(1)..(93)
<223>
<400>1
gagcgggacc tgcgagacgt gggtgactgg aggaagaaca tcgaggagaa gtctggcatg 60
gagggccgga agatgtttga gtccgagtcc tag 93
<210>2
<211>4163
<212>DNA
<213>TNNI2
<220>
<221>CDS
<222>(1067)..(1096)
<223>
<220>
<221>CDS
<222>(1795)..(1836)
Arthrogryposis
<223>
<220>
<221>CDS
<222>(1920)..(2048)
<223>
<220>
<221>CDS
<222>(2211)..(2300)
<223>
<220>
<221>CDS
<222>(2423)..(2599)
<223>
<220>
<221>CDS
<222>(2845)..(3066)
<223>
<400>2
gctgacctcg ggtgagatgg gctgaggcga ggtgtggata ctcgcagcta cccctcagct 60
gacccgagct gtgtgcccgg ctgaggccac aggcaaagcc aggcacactg tcctcaggct 120
ccttacgaga acgacagagg catctccagc gcgtcaccga gccctaaata gagtagccca 180
gccacggcac cccccaccaa gacttcttgg actgggcggc agcacgcggc caggccaggc 240
ggccggacag gtggggaggt ctctgtggct ctccacgccc ccattggtct gaggaggact 300
ctatgccctt tctgagcagg ggcccagcct gggggaggcc atttataccc ctccccctgg 360
gcccaccagc ccaactcgcc gctgccggcc tgacctcgct cccagccctg ctgcccagat 420
tctaggtgag gcccagcccg gcccgccgag gccgggggac agggcgtggc tcgagctggt 480
ttgagggagg acttcctggg gcgggggtct gggggcctgg gggatgccac cagcagcccc 540
ctttggggcc tgcacgggtc cgggagtgag aaggagaggc tttggggagg cagctgtagc 600
gagaggcagg tattagacac tccctgacca ccaggcttca cctctgggga ccctggaagg 660
agagtttagg ggtcaagaag ccccagaacc tgagccccca ggccaaactg aggagggatt 720
tcttccatgc acttaggccc aaagccaaag agagagggtt aaaaataaca gcgtcactca 780
ggcggccacc tgcgctggcc catcccaccc tccctcgggg acagctgcag ctcctcaggc 840
tatgcctggg acattttggg aacactttct cctcttactt ctcaccctgg ggaattccaa 900
Arthrogryposis
gacattgtcc ttgaaggagg tgagagtagg gggaggaggt gagagtaggg ggtgggcggg 960
agggggctgt catcaggagc cctgaacccc tcaccaccta cctgatgggc acaggcatca 1020
cggtggcaag ggcctggcca acacctctgt cttcctctcc ccacag gct cca agc 1075
Ala Pro Ser
1
tca gga cct cag gat ggg aga gtaagtggta cccctgtacc cccatacagt 1126
Ser Gly Pro Gln Asp Gly Arg
5 10
gaccctgccc acctcctgcc ctgtccaccc catcacacac tccgaccccg ccagccatgg 1186
ccctaacctc tgtcttctct ccccgtcctg cctgcgtcct ccctccctgg acagtgagga 1246
ggtaagtagt tgctgggggc tcaaaacatg acgaggaggg ggctccccca actcagcata 1306
ggtcataggt cacagcctca aggccctaag gcccagagaa gatggcctgg ccctccccgc 1366
tggcaaaagt gccccaccca accaccaaga cgctgctgaa agagaggaag tggctgcccc 1426
aagccttctg gggcagggga agtgtggctg tggcctggtc acaggggaat cacttcttct 1486
ttctgattcc tgcacttccc gcccccacct caccggccga cctgccccca actggccctc 1546
ctctccccca gcctctggcc tcccagcacc atgtgccacc tggcaaagtg tcacacacca 1606
cacagcacca tgtcccagtg caaggtctgg ggccagggag gcccagcctg cccatcatgg 1666
cctcaggagc ccccaggctc tgctggtccc ggagccggag cccctgacct ggccagggag 1726
cgtggaaggg ggtgggggtg ctccaggcct ggaggccctg actcgacccc ctgtcccctg 1786
ccctgcag aag cgg aac agg gcc atc acg gcc cgc agg cag cac ctg aag 1836
Lys Arg Asn Arg Ala Ile Thr Ala Arg Arg Gln His Leu Lys
15 20
gtaggtgtgg gctcccgggg gggtggccca ggtgggtctg caggggagct ggctgcagcc 1896
cctcaccgcc tgccccaccg cag agc gtg atg ctg cag ata gcg gcc acg gag 1949
Ser Val Met Leu Gln Ile Ala Ala Thr Glu
25 30
ctg gag aag gag gag agc cgc cgt gag gca gag aag cag aac tac ctg 1997
Leu Glu Lys Glu Glu Ser Arg Arg Glu Ala Glu Lys Gln Asn Tyr Leu
35 40 45 50
gcg gag cac tgc ccg ccg ctg cat atc ccg ggc tcc atg tct gaa gtg 2045
Ala Glu His Cys Pro Pro Leu His Ile Pro Gly Ser Met Ser Glu Val
55 60 65
cag gtaccagccc ctccccggcc accccgcctc cccagcagca ggcctgcctg 2098
Gln
ctaactcagt ttccccactt gtcaagaggg ccagtggggt ggtcagggca ggggcaggtg 2158
accgtggctg ccaagtgtca ggacggccgc ccgcccccac acccacccct ag gag ctc 2216
Glu Leu
tgc aaa cag ctg cac gcc aag atc gat gcg gct gaa gag gag aag tac 2264
Cys Lys Gln Leu His Ala Lys Ile Asp Ala Ala Glu Glu Glu Lys Tyr
70 75 80 85
gac atg gag gtg agg gtg cag aag acc agc aag gag gtgagtggtg 2310
Asp Met Glu Val Arg Val Gln Lys Thr Ser Lys Glu
90 95
gcggcgggcc ggcggcaggt gggtaggcgg tggcccagcg ggcaggcggg gcgggccggg 2370
gaggccgaga ccaccgggac ctcgggctcc cacccggctc ccctgcccac ag ctg gag 2428
Leu Glu
Arthrogryposis
gac atg aac cag aag cta ttt gat ctg cgg ggc aag ttc aag cgg ccc 2476
Asp Met Asn G1n Lys Leu Phe Asp Leu Arg Gly Lys Phe Lys Arg Pro
100 105 110 115
cca ctg cgg agg gtg cgc atg tcg gcc gat gcc atg ctc aag gcc ctg 2524
Pro Leu Arg Arg Val Arg Met Ser Ala Asp Ala Met Leu Lys Ala Leu
120 125 130
ctg ggc tcg aag cac aag gtg tgc atg gac ctg agg gcc aac ctg aag 2572
Leu Gly Ser Lys His Lys Val Cys Met Asp Leu Arg Ala Asn Leu Lys
135 140 145
cag gtc aag aag gag gac aca gag aag gtgcgtgcca cggggggagc 2619
Gln Val Lys Lys Glu Asp Thr Glu Lys
150 155
accaccacac ctaccctgcc ggggaagcac ctcccacacc tgccccgcct gggaccacct 2679
cccacacctg cctgccgggg ccctgtacca ctgcccctcc agggtgccat gcaggggaca 2739
ctccactgcc caatgcagag ggtaaactga ggctgaaggt ggtgtggacc agggtgcgtg 2799
cataagtggg tgagcctgag ctctctcctg ccctctcctc cacag gag cgg gac ctg 2856
Glu Arg Asp Leu
160
cga gac gtg ggt gac tgg agg aag aac atc gag gag aag tct ggc atg 2904
Arg Asp Val Gly Asp Trp Arg Lys Asn Ile Glu Glu Lys Ser Gly Met
165 170 175
gag ggc cgg aag aag atg ttt gag tcc gag tcc tag gcc act cgc tgc 2952
Glu Gly Arg Lys Lys Met Phe Glu Ser Glu Ser Ala Thr Arg Cys
180 185 190
ccc tac gcc tgc ccc ggt gcc cgg ctc cca gca gaa cat act agg gag 3000
Pro Tyr Ala Cys Pro Gly Ala Arg Leu Pro Ala Glu His Thr Arg Glu
195 200 205
atg cac cca gag cct gcc agg gag ggc tgg cct cac cac cac cgt caa 3048
Met His Pro Glu Pro Ala Arg Glu Gly Trp Pro His His His Arg Gln
210 215 220
taa agg att tga atc ccc atggctggtc tggtctggct ctccccagcc 3096
Arg Ile Ile Pro
225
tcttgggcca tgctctgggc ccccgcatcg gtggcctgca gtgtggtcag tggccagcgg 3156
ggaaagcctg ggaggaggcc acacggggcc tgggatttca ggttgggagg gaagctgctt 3216
ccagcaagga ggtgagcctg ggaaggcccc tacaggggaa tccaccccag gctgcacggg 3276
gctgtttggt gagggccctg atagtgcccc aggcgttcct ggggctcggc ctgggcacat 3336
ccaacatgca gggctgggga tggaggctgt gggaccgagc caggtctggg tgggagttcc 3396
tgagataagt gggtctcaca tttgcacagc cacgcaaagg gcctcccggg gctccagaga 3456
gatccacaca tgtgacacac gtgtggcccc cgcagtgctg ggggcagccc cctatgcctc 3516
ccaagctgcc cctcctcagg gagctcatct gaggcaggaa gccaagggcc acattagacc 3576
ccaggctgct gtccacgcgt gcccaccccc agatcctcct gctcatcccc ctcccacatc 3636
actttgggac agacccccag ccccggggcc tccctgcttt tcctatctgc cccctgccct 3696
gagcactgag gctgggcacg gggagcgtgg aggggcgagc ctgcacggtg ggccatgacc 3756
aggccaaatt ggcagtctcc gggctgggga ccagcatggt gctgggggtt ggccagcctg 3816
gtctctggtc cttactgcca ccctgaaagg caggctgtgt cactcctcac catgccaggg 3876
gaccaagaga cctgtgccca tcaggcaggg gctaggcctg gccctgacct ggctccagtg 3936
Arthrogryposis
tggctcccaa gtctcgtttc cactcagccc caagacccag ccccatctgg ccaccaagga 3996
caaggcagct gacaggttct gacaaggccg gtgacagcaa ggccacgtta tcagccctgc 4056
tctttgaagg ctgacagagc aggcacgcca aggtccctgt gctcagatct gcgctgggga 4116
ggctgccagc ctgcgctgtg cccttgcccc cgggaggtcc catcgat 4163
<210>3
<211>10
<212>PRT
<213>TNNI2
<400>3
Ala Pro Ser Ser Gly Pro Gln Asp Gly Arg
1 5 10
<210>4
<211>14
<212>PRT
<213>TNNI2
<400>4
Lys Arg Asn Arg Ala Ile Thr Ala Arg Arg Gln His Leu Lys
1 5 10
<210>5
<211>43
<212>PRT
<213>TNNI2
<400>5
Ser Val Met Leu Gln Ile Ala Ala Thr Glu Leu Glu Lys Glu Glu Ser
1 5 10 15
Arg Arg Glu Ala Glu Lys Gln Asn Tyr Le uAla Glu His Cys Pro Pro
20 25 30
Leu His Ile Pro Gly Ser Met Ser Glu Val Gln
35 40
<210>6
<211>30
<212>PRT
<213>TNNI2
Arthrogryposis
<400>6
Glu Leu Cys Lys Gln Leu His Ala Lys Ile Asp Ala Ala Glu Glu Glu
1 5 10 15
Lys Tyr Asp Met Glu Val Arg Val Gln Lys Thr Ser Lys Glu
20 25 30
<210>7
<211>59
<212>PRT
<213>TNNI2
<400>7
Leu Glu Asp Met Asn Gln Lys Leu Phe Asp Leu Arg Gly Lys Phe Lys
1 5 10 15
Arg Pro Pro Leu Arg Arg Val Arg Met Ser Ala Asp Ala Met Leu Lys
20 25 30
Ala Leu Leu Gly Ser Lys His Lys Val Cys Met Asp Leu Arg Ala Asn
35 40 45
Leu Lys Gln Val Lys Lys Glu Asp Thr Glu Lys
50 55
<210>8
<211>31
<212>PRT
<213>TNNI2
<400>8
Glu Arg Asp Leu Arg AspVal Gly Asp Trp Arg Lys Asn Ile Glu Glu
1 5 10 15
Lys Ser Gly Met Glu Gly Arg Lys Lys Met Phe Glu Ser Glu Ser
20 25 30
<210>9
<211>36
<212>PRT
<213>TNNI2
<400>9
Ala Thr Arg Cys Pro Tyr Ala Cys Pro Gly Ala Arg Leu Pro Ala Glu
1 5 10 15
Arthrogryposis
His Thr Arg Glu Met His Pro Glu Pro Ala Arg Glu Gly Trp Pro His
20 25 30
His His Arg Gln
35
Claims (4)
1. a pathogenic gene for far end arthrosis bend is characterized in that: have aminoacid sequence among the sequence table SEQ ID No:1.
2. the detection method of the described pathogenic gene for far end arthrosis bend of claim 1 is characterized in that: use nested PCR method and detect:
1) extracts person under inspection's blood template DNA;
2) design of primers and reaction conditions:
First round PCR:
Forward primer: TNNI2-1F:5 '-GGTGACCGTGGCTGCCAAGTGTC-3 '
Reverse primer: TNNI2-1R:5 '-AGCTCAGGCTCACCCACTTATGCA-3 ';
Reaction system: be total to 20ul, person under inspection's template DNA 10ng ul, 10 * buffer 2ul/ pipe, Taqase:1U/ pipe, 2.5mMdNTP:2ul/ pipe, sterilized water: 14ul/ pipe;
With the aforesaid liquid mixing, moment is centrifugal, increases on the pcr amplification instrument, and amplification condition is: 95 ℃, and 4min; 94 ℃ of 40sec, 61 ℃ of 1min, 72 ℃ of 45sec, 35cycles, 72 ℃ of 8min; Separate the purpose band with the PAGE gel electrophoresis on electrophoresis apparatus, the purpose band is 885bp or 883bp, and normal people is 885bp sheet segment length, is 883bp sheet segment length unusually;
Second takes turns PCR: primer sequence: 5 '-TGGGTGACTGGAGGAAGAACAT-3 '
5’-AGCTCAGGCTCACCCACTTATGCA-3’
Reaction system: be total to 20ul, person under inspection first round PCR product is template DNA 10ng, 10 * buffer2ul/ pipe, Taqase:1U/ pipe, 2.5mMdNTP:2ul/ pipe, sterilized water: 14ul/ pipe;
With the aforesaid liquid mixing, moment is centrifugal, increases on the pcr amplification instrument, and amplification condition is: 95 ℃, and 4min; 94 ℃ of 40sec, 60 ℃ of 40sec, 72 ℃ of 45sec, 35cycles, 72 ℃ of 8min; On electrophoresis apparatus, separate the purpose band with the PAGE gel electrophoresis, the normal artificial 143bp band of purpose strap section, the patient is two band 140/143bp.
3. the application of the described pathogenic gene for far end arthrosis bend of claim 1 is characterized in that: described pathogenic gene for far end arthrosis bend is used to prepare the reagent or the test kit of diagnosis far end arthrosis bend 2B type, DAS, the crooked deformity of brothers, equinvoarus or talipes equinovalgus disease.
4. according to the application of the described pathogenic gene for far end arthrosis bend of claim 3, it is characterized in that: described reagent or test kit adopt
First round primer:
Forward 5 '-CTACAAGGAAAGCTGGGTC-3 ',
Reverse 5 '-AAGGGCTGGAAGAGGTGG-3 ';
Second takes turns primer:
Forward 5 '-TGGGTGACTGGAGGAAGAACAT-3 ',
Reverse 5 '-GTGCATCTCCCTAGTATGTTCTGC-3 '.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN2006100462951A CN101054412B (en) | 2006-04-12 | 2006-04-12 | Pathogenic gene for far end arthrosis bend, detection method and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN2006100462951A CN101054412B (en) | 2006-04-12 | 2006-04-12 | Pathogenic gene for far end arthrosis bend, detection method and application thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN101054412A true CN101054412A (en) | 2007-10-17 |
CN101054412B CN101054412B (en) | 2010-12-29 |
Family
ID=38794484
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN2006100462951A Expired - Fee Related CN101054412B (en) | 2006-04-12 | 2006-04-12 | Pathogenic gene for far end arthrosis bend, detection method and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN101054412B (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106906299A (en) * | 2017-04-18 | 2017-06-30 | 吉林省锐吉尔生物科技有限公司 | People's JAK2V617F gene mutation detection kits |
-
2006
- 2006-04-12 CN CN2006100462951A patent/CN101054412B/en not_active Expired - Fee Related
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106906299A (en) * | 2017-04-18 | 2017-06-30 | 吉林省锐吉尔生物科技有限公司 | People's JAK2V617F gene mutation detection kits |
Also Published As
Publication number | Publication date |
---|---|
CN101054412B (en) | 2010-12-29 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN1497049A (en) | Androgen receptor compound-associated protein | |
CN101061222A (en) | Gene for encoding methylated catechin biological synthetase | |
CN1861799A (en) | Improved overlap extension PCR process and mutation gene obtained thereby | |
CN1778930A (en) | Fusion gene of provocative organ anti-Coccidium tenellum infection and its coding protein and use thereof | |
CN1160459C (en) | Cytochrome BD type quinol oxidase gene of brevibacterium lactofermentum | |
CN1239713C (en) | Application of ion channel inhibitor for curing arhythmia | |
CN101054412A (en) | Pathogenic gene for far end arthrosis bend, detection method and application thereof | |
CN1827640A (en) | Polypeptide for inhibition of angiogenesis and method for preparing same and use thereof | |
CN101044238A (en) | Method for producing highly sensitive endonucleases, novel preparations of endonucleases and uses thereof | |
CN1950505A (en) | Process for producing polypeptide | |
CN1163604C (en) | Attenuated virus oka strain gene 62 and method for identifying virus strain for attenuated live vaccine by using same | |
CN1891718A (en) | Fusion immunotoxin ML-L-SEC2 and gene and its preparation | |
CN1256431C (en) | Recombined human parathyroid hormone gene, its expression carrier and preparing method of recombined human parathyroid protein | |
CN1769436A (en) | Nanjing bass 3-hydroxyl-3-methyl glutaryl coenzyme A reductase protein encoding sequence | |
CN1798837A (en) | Thioredoxin modification | |
CN101068925A (en) | A microorganism of enterobacteriacae genus haboring genes associated with L-carintine biosynthesis and method of producing L-carnitine using the micro organism | |
CN1711353A (en) | Modified sarcosine oxidase, process for producing the same and reagent composition using the same | |
CN1928084A (en) | Nucleotide and amino acid sequence of gene of penaeus monodon heat shock protein 90 | |
CN1242061C (en) | Short finger gene | |
CN1252270C (en) | Taxaceae 3-hydroxy-3-methylpentadiacyl cozymase A synthetic zymoprotein coding sequence | |
CN1604907A (en) | Nucleic acid labeling by thermoanaerobacter thermohydrosulfuricus DNA polymerase I variants | |
CN1186448C (en) | Recombinant human alpha-prothymosin interleukin 2 gene and its expression and use | |
CN1760363A (en) | Coded sequence of reductase enzyme protein of eucommia 3-hydroxy-3-coenzyme of methyl glutaryl A | |
CN1119418C (en) | D-amino acid oxidase of red teliosporeae | |
CN1807642A (en) | Birch phenylalanine ammonia-lyase cDNA sequence and its coded amino acid and its recombinant strain for expression |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
C14 | Grant of patent or utility model | ||
GR01 | Patent grant | ||
C17 | Cessation of patent right | ||
CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20101229 Termination date: 20120412 |