CA2579861C - Formulation of pertuzumab in a histidine-acetate buffer - Google Patents
Formulation of pertuzumab in a histidine-acetate buffer Download PDFInfo
- Publication number
- CA2579861C CA2579861C CA2579861A CA2579861A CA2579861C CA 2579861 C CA2579861 C CA 2579861C CA 2579861 A CA2579861 A CA 2579861A CA 2579861 A CA2579861 A CA 2579861A CA 2579861 C CA2579861 C CA 2579861C
- Authority
- CA
- Canada
- Prior art keywords
- antibody
- antibodies
- her2
- formulation
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/22—Heterocyclic compounds, e.g. ascorbic acid, tocopherol or pyrrolidones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39541—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7012—Compounds having a free or esterified carboxyl group attached, directly or through a carbon chain, to a carbon atom of the saccharide radical, e.g. glucuronic acid, neuraminic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39591—Stabilisation, fragmentation
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
- A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Oncology (AREA)
- Biomedical Technology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
The present application describes antibody formulations, including monoclonal antibodies formulated in histidine-acetate buffer, as well as a formulation comprising an antibody that binds to domain II of HER2 (for example, Pertuzumab), and a formulation comprising an antibody that binds to DR5 (for example, Apomab).
Description
FORMULATION OF PERTUZUMAB IN A HISTIDINE-ACETATE BUFFER
This is a non-provisional application filed under 37 CFR 1.53(b) claiming priority to provisional application 60/620,413 filed October 20, 2004, Field of the Invention The present invention concerns antibody formulations, including monoclonal antibodies formulated in histidine-acetate buffer, as well as a formulation comprising an antibody that binds to domain II of HER2 (for example, Pertuzumab), and a formulation comprising an antibody that binds to DR5 (for example, Apomab).
Background of the Invention In the past ten years, advances in biotechnology have made it possible to produce a variety of proteins for pharmaceutical applications using recombinant DNA techniques. Because proteins are larger and more complex than traditional organic and inorganic drugs (i.e. possessing multiple functional groups in addition to complex three-dimensional structures), the formulation of such proteins poses special problems. For a protein to remain biologically active, a formulation must preserve intact the conformational integrity of at least a core sequence of the protein's amino acids while at the same time protecting the protein's multiple functional groups from degradation. Degradation pathways for proteins can involve chemical instability (i.e. any process which involves modification of the protein by bond formation or cleavage resulting in a new chemical entity) or physical instability (i.e. changes in the higher order structure of the protein). Chemical instability can result from deamidation, racemization, hydrolysis, oxidation, beta elimination or disulfide exchange. Physical instability can result from denaturation, aggregation, precipitation or adsorption, for example. The three most common protein degradation pathways are protein aggregation, deamidation and oxidation. Cleland et at Critical Reviews in Therapeutic Drug Carrier Systems 10(4): 307-377 (1993).
Antibody Formulations Included in the proteins used for pharmaceutical applications are antibodies.
An example of an antibody useful for therapy is an antibody which binds to the HER2 antigen, such as Pertuzumab.
US Patent No. 6,339,142 describes a HER2 antibody composition comprising a mixture of anti-HER2 antibody and one or more acidic variants thereof, wherein the amount of the acidic variant(s) is less than about 25%. Trastuzumab is an exemplified HER2 antibody.
US Patent Nos. 6,267,958 and 6,685,940 (Andya et at) describe lyophilized antibody formulations, including HER2 and IgE antibody formulations. W097/04807 and US 2004/0197326A1 (Fick et at) describe methods for treating allergic asthma with an IgE antibody. W099/01556 (Lowman et at) relates to IgE antibody with aspartyl residues prone to isomerization, and improved variants thereof.
US 2002/0045571 (Liu et at) provides reduced viscosity concentrated protein formulations, exemplified by humanized IgE antibody formulations, rhuMAb E25 and E26. WO 02/096457 and US 2004/0170623 (Arvinte et al.) describes stable liquid formulations comprising anti-IgE antibody E25. See, also, US
2004/0197324 Al (Liu and Shire) concerning high concentration anti-IgE formulation.
US Patent No. 6,171,586 (Lam et at) describes stable aqueous antibody formulations. A F(ab')2 rhuMAb CD18 antibody was formulated in sodium acetate and histidine-HC1 buffers. The preferred formulation for rhuMAb CD18 was 10mM sodium acetate, 8% trehalose, 0.01% TWEEN 20Tm, pH
5Ø Acetate (pH 5.0) formulations of rhuMAb CD20 stored at 40 for one month demonstrated greater stability than those samples formulated in histidine (pH 5.0 or 6.0).
US 2003/0190316 (Kakuta et al.) concerns formulated antibody hPM-1, a humanized IL-6 receptor antibody. Monomer loss was the greatest in sodium citrate (pH 6.7), followed by sodium phosphate (pH 6.8), Tris-HCl (pH 7.2), histidine-HCI (pH 7.2) and glycine (pH 7.6) in descending order. The effect of phosphate-Na (pH 6.5), phosphate-His (pH 6.0 or 6.5), His-HC1 (pH 6.5), and phosphate-Na (pH 6.0) on the stability of hPM-1 was assessed.
W02004/071439 (Burke et al.) state that impurities arose in a natalizumab (anti-alpha4 integrin humanized monoclonal antibody) formulation from the degradation of polysorbate 80, apparently through an oxidation reaction involving metal ions and hisitidine. Thus, a phosphate buffer was selected.
WO 2000/066160 (English language counterpart EP 1 174 148A1) (Okada et al.) refers to a formulation of a humanized C4G1 antibody which binds to a fibrinogen receptor of a human platelet membrane glycoprotein GPIIb/lIIa, in a sodium phosphate or sodium citrate buffer.
W02004/019861 (Johnson et al.) concerns CDP870, a pegylated anti-TNFa Fab fragment, formulated at 200mg/ml in 50mM sodium acetate (pH 5.5) and 125mM sodium chloride.
W02004/004639 (Nesta, P.) refers to a formulation for huC242-DM1, a tumor-activated immunotoxin, in a 50mM succinic acid buffer (pH 6.0) and sucrose (5%w/v).
W003/039485 (Kaisheva et al.) found that Daclizumab (a humanized IL-2 receptor antibody) had the highest stability in sodium succinate buffer at pH 6.0, and rapidly lost potency in histidine as the buffer oxidized.
WO 2004/001007 concerns a CD80 monoclonal antibody in a histidine HCl, sodium acetate or sodium citrate buffer.
US Patent No. 6,252,055 (Relton, J.) refers to anti-CD4 and anti-CD23 antibodies formulated in maleate, succinate, sodium acetate or phosphate buffers, with phosphate being identified as the preferred buffer.
US Patent No. 5,608,038 (Eibl et al.) refers to highly concentrated polyclonal immunoglobulin preparations with immunoglobulin, glucose or sucrose, and sodium chloride therein.
W003/015894 (Oliver et al.) refers to an aqueous formulation of 100mg/mL
SYNAGIS , 25mM
histidine-HCI, 1.6mM glycine, pH 6.0, and a lyophilized SYNAGIS which when formulated (before lyophilization) contains 25mM histidine, 1.6mM glycine and 3% w/v mannitol at pH 6Ø
US 2004/0191243 Al (Chen et al.) reports formulation of ABX-1L8, a human IgG2 antibody.
US 2003/0113316 Al (Kaisheva et al.) refers to a lyophilized anti-1L2 receptor antibody formulation.
HER2 Antibodies The HER family of receptor tyrosine kinases are important mediators of cell growth, differentiation and survival. The receptor family includes four distinct members including epidermal growth factor receptor (EGFR, ErbBI, or HER1), HER2 (ErbB2 or p185"eU), HER3 (ErbB3) and HER4 (ErbB4 or tyro2).
EGFR, encoded by the erbB 1 gene, has been causally implicated in human malignancy. In particular, increased expression of EGFR has been observed in breast, bladder, lung, head, neck and stomach cancer as well as glioblastomas. Increased EGFR receptor expression is often associated with increased production of the EGFR ligand, transforming growth factor alpha (TGF-a), by the same tumor cells resulting in receptor activation by an autocrine stimulatory pathway. Baselga and Mendelsohn Pharrac. Ther.
64:127-154 (1994). Monoclonal antibodies directed against the EGFR or its ligands, TGF-a and EGF, have been evaluated as therapeutic agents in the treatment of such malignancies. See, e.g., Baselga and Mendelsohn., supra; Masui et al. Cancer Research 44:1002-1007 (1984); and Wu et al. J. Clin. Invest. 95:1897-1905 (1995).
The second member of the HER family, p185/eU, was originally identified as the product of the transforming gene from neuroblastomas of chemically treated rats. The activated form of the zzeu proto-oncogene results from a point mutation (valine to glutamic acid) in the transmembrane region of the encoded protein. Amplification of the human homolog of neu is observed in breast and ovarian cancers and correlates with a poor prognosis (Slamon et al., Science, 235:177-182 (1987); Slamon et al., Science, 244:707-712 (1989);
and US Pat No. 4,968,603). To date, no point mutation analogous to that in the neu proto-oncogene has been reported for human tumors. Overexpression of HER2 (frequ(--ntly but not uniformly due to gene amplification) has also been observed in other carcinomas including carcinomas of the stomach, endometrium, salivary gland, lung, kidney, colon, thyroid, pancreas and bladder. See, among others, King et al., Science, 229:974 (1985);
Yokota et al., Lancet: 1:765-767 (1986); Fukushige et at., Mol Cell Biol., 6:955-958 (1986); Guerin et al., Oncogene Res., 3:21-31 (1988); Cohen et al., Oncogene, 4:81-88 (1989);
Yonemura et al., Cancer Res., 51:1034 (1991); Borst et al., Gynecol. Oncol., 38:364 (1990); Weiner et al., Cancer Res., 50:421-425 (1990); Kern et al., Cancer Res., 50:5184 (1990); Park et al., Cancer Res., 49:6605 (1989); Zhau et al., Mol. Carcinog., 3:254-257 (1990); Aasland et al. Br. J. Cancer 57:358-363 (1988); Williams et al.
Pathobiology 59:46-52 (1991); and McCann et al., Cancer, 65:88-92 (1990). HER2 may be overexpressed in prostate cancer (Gu et al. Cancer Lett. 99:185-9 (1996); Ross et al. Hum. Pathol. 28:827-33 (1997); Ross et al.
Cancer 79:2162-70 (1997); and Sadasivan et al. J. Urol. 150:126-31 (1993)).
Antibodies directed against the rat p1857e" and human HER2 protein products have been described.
Drebin and colleagues have raised antibodies against the rat zzeu gene product, p 185... See, for example, Drebin et al., Cell 41:695-706 (1985); Myers et al., Meth. Enzym. 198:277-290 (1991);
and W094/22478. Drebin et al.
Oncogene 2:273-277 (1988) report that mixtures of antibodies reactive with two distinct regions of p185"eU result in synergistic anti-tumor effects on zzeu-transformed NIH-3r3 cells implanted into nude mice. See also U.S.
Patent 5,824,311 issued October 20, 1998.
Hudziak et al., Mol. Cell. Biol. 9(3):1165-1172 (1989) describe the generation of a panel of HER2 antibodies which were characterized using the human breast tumor cell line SK-BR-3. Relative cell proliferation of the SK-BR-3 cells following exposure to the antibodies was determined by crystal violet staining of the monolayers after 72 hours. Using this assay, maximum inhibition was obtained with the antibody called 4D5 which inhibited cellular proliferation by 56%. Other antibodies in the panel reduced cellular proliferation to a lesser extent in this assay. The antibody 4D5 was further found to sensitize HER2-overexpressing breast tumor cell lines to the cytotoxic effects of TNF-a. See also U.S. Patent No.
5,677,171 issued October 14, 1997. The HER2 antibodies discussed in Hudziak et al. are further characterized in Fendly et al. Cancer Research 50:1550-1558 (1990); Kotts et al. In Vitro 26(3):59A (1990); Sarup et al. Growth Regulation 1:72-82 (1991); Shepard et al. J. Clin. Immunol. 11(3):117-127 (1991); Kumar et al. Mol. Cell. Biol.
11(2):979-986 (1991); Lewis et al.
Cancer Inzmunol. Imznunother. 37:255-263 (1993); Pietras et al. Oncogene 9:1829-1838 (1994); Vitetta et al.
Cancer Research 54:5301-5309 (1994); Sliwkowski et a!. J. Riol. Chem.
269(20):14661-14665 (1994); Scott et al. J. Biol. Chem. 266:14300-5 (1991); D'souza et a!. Proc. Mat!. Acad. Sci.
91:7202-7206 (1994); Lewis et a!.
Cancer Research 56:1457-1465 (1996); and Schaefer et a!. Orcogene 15:1385-1394 (1997).
This is a non-provisional application filed under 37 CFR 1.53(b) claiming priority to provisional application 60/620,413 filed October 20, 2004, Field of the Invention The present invention concerns antibody formulations, including monoclonal antibodies formulated in histidine-acetate buffer, as well as a formulation comprising an antibody that binds to domain II of HER2 (for example, Pertuzumab), and a formulation comprising an antibody that binds to DR5 (for example, Apomab).
Background of the Invention In the past ten years, advances in biotechnology have made it possible to produce a variety of proteins for pharmaceutical applications using recombinant DNA techniques. Because proteins are larger and more complex than traditional organic and inorganic drugs (i.e. possessing multiple functional groups in addition to complex three-dimensional structures), the formulation of such proteins poses special problems. For a protein to remain biologically active, a formulation must preserve intact the conformational integrity of at least a core sequence of the protein's amino acids while at the same time protecting the protein's multiple functional groups from degradation. Degradation pathways for proteins can involve chemical instability (i.e. any process which involves modification of the protein by bond formation or cleavage resulting in a new chemical entity) or physical instability (i.e. changes in the higher order structure of the protein). Chemical instability can result from deamidation, racemization, hydrolysis, oxidation, beta elimination or disulfide exchange. Physical instability can result from denaturation, aggregation, precipitation or adsorption, for example. The three most common protein degradation pathways are protein aggregation, deamidation and oxidation. Cleland et at Critical Reviews in Therapeutic Drug Carrier Systems 10(4): 307-377 (1993).
Antibody Formulations Included in the proteins used for pharmaceutical applications are antibodies.
An example of an antibody useful for therapy is an antibody which binds to the HER2 antigen, such as Pertuzumab.
US Patent No. 6,339,142 describes a HER2 antibody composition comprising a mixture of anti-HER2 antibody and one or more acidic variants thereof, wherein the amount of the acidic variant(s) is less than about 25%. Trastuzumab is an exemplified HER2 antibody.
US Patent Nos. 6,267,958 and 6,685,940 (Andya et at) describe lyophilized antibody formulations, including HER2 and IgE antibody formulations. W097/04807 and US 2004/0197326A1 (Fick et at) describe methods for treating allergic asthma with an IgE antibody. W099/01556 (Lowman et at) relates to IgE antibody with aspartyl residues prone to isomerization, and improved variants thereof.
US 2002/0045571 (Liu et at) provides reduced viscosity concentrated protein formulations, exemplified by humanized IgE antibody formulations, rhuMAb E25 and E26. WO 02/096457 and US 2004/0170623 (Arvinte et al.) describes stable liquid formulations comprising anti-IgE antibody E25. See, also, US
2004/0197324 Al (Liu and Shire) concerning high concentration anti-IgE formulation.
US Patent No. 6,171,586 (Lam et at) describes stable aqueous antibody formulations. A F(ab')2 rhuMAb CD18 antibody was formulated in sodium acetate and histidine-HC1 buffers. The preferred formulation for rhuMAb CD18 was 10mM sodium acetate, 8% trehalose, 0.01% TWEEN 20Tm, pH
5Ø Acetate (pH 5.0) formulations of rhuMAb CD20 stored at 40 for one month demonstrated greater stability than those samples formulated in histidine (pH 5.0 or 6.0).
US 2003/0190316 (Kakuta et al.) concerns formulated antibody hPM-1, a humanized IL-6 receptor antibody. Monomer loss was the greatest in sodium citrate (pH 6.7), followed by sodium phosphate (pH 6.8), Tris-HCl (pH 7.2), histidine-HCI (pH 7.2) and glycine (pH 7.6) in descending order. The effect of phosphate-Na (pH 6.5), phosphate-His (pH 6.0 or 6.5), His-HC1 (pH 6.5), and phosphate-Na (pH 6.0) on the stability of hPM-1 was assessed.
W02004/071439 (Burke et al.) state that impurities arose in a natalizumab (anti-alpha4 integrin humanized monoclonal antibody) formulation from the degradation of polysorbate 80, apparently through an oxidation reaction involving metal ions and hisitidine. Thus, a phosphate buffer was selected.
WO 2000/066160 (English language counterpart EP 1 174 148A1) (Okada et al.) refers to a formulation of a humanized C4G1 antibody which binds to a fibrinogen receptor of a human platelet membrane glycoprotein GPIIb/lIIa, in a sodium phosphate or sodium citrate buffer.
W02004/019861 (Johnson et al.) concerns CDP870, a pegylated anti-TNFa Fab fragment, formulated at 200mg/ml in 50mM sodium acetate (pH 5.5) and 125mM sodium chloride.
W02004/004639 (Nesta, P.) refers to a formulation for huC242-DM1, a tumor-activated immunotoxin, in a 50mM succinic acid buffer (pH 6.0) and sucrose (5%w/v).
W003/039485 (Kaisheva et al.) found that Daclizumab (a humanized IL-2 receptor antibody) had the highest stability in sodium succinate buffer at pH 6.0, and rapidly lost potency in histidine as the buffer oxidized.
WO 2004/001007 concerns a CD80 monoclonal antibody in a histidine HCl, sodium acetate or sodium citrate buffer.
US Patent No. 6,252,055 (Relton, J.) refers to anti-CD4 and anti-CD23 antibodies formulated in maleate, succinate, sodium acetate or phosphate buffers, with phosphate being identified as the preferred buffer.
US Patent No. 5,608,038 (Eibl et al.) refers to highly concentrated polyclonal immunoglobulin preparations with immunoglobulin, glucose or sucrose, and sodium chloride therein.
W003/015894 (Oliver et al.) refers to an aqueous formulation of 100mg/mL
SYNAGIS , 25mM
histidine-HCI, 1.6mM glycine, pH 6.0, and a lyophilized SYNAGIS which when formulated (before lyophilization) contains 25mM histidine, 1.6mM glycine and 3% w/v mannitol at pH 6Ø
US 2004/0191243 Al (Chen et al.) reports formulation of ABX-1L8, a human IgG2 antibody.
US 2003/0113316 Al (Kaisheva et al.) refers to a lyophilized anti-1L2 receptor antibody formulation.
HER2 Antibodies The HER family of receptor tyrosine kinases are important mediators of cell growth, differentiation and survival. The receptor family includes four distinct members including epidermal growth factor receptor (EGFR, ErbBI, or HER1), HER2 (ErbB2 or p185"eU), HER3 (ErbB3) and HER4 (ErbB4 or tyro2).
EGFR, encoded by the erbB 1 gene, has been causally implicated in human malignancy. In particular, increased expression of EGFR has been observed in breast, bladder, lung, head, neck and stomach cancer as well as glioblastomas. Increased EGFR receptor expression is often associated with increased production of the EGFR ligand, transforming growth factor alpha (TGF-a), by the same tumor cells resulting in receptor activation by an autocrine stimulatory pathway. Baselga and Mendelsohn Pharrac. Ther.
64:127-154 (1994). Monoclonal antibodies directed against the EGFR or its ligands, TGF-a and EGF, have been evaluated as therapeutic agents in the treatment of such malignancies. See, e.g., Baselga and Mendelsohn., supra; Masui et al. Cancer Research 44:1002-1007 (1984); and Wu et al. J. Clin. Invest. 95:1897-1905 (1995).
The second member of the HER family, p185/eU, was originally identified as the product of the transforming gene from neuroblastomas of chemically treated rats. The activated form of the zzeu proto-oncogene results from a point mutation (valine to glutamic acid) in the transmembrane region of the encoded protein. Amplification of the human homolog of neu is observed in breast and ovarian cancers and correlates with a poor prognosis (Slamon et al., Science, 235:177-182 (1987); Slamon et al., Science, 244:707-712 (1989);
and US Pat No. 4,968,603). To date, no point mutation analogous to that in the neu proto-oncogene has been reported for human tumors. Overexpression of HER2 (frequ(--ntly but not uniformly due to gene amplification) has also been observed in other carcinomas including carcinomas of the stomach, endometrium, salivary gland, lung, kidney, colon, thyroid, pancreas and bladder. See, among others, King et al., Science, 229:974 (1985);
Yokota et al., Lancet: 1:765-767 (1986); Fukushige et at., Mol Cell Biol., 6:955-958 (1986); Guerin et al., Oncogene Res., 3:21-31 (1988); Cohen et al., Oncogene, 4:81-88 (1989);
Yonemura et al., Cancer Res., 51:1034 (1991); Borst et al., Gynecol. Oncol., 38:364 (1990); Weiner et al., Cancer Res., 50:421-425 (1990); Kern et al., Cancer Res., 50:5184 (1990); Park et al., Cancer Res., 49:6605 (1989); Zhau et al., Mol. Carcinog., 3:254-257 (1990); Aasland et al. Br. J. Cancer 57:358-363 (1988); Williams et al.
Pathobiology 59:46-52 (1991); and McCann et al., Cancer, 65:88-92 (1990). HER2 may be overexpressed in prostate cancer (Gu et al. Cancer Lett. 99:185-9 (1996); Ross et al. Hum. Pathol. 28:827-33 (1997); Ross et al.
Cancer 79:2162-70 (1997); and Sadasivan et al. J. Urol. 150:126-31 (1993)).
Antibodies directed against the rat p1857e" and human HER2 protein products have been described.
Drebin and colleagues have raised antibodies against the rat zzeu gene product, p 185... See, for example, Drebin et al., Cell 41:695-706 (1985); Myers et al., Meth. Enzym. 198:277-290 (1991);
and W094/22478. Drebin et al.
Oncogene 2:273-277 (1988) report that mixtures of antibodies reactive with two distinct regions of p185"eU result in synergistic anti-tumor effects on zzeu-transformed NIH-3r3 cells implanted into nude mice. See also U.S.
Patent 5,824,311 issued October 20, 1998.
Hudziak et al., Mol. Cell. Biol. 9(3):1165-1172 (1989) describe the generation of a panel of HER2 antibodies which were characterized using the human breast tumor cell line SK-BR-3. Relative cell proliferation of the SK-BR-3 cells following exposure to the antibodies was determined by crystal violet staining of the monolayers after 72 hours. Using this assay, maximum inhibition was obtained with the antibody called 4D5 which inhibited cellular proliferation by 56%. Other antibodies in the panel reduced cellular proliferation to a lesser extent in this assay. The antibody 4D5 was further found to sensitize HER2-overexpressing breast tumor cell lines to the cytotoxic effects of TNF-a. See also U.S. Patent No.
5,677,171 issued October 14, 1997. The HER2 antibodies discussed in Hudziak et al. are further characterized in Fendly et al. Cancer Research 50:1550-1558 (1990); Kotts et al. In Vitro 26(3):59A (1990); Sarup et al. Growth Regulation 1:72-82 (1991); Shepard et al. J. Clin. Immunol. 11(3):117-127 (1991); Kumar et al. Mol. Cell. Biol.
11(2):979-986 (1991); Lewis et al.
Cancer Inzmunol. Imznunother. 37:255-263 (1993); Pietras et al. Oncogene 9:1829-1838 (1994); Vitetta et al.
Cancer Research 54:5301-5309 (1994); Sliwkowski et a!. J. Riol. Chem.
269(20):14661-14665 (1994); Scott et al. J. Biol. Chem. 266:14300-5 (1991); D'souza et a!. Proc. Mat!. Acad. Sci.
91:7202-7206 (1994); Lewis et a!.
Cancer Research 56:1457-1465 (1996); and Schaefer et a!. Orcogene 15:1385-1394 (1997).
A recombinant humanized version of the murine HER2 antibody 4D5 (huMAb4D5-8, rhuMAb HER2, Trastuzumab or HERCEPTIN`"; U.S. Patent No. 5,821,337) is clinically active in patients with HER2-overexpressing metastatic breast cancers that have received extensive prior anti-cancer therapy (Baselga et al., J.
Clin. Oncol. 14:737-744 (1996)). Trastuzumab received marketing approval from the Food and Drug Administration September 25, 1998 for the treatment of patients with metastatic breast cancer whose tumors overexpress the HER2 protein.
Other HER2 antibodies with various properties have been described in Tagliabue et al. Int. J. Cancer 47:933-937 (1991); McKenzie et al. Oncogene 4:543-548 (1989); Maier et al.
Cancer Res. 51:5361-5369 (1991);
Bacus et al. Molecular Carcinogenesis 3:350-362 (1990); Stancovski et al. PNAS
(USA) 88:8691-8695 (1991);
Bacus et al. Cancer Research 52:2580-2589 (1992); Xu et al. Int. J. Cancer 53:401-408 (1993); W094/00136;
Kasprzyk et al. Cancer Research 52:2771-2776 (1992);Hancock et al. Cancer Res.
51:4575-4580 (1991);
Shawver et al. Cancer Res. 54:1367-1373 (1994); Arteaga et al. Cancer Res.
54:3758-3765 (1994); Harwerth et al. J. Biol. Chem. 267:15160-15167 (1992); U.S. Patent No. 5,783,186; and Klapper et cal. Oncogene 14:2099-2109 (1997).
Homology screening has resulted in the identification of two other HER
receptor family members;
HER3 (US Pat. Nos. 5,183,884 and 5,480,968 as well as Kraus et al. PNAS (USA) 86:9193-9197 (1989)) and HER4 (EP Pat Appln No 599,274; Plowman et al., Proc. Natl. Acad. Sci. USA, 90:1746-1750 (1993); and Plowman et al., Nature, 366:473-475 (1993)). Both of these receptors display increased expression on at least some breast cancer cell lines.
The HER receptors are generally found in various combinations in cells and heterodimerization is thought to increase the diversity of cellular responses to a variety of HER
ligands (Earp et al. Breast Cancer Research and Treatment 35: 115-132 (1995)). EGFR is bound by six different ligands; epidermal growth factor (EGF), transforming growth factor alpha (TGF-a), amphiregulin, heparin binding epidermal growth factor (HB-EGF), betacellulin and epiregulin (Groenen et al. Growth Factors 11:235-257 (1994)). A family of heregulin proteins resulting from alternative splicing of a single gene are ligands for HER3 and HER4. The heregulin family includes alpha, beta and gamma heregulins (Holmes et al., Science, 256:1205-1210 (1992); U.S. Patent No. 5,641,869; and Schaefer et al. Oncogene 15:1385-1394 (1997)); neu differentiation factors (NDFs), glial growth factors (GGFs); acetylcholine receptor inducing activity (ARIA); and sensory and motor neuron derived factor (SMDF). For a review, see Groenen et al. Growth Factors 11:235-257 (1994); Lernke, G. Molec. & Cell.
Neurosci. 7:247-262 (1996) and Lee et al. Pharm. Rev. 47:51-85 (1995).
Recently three additional HER ligands were identified; neuregulin-2 (NRG-2) which is reported to bind either HER3 or HER4 (Chang et al. Nature 387 509-512 (1997); and Carraway et al Nature 387:512-516 (1997)); neuregulin-3 which binds HER4 (Zhang et al.
PNAS (USA) 94(18):9562-7 (1997)); and neuregulin-4 which binds HER4 (Harari et al. Oncogene 18:2681-89 (1999)) HB-EGF, betacellulin and epiregulin also bind to HER4.
While EGF and TGFa do not bind HER2, EGF stimulates EGFR and HER2 to form a heterodimer, which activates EGFR and results in transphosphorylation of HER2 in the heterodimer_ Dimerization and/or transphosphorylation appears to activate the HER2 tyrosine kinase. See Earp et al., supra. Likewise, when HER3 is co-expressed with HER2, an active signaling complex is formed and antibodies directed against HER2 are capable of disrupting this complex (Sliwkowski et al., J. Biol. Chem., 269(20): 14661-14665 (1994)).
Additionally, the affinity of HER3 for heregulin (HRG) is increased to a higher affinity state when co-expressed with HER2. See also, Levi et al., Journal of Neuroscience 15: 1329-1340 (1995); Morrissey et al., Proc. Natl.
Acad. Sci. USA 92: 1431-1435 (1995); and Lewis et al., Cancer Res., 56:1457-1465 (1996) with respect to the:
HER2-HER3 protein complex. HER4, like HER3, forms an active signaling complex with HER2 (Carraway and Cantley, Cell 78:5-8 (1994)).
To target the HER signaling pathway, rhuMAb 2C4 (Pertuzumab, OMNITARGTM) was developed as a.
humanized antibody that inhibits the dimerization of HER2 with other HER
receptors, thereby inhibiting ligand-driven phosphorylation and activation, and downstream activation of the RAS
and AKT pathways. In a phase I
trial of Pertuzumab as a single agent for treating solid tumors, 3 subjects with advanced ovarian cancer were treated with Pertuzumab. One had a durable partial response, and an additional subject had stable disease for 15 weeks Agus et al. Proc Am Soc Clin Oncol 22: 192, Abstract 771 (2003).
DR5 Antibodies Various ligands and receptors belonging to the tumor necrosis factor (TNF) superfamily have been identified in the art. Included among such ligands are tumor necrosis factor-alpha ("TNF-alpha"), tumor necrosis factor-beta ("TNF-beta" or "lymphotoxin-alpha"), lymphotoxin-beta ("LT-beta"), CD30 ligand, CD27 ligand, CD40 ligand, OX-40 ligand, 4-1BB ligand, LIGHT, Apo-1 ligand (also referred to as Fas ligand or CD95 ligand), Apo-2 ligand (also referred to as Apo2L or TRAIL), Apo-3 ligand (also referred to as TWEAK), APRIL, OPG ligand (also referred to as RANK ligand, ODF, or TRANCE), and TALL-1 (also referred to as B1yS, BAFF or THANK) (See, e.g., Ashkenazi, Nature Review, 2:420-430 (2002); Ashkenazi and Dixit, Science, 281:1305-1308 (1998); Ashkenazi and Dixit, Curr. Opin. Cell Biol., 11:255-260 (2000); Golstein, Curr. Biol., 7:750-753 (1997) Wallach, Cytol;ine Reference, Academic Press, 2000, pages 377-411; Locksley et al., Cell, 104:487-501 (2001); Gruss and Dower, Blood, 85:3378-3404 (1995); Schmid et al., Proc. Natl. AcacL Sci., 83:1881 (1986); Dealtry et al., Eur. J. Immunol., 17:689 (1987); Pitti et al., J. Biol. Chem., 271:12687-12690 (1996); Wiley et aL, Immunity, 3:673-682 (1995);
Browning et aL, Cell, 72:847-856 (1993); Armitage et al. Nature, 357:80-82 (1992), WO 97/01633 published January 16, 1997; WO 97/25428 published July 17, 1997; Marsters et al., Curr.
Biol., 8:525-528 (1998);
Chicheportiche et al., Biol. Chem., 272:32401-32410 (1997); Hahne et al., J.
Exp. Med., 188:1185-1190 (1998);
W098/28426 published July 2, 1998; W098/46751 published October 22, 1998;
WO/98/18921 published May 7, 1998; Moore et al., Science, 285:260-263 (1999); Shu et al., J. Leukocyte Biol., 65:680 (1999); Schneider et al., J.
Exp. Med., 189:1747-1756 (1999); Mukhopadhyay et al., J, Biol. Chem., 274:15978-15981 (1999)).
Induction of various cellular responses mediated by such TNF family ligands is typically initiated by their binding to specific cell receptors. Some, but not all, TNF family ligands bind to, and induce various biological activity through, cell surface "death receptors" to activate caspases, or enzymes that carry out the cell death or apoptosis pathway (Salvesen et al., Cell, 91:443-446 (1997)). Included among the members of the TNF receptor superfamily identified to date are TNFRI, TNFR2, TACI, GITR,, CD27, OX-40, CD30, CD40, HVEM, Fas (also referred to as Apo-1 or CD95), DR4 (also referred to as TRAIL-Rl), DR5 (also referred to as Apo-2 or TRAIL-R2), DcRl, DcR2, osteoprotegerin (OPG), RANK and Apo-3 (also referred to as DR3 or TRAMP).
Most of these TNF receptor family members share the typical structure of cell surface receptors including extracellular, transmembrane and intracellular regions, while others are found naturally as soluble proteins lacking a transmembrane and intracellular domain. The extracellular portion of typical TNFRs contains a repetitive amino acid sequence pattern of multiple cysteine-rich domains (CRDs), starting from the NH2-terminus.
The ligand referred to as Apo-2L or TRAIL was identified several years ago as a member of the TNF
family of cytokines. (see, e.g., Wiley et al., Immunity, 3:673-682 (1995);
Pitti et al., J. Biol. Chem., 271:12697-12690 (1996); WO 97/01633; WO 97/25428; US Patent 5,763,223 issued June 9, 1998; US Patent 6,284,236 issued September 4, 2001). The full-length native sequence human Apo2L/TRAIL
polypeptide is a 281 amino acid long, Type II transmembrane protein. Some cells can produce a natural soluble form of the polypeptide, through enzymatic cleavage of the polypeptide's extracellular region (Mariani et al., J. Cell. Biol., 137:221-229 (1997)). Crystallographic studies of soluble forms of Apo2L/TRAIL reveal a homotrimeric structure similar to the structures of TNF and other related proteins (Hymowitz et al., Molec_ Cell, 4:563-571 (1999); Cha et al., Immunity, 11:253-261 (1999); Mongkolsapaya et al., Nature Structural Biology, 6:1048 (1999); Hymowitz et al., Biochemistry, 39:633-644 (2000)). Apo2L/TRAIL, unlike other TNF faa-idly members however, was found to have a unique structural feature in that three cysteine residues (at position 230 of each subunit in the homotrimer) together coordinate a zinc atom, and that the zinc binding is important for trimer stability and biological activity.
(Hymowitz et al., supra; Bodmer et al., J. Biol. Chen., 275:20632-20637 (2000)).
It has been reported in the literature that Apo2L/TRAIL may play a role in immune system modulation, including autoimmune diseases such as rheumatoid arthritis (see, e.g., Thomas et al., J. Immunol., 161:2195-2200 (1998); Johnsen et al., Cytokine, 11:664-672 (1999); Griffith et al., J.
Exp. Med., 189:1343-1353 (1999);
Song et al., J. Exp. Med., 191:1095-1103 (2000)).
Soluble forms of Apo2L/TRAIL have also been reported to induce apoptosis in a variety of cancer cells, including colon, lung, breast, prostate, bladder, kidney, ovarian and brain tumors, as well as melanoma, leukemia, and multiple myeloma (see, e.g., Wiley et al., supra; Pitti et al., supra; US
Patent 6,030,945 issued February 29, 2000; US Patent 6,746,668 issued June 8, 2004; Rieger et al., FEBS Letters, 427:124-128 (1998); Ashkenazi et al., J. Clin. Invest., 104:155-162 (1999); Walczak et al., Nature Med., 5:257-163 (1999); Keane et al., Cancer Research, 59:734-741 (1999); Mizutani et al., Clin. Cancer Res., 5:2605-2612 (1999); Gazitt, Leukemia, 13:1817-1824 (1999); Yu et al., Cancer Res., 60:2384-2389 (2000); Chirinaiyan et al., Proc. Natl. Acad. Sci., 97:1754-1759 (2000)). In vivo studies in murine tumor models further suggest that Apo2L/TRAIL, alone or in combination with chemotherapy or radiation therapy, can exert substantial anti-tumor effects (see, e.g., Ashkenazi et al., supra; Walzcak et al., supra; Gliniak et al., Cancer Res., 59:6153-6158 (1999); Chinnaiyan et al., supra; Roth et al., Biochem. Biophys. Res. Comin., 265:1999 (1999); PCT
Application US/00/15512; PCT
Application US/01/23691). In contrast to many types of cancer cells, most normal human cell types appear to be resistant to apoptosis induction by certain recombinant forms of Apo2L/TRAIL
(Ashkenazi et al., supra;
Walzcak et al., supra). Jo et al. has reported that a polyhistidine-tagged soluble form of Apo2L/TRAIL induced apoptosis in vitro in normal isolated human, but not non-human, hepatocytes (Jo et al., Nature Med., 6:564-567 (2000); see also, Nagata, Nature Med., 6:502-503 (2000)). It is believed that certain recombinant Apo2L/TRAIL
preparations may vary in terms of biochemical properties and biological activities on diseased versus normal cells, depending, for example, on the presence or absence of a tag molecule, zinc content, and % trimer content (See, Lawrence et al., Nature Med., Letter to the Editor, 7:383-385 (2001);
Qin et al., Nature Med., Letter to the Editor, 7:385-386 (2001)).
Apo2L/TRAIL has been found to bind at least five different receptors. At least two of the receptors which bind Apo2L/TRAIL contain a functional, cytoplasmic death domain. One such receptor has been referred to as "DR4" (and alternatively as TR4 or TRAIL-R1) (Pan et al., Science, 276:111-113 (1997); see also W098/32856 published July 30, 1998; W099/37684 published July 29, 1999; WO
00/73349 published December 7, 2000; US 6,433,147 issued August 13, 2002; US 6,461,823 issued October 8, 2002, and US
6,342,383 issued January 29, 2002).
Another such receptor for Apo2L/TRAIL has been referred to as DR5 (it has also been alternatively referred to as Apo-2; TRAIL-R or TRAIL-R2, TR6, Tango-63, hAPO8, TRICK2 or KILLER) (see, e.g., Sheridan et at., Science, 277:818-821 (1997), Pan et al., Science, 277:815-818 (1997), W098/51793 published November 19, 1998; W098/41629 published September 24, 1998; Screaton et al., Curr. Biol., 7:693-696 (1997);
Walczak et al., EMBO J., 16:5386-5387 (1997); Wu et al., Nature Genetics, 17:141-143 (1997); W098/35986 published August 20, 1998; EP870,827 published October 14, 1998; W098/46643 published October 22, 1998;
W099/02653 published January 21, 1999; W099/09165 published February 25, 1999;
W099/11791 published March 11, 1999; US 2002/0072091 published August 13, 2002; US 2002/0098550 published December 7, 2001;
US 6,313,269 issued December 6, 2001; US 2001/0010924 published August 2, 2001; US 2003/01255540 published July 3, 2003; US 2002/0160446 published October 31, 2002, US
2002/0048785 published April 25, 2002; US 6,342,369 issued February, 2002; US 6,569,642 issued May 27, 2003, US
6,072,047 issued June 6, 2000, US 6,642,358 issued November 4, 2003; IS 6,743,625 issued June 1, 2004).
Like DR4, DR-5 is reported to contain a cytoplasmic death domain and be capable of signaling apoptosis upon ligand binding (or upon binding a molecule, such as an agonist antibody, which mimics the activity of the ligand). The crystal structure of the complex formed between Apo-2L/TRAIL and DR5 is described in Hymowitz et al., Moleculczr Cell, 4:563-571 (1999).
Upon ligand binding, both DR4 and DR5 can trigger apoptosis independently by recruiting and activating the apoptosis initiator, caspase-8, through the death-domain-containing adaptor molecule referred to as FADD/Mortl (Kischkel et al., Immunity, 12:611-620 (2000); Sprick et al., Immunity, 12:599-609 (2000);
Bodmer et al., Nature Cell Biol., 2:241-243 (2000)).
Apo2L/TRAIL has been reported to also bind those receptors referred to as DcRI, DcR2 and OPG, which believed to function as inhibitors, rather than transducers of signaling (see., e.g., DcR1 (also referred to as TRID, LIT or TRAIL-R3) (Pan et al., Science, 276:111-113 (1997); Sheridan et al., Science, 277:818-821 (1997);
McFarlane et al., J. Biol. Chen., 272:25417-25420 (1997); Schneider et al., FEBS Letters, 416:329-334 (1997);
Degli-Esposti et al., J. Exp. Med., 186:1165-1170 (1997); and Mongkolsapaya et al., J. Erninunol., 160:3-6 (1998)); DcR2 (also called TRUNDD or TRAIL-R4) (Marsters et al., Curr. Biol., 7:1003-1006 (1997); Pan et al., FEBS Letters, 424:41-45 (1998); Degli-Esposti et at., Immunity, 7:813-820 (1997)), and OPO. In contrast to DR4 and DR5, the DcR1 and DcR2 receptors do not signal apoptosis.
Certain antibodies which bind to the DR4 and/or DR5 receptors have been reported in the literature.
For example, anti-DR4 antibodies directed to the DR4 receptor and having agonistic or apoptotic activity in certain mammalian cells are described in, e.g., WO 99/37684 published July 29, 1999; WO 00/73349 published July 12, 2000; WO 03/066661 published August 14, 2003. See, also, e.g., Griffith et al., J. Iimunol., 162:2597-2605 (1999); Chuntharapai et al., J. Immunol., 166:4891-4898 (2001); WO
02/097033 published December 2, 2002; WO 03/042367 published May 22, 2003; WO 03/038043 published May 8, 2003;
WO 03/037913 published May 8, 2003. Certain anti-DR5 antibodies have likewise been described, see, e.g., WO 98/51793 published November 8, 1998; Griffith et al., J. Immunol., 162:2597-2605 (1999); Ichikawa et al., Nature Med., 7:954-960 (2001); Hylander et al., "An Antibody to DR5 (TRAIL-Receptor 2) Suppresses the Growth of Patient Derived Gastrointestinal Tumors Grown in SCID mice", Abstract, 2d International Congress on Monoclonal Antibodies in Cancers, Aug. 29-Sept. 1, 2002, Banff, Alberta, Canada; WO 03/038043 published May 8, 2003; WO
03/037913 published May 8, 2003. In addition, certain antibodies having cross-reactivity to both DR4 and DR5 receptors have been described (see, e.g., US patent 6,252,050 issued June 26, 2001).
Summary of the Invention The invention herein relates, at least in part, to the identification of histidine-acetate, pH 5.5 to 6.5, as a particularly useful buffer for formulating monoclonal antibodies, especially full length IgGi antibodies which are susceptible to deamidation and/or aggregation. The formulation retards degradation of the antibody product therein.
Thus, in a first aspect, the invention concerns a stable pharmaceutical formulation comprising a monoclonal antibody in histidine-acetate buffer, pH 5.5 to 6.5. The monoclonal antibody preferably binds an antigen selected from the group consisting of HER2, CD20, DR5, BR3, IgE, and VEGF.
In addition, the invention concerns a method of treating a disease or disorder in a subject comprising administering the formulation to a subject in an amount effective to treat the disease or disorder.
In another aspect, the invention concerns a pharmaceutical formulation comprising: (a) a full length IgG1 antibody susceptible to deamidation or aggregation in an amount from about l0mg/mL to about 250mg/mL;
(b) histidine-acetate buffer, pH 5.5 to 6.5; (c) saccharide selected from the group consisting of trehalose and sucrose, in an amount from about 60mM to about 250mM; and (d) polysorbate 20 in an amount from about 0.01% to about 0.1%.
The invention also provides a method for reducing deamidation or aggregation of a therapeutic monoclonal antibody, comprising formulating the antibody in a histidine-acetate buffer, pH 5.5 to 6.5.
In yet a further aspect, the invention concerns a pharmaceutical formulation comprising an antibody that binds to domain II of HER2 in a histidine buffer at a pH from about 5.5 to about 6.5, a saccharide and a surfactant.
The invention also relates to a pharmaceutical formulation comprising Pertuzumab in an amount from about 20mg/mL to about 40mg1mL, histidine-acetate buffer, sucrose, and polysorbate 20, wherein the pH of the formulation is from about 5.5 to about 6.5.
The invention also pertains to a pharmaceutical formulation comprising a DR5 antibody in a histidine buffer at a pH from about 5.5 to about 6.5, a saccharide, and a surfactant.
In another aspect, the invention concerns a pharmaceutical formulation comprising Apomab in an amount from about 10mg/mL to about 30mg/mL, histidine-acetate buffer, trehalose, and polysorbate 20, wherein the pH of the formulation is from about 5.5 to about 6.5.
In yet another aspect, the invention provides a method of treating cancer in a subject, comprising administering the pharmaceutical formulation to the subject in an amount effective to treat the cancer.
The invention also concerns a vial with a stopper pierceable by a syringe or a stainless steel tank comprising the formulation inside the vial or tank, optionally in frozen form.
Moreover, the invention provides a method of making a pharmaceutical formulation comprising: (a) preparing the monoclonal antibody formulation; and (b) evaluating physical stability, chemical stability, or biological activity of the monoclonal antibody in the formulation.
Brief Description of the Drawings Figure 1 depicts Domains I-IV (SEQ ID Nos. 19-22, respectively) of the extracellular domain of HER2.
Figures 2A and 2B depict alignments of the amino acid sequences of the variable light (VL) (Fig. 2A) and variable heavy (VH) (Fig. 2B) domains of murine monoclonal antibody 2C4 (SEQ ID Nos. 1 and 2, respectively); VL and VH domains of humanized 2C4 version 574 (SEQ ID Nos. 3 and 4, respectively), and human VL and VH consensus frameworks (hum xl, light kappa subgroup I; humlll, heavy subgroup III) (SEQ
ID Nos. 5 and 6, respectively). Asterisks identify differences between humanized 2C4 version 574 and murine monoclonal antibody 2C4 or between humanized 2C4 version 574 and the human framework. Complementarity Determining Regions (CDRs) are in brackets.
Figures 3A and 3B show the amino acid sequences of Pertuzumab light chain and heavy chain (SEQ ID
Nos. 15 and 16, respectively). CDRs are shown in bold. Calculated molecular mass of the light chain and heavy chain are 23,526.22 Da and 49,216.56 Da (cysteines in reduced form). The carbohydrate moiety is attached to Asn 299 of the heavy chain.
Figures 4A and 4B show the amino acid sequences of Pertuzumab light and heavy chain, each including an intact amino terminal signal peptide sequence (SEQ ID Nos. 17 and 18, respectively).
Figure 5 depicts, schematically, binding of 2C4 at the heterodimeric binding site of HER2, thereby preventing heterodimerization with activated EGFR or HER3.
Figure 6 depicts coupling of HER2/HER3 to the MAPK and Akt pathways.
Figure 7 compares activities of Trastuzumab and Pertuzumab.
Figure 8 depicts stability of Pertuzumab formulation by ion exchange (IEX) analyses.
Figure 9 shows stability of Pertuzumab formulation by size exclusion chromatography (SEC) analysis.
Figure 10 reflects physical stability Pertuzumab in different formulations.
Figure 11 is from an agitation study of Pertuzumab liquid formulations.
Figure 12 is from another agitation study of Pertuzumab liquid formulations.
Figure 13 is from a freeze-thawing study of Pertuzumab formulation.
Figures 14A and 14B show the amino acid sequences of Trastuzumab light chain (SEQ ID No. 13) and heavy chain (SEQ ID No. 14).
Figures 15A and 15B depict a variant Pertuzumab light chain sequence (SEQ ID
No. 23) and a variant Pertuzumab heavy chain sequence (SEQ ID No. 24).
Figure 16A and 16B shows oligosaccharide structures commonly observed in IgG
antibodies.
Figures 17A and 17B show the sequences of the light and heavy chains (SEQ ID
Nos. 37-44) of specific anti-IgE antibodies E25, E26, HAE1 and Hu-901. In Fig. 17A, the variable light domain ends with the residues VEIK, residue 111. In Fig. 17B, the variable heavy domain ends with the residues VTVSS, around residue 120.
Figure 18A is a sequence alignment comparing the amino acid sequences of the variable light domain (VL) of each of murine 2H7 (SEQ ID No. 25), humanized 2H7v16 variant (SEQ ID
No. 26), and the human kappa light chain subgroup I (SEQ ID No. 27). The CDRs of VL of 2H7 and hu2H7vl6 are as follows: CDRI
(SEQ ID No. 57), CDR2 (SEQ ID No. 58), and CDR3 (SEQ ID No. 59).
Figure 18B is a sequence alignment comparing the amino acid sequences of the variable heavy domain (VH) of each of murine 2H7 (SEQ ID No. 28), humanized 2H7v16 variant (SEQ ID
No. 29), and the human consensus sequence of the heavy chain subgroup III (SEQ ID No. 30). The CDRs of VH of 2H7 and hu2H7v16 are as follows: CDR1 (SEQ ID No. 60), CDR2 (SEQ ID No. 61), and CDR3 (SEQ ID
No. 62).
In Fig. 18A and Fig. 18B, the CDR1, CDR2 and CDR3 in each chain are enclosed within brackets, flanked by the framework regions, FRl-FR4, as indicated. 2H7 refers to murine 2H7 antibody. The asterisks in between two rows of sequences indicate the positions that are different between the two sequences. Residue numbering is according to Kabat et al. Sequences of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991), with insertions shown as a, b, c, d, and e.
Figure 19 depicts variable domain sequences of three different VEGF antibodies with SEQ ID Nos. 31-36.
Figure 20 shows size exclusion chromatography (SEC) elution profile of the following Apomab samples: (a) control and formulations prepared at (b) pH 4.0, (c) pH 5.0, (d) pH 6.0 and (e) pH 7Ø The formulated samples were stored at 40 C for 2 months prior to the analysis.
Figure 21 depicts pH rate profile for the loss in Apomab antibody monomer during storage. Monomer kinetics by SEC was monitored during storage at 30 C and 40 C and the first-order rate constants were calculated.
Figure 22 provides ion exchange chromatography (IEC) elution profile of Apomab samples as follows:
(a) control and formulations prepared at (b) pH 4.0, (c) pH 5.0, (d) pH 6.0 and (e) pH 7Ø The formulated samples were stored at 40 C for 2 months prior to the analysis.
Figure 23 shows pH rate profile for the loss in IEC main peak during storage.
Main peak kinetics by IEC was monitored during storage at 30 C and 40 C and the first-order rate constants were calculated.
Figure 24 shows the nucleotide sequence of human Apo-2 ligand cDNA (SEQ ID No.
45) and its derived amino acid sequence (SEQ ID No. 46). The "N" at nucleotide position 447 (in SEQ ID No. 45) is used to indicate the nucleotide base may be a "T" or "G".
Figures 25A and 25B show the 411 amino acid sequence of human DR5 receptor (SEQ ID No. 47) as published in WO 98/51793 on November 19, 1998, and the encoding nucleotide sequence (SEQ ID No. 48).
Figures 26A and 26B show the 440 amino acid sequence of human DR5 receptor (SEQ ID No. 49) and the encoding nucleotide sequence (SEQ ID No. 50), as also published in WO
98/35986 on August 20, 1998.
Figure 27 shows the Apomab 7.3 heavy chain amino acid sequence (SEQ ID No.
51).
Figure 28 shows the Apomab 7.3 light chain amino acid sequence (SEQ ID No.52).
Figures 29 show the alignment of 16E2 heavy chain (SEQ ID No. 53) and Apomab 7.3 heavy chain (SEQ ID No. 51) amino acid sequences.
Figure 30 shows the alignment of 16E2 light chain (SEQ ID No. 54) and Apomab 7.3 light chain (SEQ
ID No. 52) amino acid sequences.
Figures 31A and 31B depict the variable heavy amino acid sequence (Fig. 31A;
SEQ ID No. 55) and variable light amino acid sequence (Fig. 31B; SEQ ID No. 56) of Apomab 7.3.
CDR residues are identified in bold.
Clin. Oncol. 14:737-744 (1996)). Trastuzumab received marketing approval from the Food and Drug Administration September 25, 1998 for the treatment of patients with metastatic breast cancer whose tumors overexpress the HER2 protein.
Other HER2 antibodies with various properties have been described in Tagliabue et al. Int. J. Cancer 47:933-937 (1991); McKenzie et al. Oncogene 4:543-548 (1989); Maier et al.
Cancer Res. 51:5361-5369 (1991);
Bacus et al. Molecular Carcinogenesis 3:350-362 (1990); Stancovski et al. PNAS
(USA) 88:8691-8695 (1991);
Bacus et al. Cancer Research 52:2580-2589 (1992); Xu et al. Int. J. Cancer 53:401-408 (1993); W094/00136;
Kasprzyk et al. Cancer Research 52:2771-2776 (1992);Hancock et al. Cancer Res.
51:4575-4580 (1991);
Shawver et al. Cancer Res. 54:1367-1373 (1994); Arteaga et al. Cancer Res.
54:3758-3765 (1994); Harwerth et al. J. Biol. Chem. 267:15160-15167 (1992); U.S. Patent No. 5,783,186; and Klapper et cal. Oncogene 14:2099-2109 (1997).
Homology screening has resulted in the identification of two other HER
receptor family members;
HER3 (US Pat. Nos. 5,183,884 and 5,480,968 as well as Kraus et al. PNAS (USA) 86:9193-9197 (1989)) and HER4 (EP Pat Appln No 599,274; Plowman et al., Proc. Natl. Acad. Sci. USA, 90:1746-1750 (1993); and Plowman et al., Nature, 366:473-475 (1993)). Both of these receptors display increased expression on at least some breast cancer cell lines.
The HER receptors are generally found in various combinations in cells and heterodimerization is thought to increase the diversity of cellular responses to a variety of HER
ligands (Earp et al. Breast Cancer Research and Treatment 35: 115-132 (1995)). EGFR is bound by six different ligands; epidermal growth factor (EGF), transforming growth factor alpha (TGF-a), amphiregulin, heparin binding epidermal growth factor (HB-EGF), betacellulin and epiregulin (Groenen et al. Growth Factors 11:235-257 (1994)). A family of heregulin proteins resulting from alternative splicing of a single gene are ligands for HER3 and HER4. The heregulin family includes alpha, beta and gamma heregulins (Holmes et al., Science, 256:1205-1210 (1992); U.S. Patent No. 5,641,869; and Schaefer et al. Oncogene 15:1385-1394 (1997)); neu differentiation factors (NDFs), glial growth factors (GGFs); acetylcholine receptor inducing activity (ARIA); and sensory and motor neuron derived factor (SMDF). For a review, see Groenen et al. Growth Factors 11:235-257 (1994); Lernke, G. Molec. & Cell.
Neurosci. 7:247-262 (1996) and Lee et al. Pharm. Rev. 47:51-85 (1995).
Recently three additional HER ligands were identified; neuregulin-2 (NRG-2) which is reported to bind either HER3 or HER4 (Chang et al. Nature 387 509-512 (1997); and Carraway et al Nature 387:512-516 (1997)); neuregulin-3 which binds HER4 (Zhang et al.
PNAS (USA) 94(18):9562-7 (1997)); and neuregulin-4 which binds HER4 (Harari et al. Oncogene 18:2681-89 (1999)) HB-EGF, betacellulin and epiregulin also bind to HER4.
While EGF and TGFa do not bind HER2, EGF stimulates EGFR and HER2 to form a heterodimer, which activates EGFR and results in transphosphorylation of HER2 in the heterodimer_ Dimerization and/or transphosphorylation appears to activate the HER2 tyrosine kinase. See Earp et al., supra. Likewise, when HER3 is co-expressed with HER2, an active signaling complex is formed and antibodies directed against HER2 are capable of disrupting this complex (Sliwkowski et al., J. Biol. Chem., 269(20): 14661-14665 (1994)).
Additionally, the affinity of HER3 for heregulin (HRG) is increased to a higher affinity state when co-expressed with HER2. See also, Levi et al., Journal of Neuroscience 15: 1329-1340 (1995); Morrissey et al., Proc. Natl.
Acad. Sci. USA 92: 1431-1435 (1995); and Lewis et al., Cancer Res., 56:1457-1465 (1996) with respect to the:
HER2-HER3 protein complex. HER4, like HER3, forms an active signaling complex with HER2 (Carraway and Cantley, Cell 78:5-8 (1994)).
To target the HER signaling pathway, rhuMAb 2C4 (Pertuzumab, OMNITARGTM) was developed as a.
humanized antibody that inhibits the dimerization of HER2 with other HER
receptors, thereby inhibiting ligand-driven phosphorylation and activation, and downstream activation of the RAS
and AKT pathways. In a phase I
trial of Pertuzumab as a single agent for treating solid tumors, 3 subjects with advanced ovarian cancer were treated with Pertuzumab. One had a durable partial response, and an additional subject had stable disease for 15 weeks Agus et al. Proc Am Soc Clin Oncol 22: 192, Abstract 771 (2003).
DR5 Antibodies Various ligands and receptors belonging to the tumor necrosis factor (TNF) superfamily have been identified in the art. Included among such ligands are tumor necrosis factor-alpha ("TNF-alpha"), tumor necrosis factor-beta ("TNF-beta" or "lymphotoxin-alpha"), lymphotoxin-beta ("LT-beta"), CD30 ligand, CD27 ligand, CD40 ligand, OX-40 ligand, 4-1BB ligand, LIGHT, Apo-1 ligand (also referred to as Fas ligand or CD95 ligand), Apo-2 ligand (also referred to as Apo2L or TRAIL), Apo-3 ligand (also referred to as TWEAK), APRIL, OPG ligand (also referred to as RANK ligand, ODF, or TRANCE), and TALL-1 (also referred to as B1yS, BAFF or THANK) (See, e.g., Ashkenazi, Nature Review, 2:420-430 (2002); Ashkenazi and Dixit, Science, 281:1305-1308 (1998); Ashkenazi and Dixit, Curr. Opin. Cell Biol., 11:255-260 (2000); Golstein, Curr. Biol., 7:750-753 (1997) Wallach, Cytol;ine Reference, Academic Press, 2000, pages 377-411; Locksley et al., Cell, 104:487-501 (2001); Gruss and Dower, Blood, 85:3378-3404 (1995); Schmid et al., Proc. Natl. AcacL Sci., 83:1881 (1986); Dealtry et al., Eur. J. Immunol., 17:689 (1987); Pitti et al., J. Biol. Chem., 271:12687-12690 (1996); Wiley et aL, Immunity, 3:673-682 (1995);
Browning et aL, Cell, 72:847-856 (1993); Armitage et al. Nature, 357:80-82 (1992), WO 97/01633 published January 16, 1997; WO 97/25428 published July 17, 1997; Marsters et al., Curr.
Biol., 8:525-528 (1998);
Chicheportiche et al., Biol. Chem., 272:32401-32410 (1997); Hahne et al., J.
Exp. Med., 188:1185-1190 (1998);
W098/28426 published July 2, 1998; W098/46751 published October 22, 1998;
WO/98/18921 published May 7, 1998; Moore et al., Science, 285:260-263 (1999); Shu et al., J. Leukocyte Biol., 65:680 (1999); Schneider et al., J.
Exp. Med., 189:1747-1756 (1999); Mukhopadhyay et al., J, Biol. Chem., 274:15978-15981 (1999)).
Induction of various cellular responses mediated by such TNF family ligands is typically initiated by their binding to specific cell receptors. Some, but not all, TNF family ligands bind to, and induce various biological activity through, cell surface "death receptors" to activate caspases, or enzymes that carry out the cell death or apoptosis pathway (Salvesen et al., Cell, 91:443-446 (1997)). Included among the members of the TNF receptor superfamily identified to date are TNFRI, TNFR2, TACI, GITR,, CD27, OX-40, CD30, CD40, HVEM, Fas (also referred to as Apo-1 or CD95), DR4 (also referred to as TRAIL-Rl), DR5 (also referred to as Apo-2 or TRAIL-R2), DcRl, DcR2, osteoprotegerin (OPG), RANK and Apo-3 (also referred to as DR3 or TRAMP).
Most of these TNF receptor family members share the typical structure of cell surface receptors including extracellular, transmembrane and intracellular regions, while others are found naturally as soluble proteins lacking a transmembrane and intracellular domain. The extracellular portion of typical TNFRs contains a repetitive amino acid sequence pattern of multiple cysteine-rich domains (CRDs), starting from the NH2-terminus.
The ligand referred to as Apo-2L or TRAIL was identified several years ago as a member of the TNF
family of cytokines. (see, e.g., Wiley et al., Immunity, 3:673-682 (1995);
Pitti et al., J. Biol. Chem., 271:12697-12690 (1996); WO 97/01633; WO 97/25428; US Patent 5,763,223 issued June 9, 1998; US Patent 6,284,236 issued September 4, 2001). The full-length native sequence human Apo2L/TRAIL
polypeptide is a 281 amino acid long, Type II transmembrane protein. Some cells can produce a natural soluble form of the polypeptide, through enzymatic cleavage of the polypeptide's extracellular region (Mariani et al., J. Cell. Biol., 137:221-229 (1997)). Crystallographic studies of soluble forms of Apo2L/TRAIL reveal a homotrimeric structure similar to the structures of TNF and other related proteins (Hymowitz et al., Molec_ Cell, 4:563-571 (1999); Cha et al., Immunity, 11:253-261 (1999); Mongkolsapaya et al., Nature Structural Biology, 6:1048 (1999); Hymowitz et al., Biochemistry, 39:633-644 (2000)). Apo2L/TRAIL, unlike other TNF faa-idly members however, was found to have a unique structural feature in that three cysteine residues (at position 230 of each subunit in the homotrimer) together coordinate a zinc atom, and that the zinc binding is important for trimer stability and biological activity.
(Hymowitz et al., supra; Bodmer et al., J. Biol. Chen., 275:20632-20637 (2000)).
It has been reported in the literature that Apo2L/TRAIL may play a role in immune system modulation, including autoimmune diseases such as rheumatoid arthritis (see, e.g., Thomas et al., J. Immunol., 161:2195-2200 (1998); Johnsen et al., Cytokine, 11:664-672 (1999); Griffith et al., J.
Exp. Med., 189:1343-1353 (1999);
Song et al., J. Exp. Med., 191:1095-1103 (2000)).
Soluble forms of Apo2L/TRAIL have also been reported to induce apoptosis in a variety of cancer cells, including colon, lung, breast, prostate, bladder, kidney, ovarian and brain tumors, as well as melanoma, leukemia, and multiple myeloma (see, e.g., Wiley et al., supra; Pitti et al., supra; US
Patent 6,030,945 issued February 29, 2000; US Patent 6,746,668 issued June 8, 2004; Rieger et al., FEBS Letters, 427:124-128 (1998); Ashkenazi et al., J. Clin. Invest., 104:155-162 (1999); Walczak et al., Nature Med., 5:257-163 (1999); Keane et al., Cancer Research, 59:734-741 (1999); Mizutani et al., Clin. Cancer Res., 5:2605-2612 (1999); Gazitt, Leukemia, 13:1817-1824 (1999); Yu et al., Cancer Res., 60:2384-2389 (2000); Chirinaiyan et al., Proc. Natl. Acad. Sci., 97:1754-1759 (2000)). In vivo studies in murine tumor models further suggest that Apo2L/TRAIL, alone or in combination with chemotherapy or radiation therapy, can exert substantial anti-tumor effects (see, e.g., Ashkenazi et al., supra; Walzcak et al., supra; Gliniak et al., Cancer Res., 59:6153-6158 (1999); Chinnaiyan et al., supra; Roth et al., Biochem. Biophys. Res. Comin., 265:1999 (1999); PCT
Application US/00/15512; PCT
Application US/01/23691). In contrast to many types of cancer cells, most normal human cell types appear to be resistant to apoptosis induction by certain recombinant forms of Apo2L/TRAIL
(Ashkenazi et al., supra;
Walzcak et al., supra). Jo et al. has reported that a polyhistidine-tagged soluble form of Apo2L/TRAIL induced apoptosis in vitro in normal isolated human, but not non-human, hepatocytes (Jo et al., Nature Med., 6:564-567 (2000); see also, Nagata, Nature Med., 6:502-503 (2000)). It is believed that certain recombinant Apo2L/TRAIL
preparations may vary in terms of biochemical properties and biological activities on diseased versus normal cells, depending, for example, on the presence or absence of a tag molecule, zinc content, and % trimer content (See, Lawrence et al., Nature Med., Letter to the Editor, 7:383-385 (2001);
Qin et al., Nature Med., Letter to the Editor, 7:385-386 (2001)).
Apo2L/TRAIL has been found to bind at least five different receptors. At least two of the receptors which bind Apo2L/TRAIL contain a functional, cytoplasmic death domain. One such receptor has been referred to as "DR4" (and alternatively as TR4 or TRAIL-R1) (Pan et al., Science, 276:111-113 (1997); see also W098/32856 published July 30, 1998; W099/37684 published July 29, 1999; WO
00/73349 published December 7, 2000; US 6,433,147 issued August 13, 2002; US 6,461,823 issued October 8, 2002, and US
6,342,383 issued January 29, 2002).
Another such receptor for Apo2L/TRAIL has been referred to as DR5 (it has also been alternatively referred to as Apo-2; TRAIL-R or TRAIL-R2, TR6, Tango-63, hAPO8, TRICK2 or KILLER) (see, e.g., Sheridan et at., Science, 277:818-821 (1997), Pan et al., Science, 277:815-818 (1997), W098/51793 published November 19, 1998; W098/41629 published September 24, 1998; Screaton et al., Curr. Biol., 7:693-696 (1997);
Walczak et al., EMBO J., 16:5386-5387 (1997); Wu et al., Nature Genetics, 17:141-143 (1997); W098/35986 published August 20, 1998; EP870,827 published October 14, 1998; W098/46643 published October 22, 1998;
W099/02653 published January 21, 1999; W099/09165 published February 25, 1999;
W099/11791 published March 11, 1999; US 2002/0072091 published August 13, 2002; US 2002/0098550 published December 7, 2001;
US 6,313,269 issued December 6, 2001; US 2001/0010924 published August 2, 2001; US 2003/01255540 published July 3, 2003; US 2002/0160446 published October 31, 2002, US
2002/0048785 published April 25, 2002; US 6,342,369 issued February, 2002; US 6,569,642 issued May 27, 2003, US
6,072,047 issued June 6, 2000, US 6,642,358 issued November 4, 2003; IS 6,743,625 issued June 1, 2004).
Like DR4, DR-5 is reported to contain a cytoplasmic death domain and be capable of signaling apoptosis upon ligand binding (or upon binding a molecule, such as an agonist antibody, which mimics the activity of the ligand). The crystal structure of the complex formed between Apo-2L/TRAIL and DR5 is described in Hymowitz et al., Moleculczr Cell, 4:563-571 (1999).
Upon ligand binding, both DR4 and DR5 can trigger apoptosis independently by recruiting and activating the apoptosis initiator, caspase-8, through the death-domain-containing adaptor molecule referred to as FADD/Mortl (Kischkel et al., Immunity, 12:611-620 (2000); Sprick et al., Immunity, 12:599-609 (2000);
Bodmer et al., Nature Cell Biol., 2:241-243 (2000)).
Apo2L/TRAIL has been reported to also bind those receptors referred to as DcRI, DcR2 and OPG, which believed to function as inhibitors, rather than transducers of signaling (see., e.g., DcR1 (also referred to as TRID, LIT or TRAIL-R3) (Pan et al., Science, 276:111-113 (1997); Sheridan et al., Science, 277:818-821 (1997);
McFarlane et al., J. Biol. Chen., 272:25417-25420 (1997); Schneider et al., FEBS Letters, 416:329-334 (1997);
Degli-Esposti et al., J. Exp. Med., 186:1165-1170 (1997); and Mongkolsapaya et al., J. Erninunol., 160:3-6 (1998)); DcR2 (also called TRUNDD or TRAIL-R4) (Marsters et al., Curr. Biol., 7:1003-1006 (1997); Pan et al., FEBS Letters, 424:41-45 (1998); Degli-Esposti et at., Immunity, 7:813-820 (1997)), and OPO. In contrast to DR4 and DR5, the DcR1 and DcR2 receptors do not signal apoptosis.
Certain antibodies which bind to the DR4 and/or DR5 receptors have been reported in the literature.
For example, anti-DR4 antibodies directed to the DR4 receptor and having agonistic or apoptotic activity in certain mammalian cells are described in, e.g., WO 99/37684 published July 29, 1999; WO 00/73349 published July 12, 2000; WO 03/066661 published August 14, 2003. See, also, e.g., Griffith et al., J. Iimunol., 162:2597-2605 (1999); Chuntharapai et al., J. Immunol., 166:4891-4898 (2001); WO
02/097033 published December 2, 2002; WO 03/042367 published May 22, 2003; WO 03/038043 published May 8, 2003;
WO 03/037913 published May 8, 2003. Certain anti-DR5 antibodies have likewise been described, see, e.g., WO 98/51793 published November 8, 1998; Griffith et al., J. Immunol., 162:2597-2605 (1999); Ichikawa et al., Nature Med., 7:954-960 (2001); Hylander et al., "An Antibody to DR5 (TRAIL-Receptor 2) Suppresses the Growth of Patient Derived Gastrointestinal Tumors Grown in SCID mice", Abstract, 2d International Congress on Monoclonal Antibodies in Cancers, Aug. 29-Sept. 1, 2002, Banff, Alberta, Canada; WO 03/038043 published May 8, 2003; WO
03/037913 published May 8, 2003. In addition, certain antibodies having cross-reactivity to both DR4 and DR5 receptors have been described (see, e.g., US patent 6,252,050 issued June 26, 2001).
Summary of the Invention The invention herein relates, at least in part, to the identification of histidine-acetate, pH 5.5 to 6.5, as a particularly useful buffer for formulating monoclonal antibodies, especially full length IgGi antibodies which are susceptible to deamidation and/or aggregation. The formulation retards degradation of the antibody product therein.
Thus, in a first aspect, the invention concerns a stable pharmaceutical formulation comprising a monoclonal antibody in histidine-acetate buffer, pH 5.5 to 6.5. The monoclonal antibody preferably binds an antigen selected from the group consisting of HER2, CD20, DR5, BR3, IgE, and VEGF.
In addition, the invention concerns a method of treating a disease or disorder in a subject comprising administering the formulation to a subject in an amount effective to treat the disease or disorder.
In another aspect, the invention concerns a pharmaceutical formulation comprising: (a) a full length IgG1 antibody susceptible to deamidation or aggregation in an amount from about l0mg/mL to about 250mg/mL;
(b) histidine-acetate buffer, pH 5.5 to 6.5; (c) saccharide selected from the group consisting of trehalose and sucrose, in an amount from about 60mM to about 250mM; and (d) polysorbate 20 in an amount from about 0.01% to about 0.1%.
The invention also provides a method for reducing deamidation or aggregation of a therapeutic monoclonal antibody, comprising formulating the antibody in a histidine-acetate buffer, pH 5.5 to 6.5.
In yet a further aspect, the invention concerns a pharmaceutical formulation comprising an antibody that binds to domain II of HER2 in a histidine buffer at a pH from about 5.5 to about 6.5, a saccharide and a surfactant.
The invention also relates to a pharmaceutical formulation comprising Pertuzumab in an amount from about 20mg/mL to about 40mg1mL, histidine-acetate buffer, sucrose, and polysorbate 20, wherein the pH of the formulation is from about 5.5 to about 6.5.
The invention also pertains to a pharmaceutical formulation comprising a DR5 antibody in a histidine buffer at a pH from about 5.5 to about 6.5, a saccharide, and a surfactant.
In another aspect, the invention concerns a pharmaceutical formulation comprising Apomab in an amount from about 10mg/mL to about 30mg/mL, histidine-acetate buffer, trehalose, and polysorbate 20, wherein the pH of the formulation is from about 5.5 to about 6.5.
In yet another aspect, the invention provides a method of treating cancer in a subject, comprising administering the pharmaceutical formulation to the subject in an amount effective to treat the cancer.
The invention also concerns a vial with a stopper pierceable by a syringe or a stainless steel tank comprising the formulation inside the vial or tank, optionally in frozen form.
Moreover, the invention provides a method of making a pharmaceutical formulation comprising: (a) preparing the monoclonal antibody formulation; and (b) evaluating physical stability, chemical stability, or biological activity of the monoclonal antibody in the formulation.
Brief Description of the Drawings Figure 1 depicts Domains I-IV (SEQ ID Nos. 19-22, respectively) of the extracellular domain of HER2.
Figures 2A and 2B depict alignments of the amino acid sequences of the variable light (VL) (Fig. 2A) and variable heavy (VH) (Fig. 2B) domains of murine monoclonal antibody 2C4 (SEQ ID Nos. 1 and 2, respectively); VL and VH domains of humanized 2C4 version 574 (SEQ ID Nos. 3 and 4, respectively), and human VL and VH consensus frameworks (hum xl, light kappa subgroup I; humlll, heavy subgroup III) (SEQ
ID Nos. 5 and 6, respectively). Asterisks identify differences between humanized 2C4 version 574 and murine monoclonal antibody 2C4 or between humanized 2C4 version 574 and the human framework. Complementarity Determining Regions (CDRs) are in brackets.
Figures 3A and 3B show the amino acid sequences of Pertuzumab light chain and heavy chain (SEQ ID
Nos. 15 and 16, respectively). CDRs are shown in bold. Calculated molecular mass of the light chain and heavy chain are 23,526.22 Da and 49,216.56 Da (cysteines in reduced form). The carbohydrate moiety is attached to Asn 299 of the heavy chain.
Figures 4A and 4B show the amino acid sequences of Pertuzumab light and heavy chain, each including an intact amino terminal signal peptide sequence (SEQ ID Nos. 17 and 18, respectively).
Figure 5 depicts, schematically, binding of 2C4 at the heterodimeric binding site of HER2, thereby preventing heterodimerization with activated EGFR or HER3.
Figure 6 depicts coupling of HER2/HER3 to the MAPK and Akt pathways.
Figure 7 compares activities of Trastuzumab and Pertuzumab.
Figure 8 depicts stability of Pertuzumab formulation by ion exchange (IEX) analyses.
Figure 9 shows stability of Pertuzumab formulation by size exclusion chromatography (SEC) analysis.
Figure 10 reflects physical stability Pertuzumab in different formulations.
Figure 11 is from an agitation study of Pertuzumab liquid formulations.
Figure 12 is from another agitation study of Pertuzumab liquid formulations.
Figure 13 is from a freeze-thawing study of Pertuzumab formulation.
Figures 14A and 14B show the amino acid sequences of Trastuzumab light chain (SEQ ID No. 13) and heavy chain (SEQ ID No. 14).
Figures 15A and 15B depict a variant Pertuzumab light chain sequence (SEQ ID
No. 23) and a variant Pertuzumab heavy chain sequence (SEQ ID No. 24).
Figure 16A and 16B shows oligosaccharide structures commonly observed in IgG
antibodies.
Figures 17A and 17B show the sequences of the light and heavy chains (SEQ ID
Nos. 37-44) of specific anti-IgE antibodies E25, E26, HAE1 and Hu-901. In Fig. 17A, the variable light domain ends with the residues VEIK, residue 111. In Fig. 17B, the variable heavy domain ends with the residues VTVSS, around residue 120.
Figure 18A is a sequence alignment comparing the amino acid sequences of the variable light domain (VL) of each of murine 2H7 (SEQ ID No. 25), humanized 2H7v16 variant (SEQ ID
No. 26), and the human kappa light chain subgroup I (SEQ ID No. 27). The CDRs of VL of 2H7 and hu2H7vl6 are as follows: CDRI
(SEQ ID No. 57), CDR2 (SEQ ID No. 58), and CDR3 (SEQ ID No. 59).
Figure 18B is a sequence alignment comparing the amino acid sequences of the variable heavy domain (VH) of each of murine 2H7 (SEQ ID No. 28), humanized 2H7v16 variant (SEQ ID
No. 29), and the human consensus sequence of the heavy chain subgroup III (SEQ ID No. 30). The CDRs of VH of 2H7 and hu2H7v16 are as follows: CDR1 (SEQ ID No. 60), CDR2 (SEQ ID No. 61), and CDR3 (SEQ ID
No. 62).
In Fig. 18A and Fig. 18B, the CDR1, CDR2 and CDR3 in each chain are enclosed within brackets, flanked by the framework regions, FRl-FR4, as indicated. 2H7 refers to murine 2H7 antibody. The asterisks in between two rows of sequences indicate the positions that are different between the two sequences. Residue numbering is according to Kabat et al. Sequences of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991), with insertions shown as a, b, c, d, and e.
Figure 19 depicts variable domain sequences of three different VEGF antibodies with SEQ ID Nos. 31-36.
Figure 20 shows size exclusion chromatography (SEC) elution profile of the following Apomab samples: (a) control and formulations prepared at (b) pH 4.0, (c) pH 5.0, (d) pH 6.0 and (e) pH 7Ø The formulated samples were stored at 40 C for 2 months prior to the analysis.
Figure 21 depicts pH rate profile for the loss in Apomab antibody monomer during storage. Monomer kinetics by SEC was monitored during storage at 30 C and 40 C and the first-order rate constants were calculated.
Figure 22 provides ion exchange chromatography (IEC) elution profile of Apomab samples as follows:
(a) control and formulations prepared at (b) pH 4.0, (c) pH 5.0, (d) pH 6.0 and (e) pH 7Ø The formulated samples were stored at 40 C for 2 months prior to the analysis.
Figure 23 shows pH rate profile for the loss in IEC main peak during storage.
Main peak kinetics by IEC was monitored during storage at 30 C and 40 C and the first-order rate constants were calculated.
Figure 24 shows the nucleotide sequence of human Apo-2 ligand cDNA (SEQ ID No.
45) and its derived amino acid sequence (SEQ ID No. 46). The "N" at nucleotide position 447 (in SEQ ID No. 45) is used to indicate the nucleotide base may be a "T" or "G".
Figures 25A and 25B show the 411 amino acid sequence of human DR5 receptor (SEQ ID No. 47) as published in WO 98/51793 on November 19, 1998, and the encoding nucleotide sequence (SEQ ID No. 48).
Figures 26A and 26B show the 440 amino acid sequence of human DR5 receptor (SEQ ID No. 49) and the encoding nucleotide sequence (SEQ ID No. 50), as also published in WO
98/35986 on August 20, 1998.
Figure 27 shows the Apomab 7.3 heavy chain amino acid sequence (SEQ ID No.
51).
Figure 28 shows the Apomab 7.3 light chain amino acid sequence (SEQ ID No.52).
Figures 29 show the alignment of 16E2 heavy chain (SEQ ID No. 53) and Apomab 7.3 heavy chain (SEQ ID No. 51) amino acid sequences.
Figure 30 shows the alignment of 16E2 light chain (SEQ ID No. 54) and Apomab 7.3 light chain (SEQ
ID No. 52) amino acid sequences.
Figures 31A and 31B depict the variable heavy amino acid sequence (Fig. 31A;
SEQ ID No. 55) and variable light amino acid sequence (Fig. 31B; SEQ ID No. 56) of Apomab 7.3.
CDR residues are identified in bold.
Figure 32 shows an alignment of the mature 2H7v16 and 2H7v511 light chains (SEQ ID Nos. 63 and 64, respectively). Sequences shown with Kabat variable domain residue numbering and Eu constant domain residue numbering.
Figure 33 shows an alignment of the the mature 2H7v16 and 2H7v511 heavy chains (SEQ ID Nos. 65 and 66, respectively). Sequences shown with Kabat variable domain residue numbering and Eu constant domain residue numbering.
Detailed Description of the Preferred Embodiments 1. Definitions The term "pharmaceutical formulation" refers to a preparation which is in such form as to permit the biological activity of the active ingredient to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered. Such formulations are sterile.
A "sterile" formulation is asceptic or free from all living microorganisms and their spores.
Herein, a "frozen" formulation is one at a temperature below OOC. Generally, the frozen formulation is not freeze-dried, nor is it subjected to prior, or subsequent, lyophilization.
Preferably, the frozen formulation comprises frozen drug substance for storage (in stainless steel tank) or frozen drug product (in final vial configuration).
A "stable" formulation is one in which the protein therein essentially retains its physical stability and/or chemical stability and/or biological activity upon storage. Preferably, the formulation essentially retains its physical and chemical stability, as well as its biological activity upon storage. The storage period is generally selected based on the intended shelf-life of the formulation. Various analytical techniques for measuring protein stability are available in the art and are reviewed in Peptide and Protein Drug Delivery, 247-301, Vincent Lee Ed., Marcel Dekker, Inc., New York, New York, Pubs. (1991) and Jones, A. Adv.
Drug Delivery Rev. 10: 29-90 (1993), for example. Stability can be measured at a selected temperature for a selected time period. Preferably, the formulation is stable at about 40'C for at least about 2-4 weeks, and/or stable at about 5 C and/or 15 C for at least 3 months, and/or stable at about -20 C for at least 3 months or at least 1 year. Furthermore, the formulation is preferably stable following freezing (to, e.g., -70 C) and thawing of the formulation, for example following 1, 2 or 3 cycles of freezing and thawing. Stability can be evaluated qualitatively and/or quantitatively in a variety of different ways, including evaluation of aggregate formation (for example using size exclusion chromatography, by measuring turbidity, and/or by visual inspection); by assessing charge heterogeneity using cation exchange chromatography or capillary zone electrophoresis; amino-terminal or carboxy-terminal sequence analysis; mass spectrometric analysis; SDS-PAGE analysis to compare reduced and intact antibody;
peptide map (for example tryptic or LYS-C) analysis; evaluating biological activity or antigen binding function of the antibody; etc. Instability may involve any one or more of: aggregation, deamidation (e.g. Asn deamidation), oxidation (e.g. Met oxidation), isomerization (e.g. Asp isomeriation), clipping/hydrolysis/fragmentation (e.g. hinge region fragmentation), succinimide formation, unpaired cysteine(s), N-terminal extension, C-terminal processing, glycosylation differences, etc.
Figure 33 shows an alignment of the the mature 2H7v16 and 2H7v511 heavy chains (SEQ ID Nos. 65 and 66, respectively). Sequences shown with Kabat variable domain residue numbering and Eu constant domain residue numbering.
Detailed Description of the Preferred Embodiments 1. Definitions The term "pharmaceutical formulation" refers to a preparation which is in such form as to permit the biological activity of the active ingredient to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered. Such formulations are sterile.
A "sterile" formulation is asceptic or free from all living microorganisms and their spores.
Herein, a "frozen" formulation is one at a temperature below OOC. Generally, the frozen formulation is not freeze-dried, nor is it subjected to prior, or subsequent, lyophilization.
Preferably, the frozen formulation comprises frozen drug substance for storage (in stainless steel tank) or frozen drug product (in final vial configuration).
A "stable" formulation is one in which the protein therein essentially retains its physical stability and/or chemical stability and/or biological activity upon storage. Preferably, the formulation essentially retains its physical and chemical stability, as well as its biological activity upon storage. The storage period is generally selected based on the intended shelf-life of the formulation. Various analytical techniques for measuring protein stability are available in the art and are reviewed in Peptide and Protein Drug Delivery, 247-301, Vincent Lee Ed., Marcel Dekker, Inc., New York, New York, Pubs. (1991) and Jones, A. Adv.
Drug Delivery Rev. 10: 29-90 (1993), for example. Stability can be measured at a selected temperature for a selected time period. Preferably, the formulation is stable at about 40'C for at least about 2-4 weeks, and/or stable at about 5 C and/or 15 C for at least 3 months, and/or stable at about -20 C for at least 3 months or at least 1 year. Furthermore, the formulation is preferably stable following freezing (to, e.g., -70 C) and thawing of the formulation, for example following 1, 2 or 3 cycles of freezing and thawing. Stability can be evaluated qualitatively and/or quantitatively in a variety of different ways, including evaluation of aggregate formation (for example using size exclusion chromatography, by measuring turbidity, and/or by visual inspection); by assessing charge heterogeneity using cation exchange chromatography or capillary zone electrophoresis; amino-terminal or carboxy-terminal sequence analysis; mass spectrometric analysis; SDS-PAGE analysis to compare reduced and intact antibody;
peptide map (for example tryptic or LYS-C) analysis; evaluating biological activity or antigen binding function of the antibody; etc. Instability may involve any one or more of: aggregation, deamidation (e.g. Asn deamidation), oxidation (e.g. Met oxidation), isomerization (e.g. Asp isomeriation), clipping/hydrolysis/fragmentation (e.g. hinge region fragmentation), succinimide formation, unpaired cysteine(s), N-terminal extension, C-terminal processing, glycosylation differences, etc.
A "deamidated" monoclonal antibody herein is one in which one or more asparagine residue thereof has been derivitized, e.g. to an aspartic acid or an iso-aspartic acid.
An antibody which is "susceptible to deamidation" is one comprising one or more residue which has been found to be prone to deamidate.
An antibody which is "susceptible to aggregation" is one which has been found to aggregate with other antibody molecule(s), especially upon freezing and/or agitation.
An antibody which is "susceptible to fragmentation' 'is one which has been found to be cleaved into two or more fragments, for example at a hinge region thereof.
By "reducing deamidation, aggregation, or fragmentation" is intended preventing or decreasing the amount of deamidation, aggregation, or fragmentation relative to the monoclonal antibody formulated at a different pH or in a different buffer.
Herein, "biological activity" of a monoclonal antibody refers to the ability of the antibody to bind to antigen and result in a measurable biological response which can be measured in vitro or in vivo. Such activity may be antagonistic (for example where the antibody is a HER2 antibody) or agonistic (for instance where the antibody binds DR5). In the case of Pertuzumab, in one embodiment, the biological activity refers to the ability of the formulated antibody to inhibit proliferation of the human breast cancer cell line MDA-MB-175-VII.
Where the antibody is Apomab, the biological activity can refer, for example, to the ability of the formulated antibody to kill colon carcinoma, Colo205, cells.
By "isotonic" is meant that the formulation of interest has essentially the same osmotic pressure as human blood. Isotonic formulations will generally have an osmotic pressure from about 250 to 350mOsm.
Isotonicity can be measured using a vapor pressure or ice-freezing type osmometer, for example.
As used herein, "buffer" refers to a buffered solution that resists changes in pH by the action of its acid-base conjugate components. The buffer of this invention preferably has a pH in the range from about 5.0 to about 7.0, preferably from about 5.5 to about 6.5, for example from about 5.8 to about 6.2, and most preferably has a pH of about 6Ø Examples of buffers that will control the pH in this range include acetate, succinate, succinate, gluconate, histidine, citrate, glycylglycine and other organic acid buffers. The preferred buffer herein is a histidine buffer.
A "histidine buffer" is a buffer comprising histidine ions. Examples of histidine buffers include histidine chloride, histidine acetate, histidine phosphate, histidine sulfate.
The preferred histidine buffer identified in the examples herein was found to be histidine acetate. In the preferred embodiment, the histidine acetate buffer is prepared by titrating L-histidine (free base, solid) with acetic acid (liquid). Preferably, the histidine buffer or histidine-acetate buffer is at pH 5.5 to 6.5, preferably pH 5.8 to 6.2.
A "saccharide" herein comprises the general composition (CH2O)n and derivatives thereof, including monosaccharides, disaccharides, trisaccharides, polysaccharides, sugar alcohols, reducing sugars, nonreducing sugars, etc. Examples of saccharides herein include glucose, sucrose, trehalose, lactose, fructose, maltose, dextran, glycerin, dextran, erythritol, glycerol, arabitol, sylitol, sorbitol, mannitol, mellibiose, melezitose, raffinose, mannotriose, stachyose, maltose, lactulose, maltulose, glucitol, maltitol, lactitol, iso-maltulose, etc.
The preferred saccharide herein is a nonreducing disaccharide, such as trehalose or sucrose.
Herein, a "surfactant' 'refers to a surface-active agent, preferably a nonionic surfactant. Examples of surfactants herein include polysorbate (for example, polysorbate 20 and, polysorbate 80); poloxamer (e.g.
An antibody which is "susceptible to deamidation" is one comprising one or more residue which has been found to be prone to deamidate.
An antibody which is "susceptible to aggregation" is one which has been found to aggregate with other antibody molecule(s), especially upon freezing and/or agitation.
An antibody which is "susceptible to fragmentation' 'is one which has been found to be cleaved into two or more fragments, for example at a hinge region thereof.
By "reducing deamidation, aggregation, or fragmentation" is intended preventing or decreasing the amount of deamidation, aggregation, or fragmentation relative to the monoclonal antibody formulated at a different pH or in a different buffer.
Herein, "biological activity" of a monoclonal antibody refers to the ability of the antibody to bind to antigen and result in a measurable biological response which can be measured in vitro or in vivo. Such activity may be antagonistic (for example where the antibody is a HER2 antibody) or agonistic (for instance where the antibody binds DR5). In the case of Pertuzumab, in one embodiment, the biological activity refers to the ability of the formulated antibody to inhibit proliferation of the human breast cancer cell line MDA-MB-175-VII.
Where the antibody is Apomab, the biological activity can refer, for example, to the ability of the formulated antibody to kill colon carcinoma, Colo205, cells.
By "isotonic" is meant that the formulation of interest has essentially the same osmotic pressure as human blood. Isotonic formulations will generally have an osmotic pressure from about 250 to 350mOsm.
Isotonicity can be measured using a vapor pressure or ice-freezing type osmometer, for example.
As used herein, "buffer" refers to a buffered solution that resists changes in pH by the action of its acid-base conjugate components. The buffer of this invention preferably has a pH in the range from about 5.0 to about 7.0, preferably from about 5.5 to about 6.5, for example from about 5.8 to about 6.2, and most preferably has a pH of about 6Ø Examples of buffers that will control the pH in this range include acetate, succinate, succinate, gluconate, histidine, citrate, glycylglycine and other organic acid buffers. The preferred buffer herein is a histidine buffer.
A "histidine buffer" is a buffer comprising histidine ions. Examples of histidine buffers include histidine chloride, histidine acetate, histidine phosphate, histidine sulfate.
The preferred histidine buffer identified in the examples herein was found to be histidine acetate. In the preferred embodiment, the histidine acetate buffer is prepared by titrating L-histidine (free base, solid) with acetic acid (liquid). Preferably, the histidine buffer or histidine-acetate buffer is at pH 5.5 to 6.5, preferably pH 5.8 to 6.2.
A "saccharide" herein comprises the general composition (CH2O)n and derivatives thereof, including monosaccharides, disaccharides, trisaccharides, polysaccharides, sugar alcohols, reducing sugars, nonreducing sugars, etc. Examples of saccharides herein include glucose, sucrose, trehalose, lactose, fructose, maltose, dextran, glycerin, dextran, erythritol, glycerol, arabitol, sylitol, sorbitol, mannitol, mellibiose, melezitose, raffinose, mannotriose, stachyose, maltose, lactulose, maltulose, glucitol, maltitol, lactitol, iso-maltulose, etc.
The preferred saccharide herein is a nonreducing disaccharide, such as trehalose or sucrose.
Herein, a "surfactant' 'refers to a surface-active agent, preferably a nonionic surfactant. Examples of surfactants herein include polysorbate (for example, polysorbate 20 and, polysorbate 80); poloxamer (e.g.
poloxamer 188); Triton; sodium dodecyl sulfate (SDS); sodium laurel sulfate;
sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl-sulfobetaine; lauryl-, myristyl-, linoleyl-or stearyl-sarcosine; linoleyl-, myristyl-, or cetyl-betaine; lauroamidopropyl-, cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-betaine (e.g. lauroamidopropyl); myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-dimethylamine; sodium methyl cocoyl-, or disodium methyl oleyl-taurate; and the MONAQUATTM series (Mona Industries, Inc., Paterson, New Jersey); polyethyl glycol, polypropyl glycol, and copolymers of ethylene and propylene glycol (e.g. Pluronics, PF68 etc); etc.
The preferred surfactant herein is polysorbate 20.
A "HER receptor" is a receptor protein tyrosine kinase which belongs to the HER receptor family and includes EGFR, HER2, HER3 and HER4 receptors and other members of this family to be identified in the future. The HER receptor will generally comprise an extracellular domain, which may bind an HER ligand; a lipophilic transmembrane domain; a conserved intracellular tyrosine kinase domain; and a carboxyl-terminal signaling domain harboring several tyrosine residues which can be phosphorylated. Preferably the HER receptor is native sequence human HER receptor.
The extracellular domain of HER2 comprises four domains, Domain I (amino acid residues from about 1-195), Domain II (amino acid residues from about 196-320), Domain III (amino acid residues from about 321-488), and Domain IV (amino acid residues from about 489-632) (residue numbering without signal peptide).
See Garrett et at Mol. Cell.. 11: 495-505 (2003), Cho et at Nature 421: 756-760 (2003), Franklin et at Cancer Cell 5:317-328 (2004), or Plowman et at Proc. Natl. Acad. Sci. 90:1746-1750 (1993). See also Fig. 1 herein.
The terms "ErbBI," "HER1", "epidermal growth factor receptor" and "EGFR" are used interchangeably herein and refer to EGFR as disclosed, for example, in Carpenter et al. Ann.
Rev. Biochein. 56:881-914 (1987), including naturally occurring mutant forms thereof (e.g. a deletion mutant EGFR as in Humphrey et at PNAS
(USA) 87:4207-4211 (1990)). erbB 1 refers to the gene encoding the EGFR
protein product.
The expressions "ErbB2" and "HER2" are used interchangeably herein and refer to human HER2 protein described, for example, in Semba et al., PNAS (USA) 82:6497-6501 (1985) and Yamamoto et at Nature 319:230-234 (1986) (Genebank accession number X03363). The term "erbB2" refers to the gene encoding human ErbB2 and " neu" refers to the gene encoding rat p185"'" Preferred HER2 is native sequence human HER2.
"ErbB3" and "HERS" refer to the receptor polypeptide as disclosed, for example, in US Pat. Nos.
5,183,884 and 5,480,968 as well as Kraus et at PNAS (USA) 86:9193-9197 (1989).
The terms "ErbB4" and "HER4" herein refer to the receptor polypeptide as disclosed, for example, in EP Pat Appln No 599,274; Plowman et at, Proc. Natl. Acad. Sci. USA, 90:1746-1750 (1993); and Plowman et at, Nature, 366:473-475 (1993), including isoforms thereof, e.g., as disclosed in W099/19488, published April 22, 1999.
By "HER ligand" is meant a polypeptide which binds to and/or activates a HER
receptor. The HER
ligand of particular interest herein is a native sequence human HER ligand such as epidermal growth factor (EGF) (Savage et at, J. Biol. Chem. 247:7612-7621 (1972)); transforming growth factor alpha (TGF-a) (Marquardt et at, Science 223:1079-1082 (1984)); amphiregulin also known as schwanoma or keratinocyte autocrine growth factor (Shoyab et at Science 243:1074-1076 (1989); Kimura et at Nature 348:257-260 (1990);
and Cook et at Mol. Cell. Biol. 11:2547-2557 (1991)); betacellulin (Shing et at, Science 259:1604-1607 (1993);
sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl-sulfobetaine; lauryl-, myristyl-, linoleyl-or stearyl-sarcosine; linoleyl-, myristyl-, or cetyl-betaine; lauroamidopropyl-, cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-betaine (e.g. lauroamidopropyl); myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-dimethylamine; sodium methyl cocoyl-, or disodium methyl oleyl-taurate; and the MONAQUATTM series (Mona Industries, Inc., Paterson, New Jersey); polyethyl glycol, polypropyl glycol, and copolymers of ethylene and propylene glycol (e.g. Pluronics, PF68 etc); etc.
The preferred surfactant herein is polysorbate 20.
A "HER receptor" is a receptor protein tyrosine kinase which belongs to the HER receptor family and includes EGFR, HER2, HER3 and HER4 receptors and other members of this family to be identified in the future. The HER receptor will generally comprise an extracellular domain, which may bind an HER ligand; a lipophilic transmembrane domain; a conserved intracellular tyrosine kinase domain; and a carboxyl-terminal signaling domain harboring several tyrosine residues which can be phosphorylated. Preferably the HER receptor is native sequence human HER receptor.
The extracellular domain of HER2 comprises four domains, Domain I (amino acid residues from about 1-195), Domain II (amino acid residues from about 196-320), Domain III (amino acid residues from about 321-488), and Domain IV (amino acid residues from about 489-632) (residue numbering without signal peptide).
See Garrett et at Mol. Cell.. 11: 495-505 (2003), Cho et at Nature 421: 756-760 (2003), Franklin et at Cancer Cell 5:317-328 (2004), or Plowman et at Proc. Natl. Acad. Sci. 90:1746-1750 (1993). See also Fig. 1 herein.
The terms "ErbBI," "HER1", "epidermal growth factor receptor" and "EGFR" are used interchangeably herein and refer to EGFR as disclosed, for example, in Carpenter et al. Ann.
Rev. Biochein. 56:881-914 (1987), including naturally occurring mutant forms thereof (e.g. a deletion mutant EGFR as in Humphrey et at PNAS
(USA) 87:4207-4211 (1990)). erbB 1 refers to the gene encoding the EGFR
protein product.
The expressions "ErbB2" and "HER2" are used interchangeably herein and refer to human HER2 protein described, for example, in Semba et al., PNAS (USA) 82:6497-6501 (1985) and Yamamoto et at Nature 319:230-234 (1986) (Genebank accession number X03363). The term "erbB2" refers to the gene encoding human ErbB2 and " neu" refers to the gene encoding rat p185"'" Preferred HER2 is native sequence human HER2.
"ErbB3" and "HERS" refer to the receptor polypeptide as disclosed, for example, in US Pat. Nos.
5,183,884 and 5,480,968 as well as Kraus et at PNAS (USA) 86:9193-9197 (1989).
The terms "ErbB4" and "HER4" herein refer to the receptor polypeptide as disclosed, for example, in EP Pat Appln No 599,274; Plowman et at, Proc. Natl. Acad. Sci. USA, 90:1746-1750 (1993); and Plowman et at, Nature, 366:473-475 (1993), including isoforms thereof, e.g., as disclosed in W099/19488, published April 22, 1999.
By "HER ligand" is meant a polypeptide which binds to and/or activates a HER
receptor. The HER
ligand of particular interest herein is a native sequence human HER ligand such as epidermal growth factor (EGF) (Savage et at, J. Biol. Chem. 247:7612-7621 (1972)); transforming growth factor alpha (TGF-a) (Marquardt et at, Science 223:1079-1082 (1984)); amphiregulin also known as schwanoma or keratinocyte autocrine growth factor (Shoyab et at Science 243:1074-1076 (1989); Kimura et at Nature 348:257-260 (1990);
and Cook et at Mol. Cell. Biol. 11:2547-2557 (1991)); betacellulin (Shing et at, Science 259:1604-1607 (1993);
and Sasada et al. Biochem. Biophys. Res. Commun. 190:1173 (1993)); heparin-binding epidermal growth factor (HB-EGF) (Higashiyama et al., Science 251:936-939 (1991)); epiregulin (Toyoda et al., J. Biol. Chem.
270:7495-7500 (1995); and Komurasaki et al. Oncogene 15:2841-2848 (1997,); a heregulin (see below);
neuregulin-2 (NRG-2) (Carraway et al., Nature 387:512-516 (1997)); neuregu.lin-3 (NRG-3) (Zhang et al., Proc.
Natl. Acad. Sci. 94:9562-9567 (1997)); neuregulin-4 (NRG-4) (Harari et al.
Oatcogene 18:2681-89 (1999)) or cripto (CR-1) (Kannan et al. J. Biol. Chem. 272(6):3330-3335 (1997)). HER
ligands which bind EGFR include EGF, TGF-a, amphiregulin, betacellulin, HB-EGF and epiregulin. HER ligands which bind HER3 include heregulins. HER ligands capable of binding HER4 include betacellulin, epiregulin, HB-EGF, NRG-2, NRG-3, NRG-4 and heregulins.
"Heregulin" (HRG) when used herein refers to a polypeptide encoded by the heregulin gene product as disclosed in U.S. Patent No. 5,641,869 or Marchionni et al., Nature, 362:312-318 (1993). Examples of heregulins include heregulin-a, heregulin-01, heregulin-(32 and heregulin-(33 (]Holmes et al., Science, 256:1205-1210 (1992); and U.S. Patent No. 5,641,869); neu differentiation factor (NDF) (Peles et al. Cell 69: 205-216 (1992)); acetylcholine receptor-inducing activity (ARIA) (Falls et al. Cell 72:801-815 (1993)); glial growth factors (GGFs) (Marchionni et al., Nature, 362:312-318 (1993)); sensory and motor neuron derived factor (SMDF) (Ho et al. J. Biol. Chem. 270:14523-14532 (1995)); y-heregulin (Schaefer et al. Oncogene 15:1385-1394 (1997)). The term includes biologically active fragments and/or amino acid sequence variants of a native sequence HRG polypeptide, such as an EGF-like domain fragment thereof (e.g.
HRG(31177-244 ).
A "HER dimer" herein is a noncovalently associated dimer comprising at least two different HER
receptors. Such complexes may form when a cell expressing two or more HER
receptors is exposed to an HER
ligand and can be isolated by immunoprecipitation and analyzed by SDS-PAGE as described in Sliwkowski et al., J. Biol. Chem., 269(20):14661-14665 (1994), for example. Examples of such HER dimers include EGFR-HER2, HER2-HER3 and HER3-HER4 heterodimers. Moreover, the HER dieter may comprise two or more HER2 receptors combined with a different HER receptor, such as HER3, HER4 or EGFR. Other proteins, such as a cytokine receptor subunit (e.g. gp130) may be associated with the dimer.
A "heterodimeric binding site" on HER2, refers to a region in the extsacellular domain of HER2 that contacts, or interfaces with, a region in the extracellular domain of EGFR, HER3 or HER4 upon formation of a dimer therewith. The region is found in Domain II of HER2. Franklin et al.
Cancer Cell 5:317-328 (2004).
"HER activation" or "HER2 activation" refers to activation, or phosphorylation, of any one or more HER receptors, or HER2 receptors. Generally, HER activation results in signal transduction (e.g. that caused by an intracellular kinase domain of a HER receptor phosphorylating tyrosine residues in the HER receptor or a substrate polypeptide). HER activation may be mediated by HER ligand binding to a HER dimer comprising the HER receptor of interest. HER ligand binding to a HER dimer may activate a kinase domain of one or more of the HER receptors in the dimer and thereby results in phosphorylation of tyrosine residues in one or more of the HER receptors and/or phosphorylation of tyrosine residues in additional substrate polypeptides(s), such as Akt or MAPK intracellular kinases.
The term "antibody" herein is used in the broadest sense and specifically covers full length monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g. bispecific antibodies) formed from at least two full length antibodies, and antibody fragments, so long as they exhibit the desired biological activity.
270:7495-7500 (1995); and Komurasaki et al. Oncogene 15:2841-2848 (1997,); a heregulin (see below);
neuregulin-2 (NRG-2) (Carraway et al., Nature 387:512-516 (1997)); neuregu.lin-3 (NRG-3) (Zhang et al., Proc.
Natl. Acad. Sci. 94:9562-9567 (1997)); neuregulin-4 (NRG-4) (Harari et al.
Oatcogene 18:2681-89 (1999)) or cripto (CR-1) (Kannan et al. J. Biol. Chem. 272(6):3330-3335 (1997)). HER
ligands which bind EGFR include EGF, TGF-a, amphiregulin, betacellulin, HB-EGF and epiregulin. HER ligands which bind HER3 include heregulins. HER ligands capable of binding HER4 include betacellulin, epiregulin, HB-EGF, NRG-2, NRG-3, NRG-4 and heregulins.
"Heregulin" (HRG) when used herein refers to a polypeptide encoded by the heregulin gene product as disclosed in U.S. Patent No. 5,641,869 or Marchionni et al., Nature, 362:312-318 (1993). Examples of heregulins include heregulin-a, heregulin-01, heregulin-(32 and heregulin-(33 (]Holmes et al., Science, 256:1205-1210 (1992); and U.S. Patent No. 5,641,869); neu differentiation factor (NDF) (Peles et al. Cell 69: 205-216 (1992)); acetylcholine receptor-inducing activity (ARIA) (Falls et al. Cell 72:801-815 (1993)); glial growth factors (GGFs) (Marchionni et al., Nature, 362:312-318 (1993)); sensory and motor neuron derived factor (SMDF) (Ho et al. J. Biol. Chem. 270:14523-14532 (1995)); y-heregulin (Schaefer et al. Oncogene 15:1385-1394 (1997)). The term includes biologically active fragments and/or amino acid sequence variants of a native sequence HRG polypeptide, such as an EGF-like domain fragment thereof (e.g.
HRG(31177-244 ).
A "HER dimer" herein is a noncovalently associated dimer comprising at least two different HER
receptors. Such complexes may form when a cell expressing two or more HER
receptors is exposed to an HER
ligand and can be isolated by immunoprecipitation and analyzed by SDS-PAGE as described in Sliwkowski et al., J. Biol. Chem., 269(20):14661-14665 (1994), for example. Examples of such HER dimers include EGFR-HER2, HER2-HER3 and HER3-HER4 heterodimers. Moreover, the HER dieter may comprise two or more HER2 receptors combined with a different HER receptor, such as HER3, HER4 or EGFR. Other proteins, such as a cytokine receptor subunit (e.g. gp130) may be associated with the dimer.
A "heterodimeric binding site" on HER2, refers to a region in the extsacellular domain of HER2 that contacts, or interfaces with, a region in the extracellular domain of EGFR, HER3 or HER4 upon formation of a dimer therewith. The region is found in Domain II of HER2. Franklin et al.
Cancer Cell 5:317-328 (2004).
"HER activation" or "HER2 activation" refers to activation, or phosphorylation, of any one or more HER receptors, or HER2 receptors. Generally, HER activation results in signal transduction (e.g. that caused by an intracellular kinase domain of a HER receptor phosphorylating tyrosine residues in the HER receptor or a substrate polypeptide). HER activation may be mediated by HER ligand binding to a HER dimer comprising the HER receptor of interest. HER ligand binding to a HER dimer may activate a kinase domain of one or more of the HER receptors in the dimer and thereby results in phosphorylation of tyrosine residues in one or more of the HER receptors and/or phosphorylation of tyrosine residues in additional substrate polypeptides(s), such as Akt or MAPK intracellular kinases.
The term "antibody" herein is used in the broadest sense and specifically covers full length monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g. bispecific antibodies) formed from at least two full length antibodies, and antibody fragments, so long as they exhibit the desired biological activity.
The term "monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variants that may arise during production of the monoclonal antibody, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they are uncontaminated by other immunoglobulins. The modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al., Nature, 256:495 (1975), or may be made by recombinant DNA methods (see, e.g., U.S. Patent No. 4,816,567). The "monoclonal antibodies" may also be isolated from phage antibody libraries using the techniques described in Clackson et al., Nature, 352:624--628 (1991) and Marks et al., J. Mol. Biol., 222:581-597 (1991), for example.
The monoclonal antibodies herein specifically include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). Chimeric antibodies of interest herein include "primatized" antibodies comprising variable domain antigen-binding sequences derived from a non-human primate (e.g. Old World Monkey, Ape etc) and human constant region sequences.
"Antibody fragments" comprise a portion of a full length antibody, preferably comprising the antigen-binding or variable region thereof. Examples of antibody fragments include Fab, Fab', F(ab')2, and Fv fragments;
diabodies; linear antibodies; single-chain antibody molecules; and multispecific antibodies formed from antibody fragment(s).
A "full length antibody" is one which comprises an antigen-binding variable region as well as a light chain constant domain (CL) and heavy chain constant domains, CH1, CH2 and CH3.
The constant domains may be native sequence constant domains (e.g. human native sequence constant domains) or amino acid sequence variants thereof. Preferably, the full length antibody has one or more effector functions.
The term "main species antibody" herein refers to the antibody structure in a composition which is the quantitatively predominant antibody molecule in the composition. In one embodiment, the main species antibody is a HER2 antibody, such as an antibody that binds to Domain II of HER2, antibody that inhibits HER
dimerization more effectively than Trastuzumab, and/or an antibody which binds to a heterodimeric binding site of HER2. The preferred embodiment herein of a main species HER2 antibody is one comprising the variable light and variable heavy amino acid sequences in SEQ ID Nos. 3 and 4, and most preferably comprising the light chain and heavy chain amino acid sequences in SEQ ID Nos. 15 and 16 (Pertuzumab).
An "amino acid sequence variant" antibody herein is an antibody with an amino acid sequence 'which differs from a main species antibody. Ordinarily, amino acid sequence variants will possess at least about 70%
The monoclonal antibodies herein specifically include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). Chimeric antibodies of interest herein include "primatized" antibodies comprising variable domain antigen-binding sequences derived from a non-human primate (e.g. Old World Monkey, Ape etc) and human constant region sequences.
"Antibody fragments" comprise a portion of a full length antibody, preferably comprising the antigen-binding or variable region thereof. Examples of antibody fragments include Fab, Fab', F(ab')2, and Fv fragments;
diabodies; linear antibodies; single-chain antibody molecules; and multispecific antibodies formed from antibody fragment(s).
A "full length antibody" is one which comprises an antigen-binding variable region as well as a light chain constant domain (CL) and heavy chain constant domains, CH1, CH2 and CH3.
The constant domains may be native sequence constant domains (e.g. human native sequence constant domains) or amino acid sequence variants thereof. Preferably, the full length antibody has one or more effector functions.
The term "main species antibody" herein refers to the antibody structure in a composition which is the quantitatively predominant antibody molecule in the composition. In one embodiment, the main species antibody is a HER2 antibody, such as an antibody that binds to Domain II of HER2, antibody that inhibits HER
dimerization more effectively than Trastuzumab, and/or an antibody which binds to a heterodimeric binding site of HER2. The preferred embodiment herein of a main species HER2 antibody is one comprising the variable light and variable heavy amino acid sequences in SEQ ID Nos. 3 and 4, and most preferably comprising the light chain and heavy chain amino acid sequences in SEQ ID Nos. 15 and 16 (Pertuzumab).
An "amino acid sequence variant" antibody herein is an antibody with an amino acid sequence 'which differs from a main species antibody. Ordinarily, amino acid sequence variants will possess at least about 70%
homology with the main species antibody, and preferably, they will be at least about 80%, more preferably at least about 90% homologous with the main species antibody. The amino acid sequence variants possess substitutions, deletions, and/or additions at certain positions within or adjacent to the amino acid sequence of the main species antibody. Examples of amino acid sequence variants herein include acidic variant (e.g. deamidated antibody variant), basic variant, the antibody with an amino-terminal leader extension (e.g. VHS-) on one or two light chains thereof, antibody with a C-terminal lysine residue on one or two heavy chains thereof, etc, and includes combinations of variations to the amino acid sequences of heavy and/or light chains. The antibody variant of particular interest herein is the antibody comprising an amino-terminal leader extension on one or two light chains thereof, optionally further comprising other amino acid sequence and/or glycosylation differences relative to the main species antibody.
A "therapeutic monoclonal antibody" is an antibody used for therapy of a human subject. Therapeutic monoclonal antibodies disclosed herein include: HER2 antibodies for cancer and various non-malignant diseases or disorders; CD20 or BR3 antibodies for therapy of B cell malignancies, autoimmune diseases, graft rejection, or blocking an immune response to a foreign antigen; IgE antibodies for therapy of an IgE-mediated disorder;
DR5 or VEGF antibodies for cancer therapy.
A "glycosylation variant" antibody herein is an antibody with one or more carbohydrate moeities attached thereto which differ from one or more carbohydate moieties attached to a main species antibody.
Examples of glycosylation variants herein include antibody with a G1 or G2 oligosaccharide structure, instead a GO oligosaccharide structure, attached to an Fc region thereof, antibody with one or two carbohydrate moieties attached to one or two light chains thereof, antibody with no carbohydrate attached to one or two heavy chains of the antibody, etc, and combinations of glycosylation alterations.
Where the antibody has an Fc region, an oligosaccharide structure such as that shown in Fig. 16 herein may be attached to one or two heavy chains of the antibody, e.g. at residue 299 (298, Eu numbering of residues).
For Pertuzumab, GO was the predominant oligosaccharide structure, with other oligosaccharide structures such as GO-F, G-1, Mans, Man6, G1-1, G1(1-6), G1(1-3) and G2 being found in lesser amounts in the Pertuzumab composition.
Unless indicated otherwise, a "G1 oligosaccharide structure" herein includes G-1, G1-1, G1(1-6) and G1(1-3) structures.
An "amino-terminal leader extension" herein refers to one or more amino acid residues of the amino-terminal leader sequence that are present at the amino-terminus of any one or more heavy or light chains of an antibody. An exemplary amino-terminal leader extension comprises or consists of three amino acid residues, VHS, present on one or both light chains of an antibody variant.
"Homology" is defined as the percentage of residues in the amino acid sequence variant that are identical after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology. Methods and computer programs for the alignment are well known in the art. One such computer program is "Align 2", authored by Genentech, Inc., which was filed with user documentation in the United States Copyright Office, Washington, DC 20559, on December 10, 1991.
Antibody "effector functions" refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fe region) of an antibody.
Examples of antibody effector functions include Clq binding; complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor;
BCR), etc.
Depending on the amino acid sequence of the constant domain of their heavy chains, full length antibodies can be assigned to different "classes". There are five major classes of full length antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into "subclasses" (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgA, and IgA2. The heavy-chain constant domains that correspond to the different classes of antibodies are called a, S, s, y, and , respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
"Antibody-dependent cell-mediated cytotoxicity" and "ADCC" refer to a cell-mediated reaction in which nonspecific cytotoxic cells that express Fc receptors (FcRs) (e.g.
Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and subsequently cause lysis of the target cell. The primary cells for mediating ADCC, NK cells, express FcyRIII only, whereas monocytes express FcyRT, FcyRII
and FcyRIII. FcR expression on hematopoietic cells in summarized is Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. hnmunol 9:457-92 (1991). To assess ADCC activity of a molecule of interest, an in vitro ADCC
assay, such as that described in US Patent No. 5,500,362 or 5,821,337 may be performed. Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
"Human effector cells" are leukocytes which express one or more FcRs and perform effector functions.
Preferably, the cells express at least FcyRIll and perform ADCC effector function. Examples of human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells and neutrophils; with PBMCs and NK cells being preferred. The effector cells may be isolated from a native source thereof, e.g. from blood or PBMCs as described herein-The terms "Fc receptor" or "FcR" are used to describe a receptor that binds to the Fc region of an antibody. The preferred FcR is a native sequence human FcR. Moreover, a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and Fcy RIII subclasses, including allelic variants and alternatively spliced forms of these receptors. FcyR1I
receptors include FcyRIIA (an "activating receptor") and FcyRIIB (an "inhibiting receptor"), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof. Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain. (see review M. in Daeron, Annu. Rev. Immunol. 15:203-234 (1997)). FcRs are reviewed in Ravetch and Kinet, Aranu. Rev. Iminunol 9:457-92 (1991); Capel et al., linmunotnethods 4:25-34 (1994); and de Haas et al., J. Lab. Clin. Med. 126:330-41 (1995). Other FcRs, including those to be identified in the future, are encompassed by the term "FcR" herein.
The term also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. hninunol. 117:587 (1976) and Kim et al., J. hnmunol.
24:249 (1994)).
"Complement dependent cytotoxicity" or "CDC" refers to the ability of a molecule to lyse a target in the presence of complement. The complement activation pathway is initiated by the binding of the first component of the complement system (Clq) to a molecule (e.g. an antibody) complexed with a cognate antigen.
A "therapeutic monoclonal antibody" is an antibody used for therapy of a human subject. Therapeutic monoclonal antibodies disclosed herein include: HER2 antibodies for cancer and various non-malignant diseases or disorders; CD20 or BR3 antibodies for therapy of B cell malignancies, autoimmune diseases, graft rejection, or blocking an immune response to a foreign antigen; IgE antibodies for therapy of an IgE-mediated disorder;
DR5 or VEGF antibodies for cancer therapy.
A "glycosylation variant" antibody herein is an antibody with one or more carbohydrate moeities attached thereto which differ from one or more carbohydate moieties attached to a main species antibody.
Examples of glycosylation variants herein include antibody with a G1 or G2 oligosaccharide structure, instead a GO oligosaccharide structure, attached to an Fc region thereof, antibody with one or two carbohydrate moieties attached to one or two light chains thereof, antibody with no carbohydrate attached to one or two heavy chains of the antibody, etc, and combinations of glycosylation alterations.
Where the antibody has an Fc region, an oligosaccharide structure such as that shown in Fig. 16 herein may be attached to one or two heavy chains of the antibody, e.g. at residue 299 (298, Eu numbering of residues).
For Pertuzumab, GO was the predominant oligosaccharide structure, with other oligosaccharide structures such as GO-F, G-1, Mans, Man6, G1-1, G1(1-6), G1(1-3) and G2 being found in lesser amounts in the Pertuzumab composition.
Unless indicated otherwise, a "G1 oligosaccharide structure" herein includes G-1, G1-1, G1(1-6) and G1(1-3) structures.
An "amino-terminal leader extension" herein refers to one or more amino acid residues of the amino-terminal leader sequence that are present at the amino-terminus of any one or more heavy or light chains of an antibody. An exemplary amino-terminal leader extension comprises or consists of three amino acid residues, VHS, present on one or both light chains of an antibody variant.
"Homology" is defined as the percentage of residues in the amino acid sequence variant that are identical after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology. Methods and computer programs for the alignment are well known in the art. One such computer program is "Align 2", authored by Genentech, Inc., which was filed with user documentation in the United States Copyright Office, Washington, DC 20559, on December 10, 1991.
Antibody "effector functions" refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fe region) of an antibody.
Examples of antibody effector functions include Clq binding; complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor;
BCR), etc.
Depending on the amino acid sequence of the constant domain of their heavy chains, full length antibodies can be assigned to different "classes". There are five major classes of full length antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into "subclasses" (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgA, and IgA2. The heavy-chain constant domains that correspond to the different classes of antibodies are called a, S, s, y, and , respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
"Antibody-dependent cell-mediated cytotoxicity" and "ADCC" refer to a cell-mediated reaction in which nonspecific cytotoxic cells that express Fc receptors (FcRs) (e.g.
Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and subsequently cause lysis of the target cell. The primary cells for mediating ADCC, NK cells, express FcyRIII only, whereas monocytes express FcyRT, FcyRII
and FcyRIII. FcR expression on hematopoietic cells in summarized is Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. hnmunol 9:457-92 (1991). To assess ADCC activity of a molecule of interest, an in vitro ADCC
assay, such as that described in US Patent No. 5,500,362 or 5,821,337 may be performed. Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
"Human effector cells" are leukocytes which express one or more FcRs and perform effector functions.
Preferably, the cells express at least FcyRIll and perform ADCC effector function. Examples of human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells and neutrophils; with PBMCs and NK cells being preferred. The effector cells may be isolated from a native source thereof, e.g. from blood or PBMCs as described herein-The terms "Fc receptor" or "FcR" are used to describe a receptor that binds to the Fc region of an antibody. The preferred FcR is a native sequence human FcR. Moreover, a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and Fcy RIII subclasses, including allelic variants and alternatively spliced forms of these receptors. FcyR1I
receptors include FcyRIIA (an "activating receptor") and FcyRIIB (an "inhibiting receptor"), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof. Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain. (see review M. in Daeron, Annu. Rev. Immunol. 15:203-234 (1997)). FcRs are reviewed in Ravetch and Kinet, Aranu. Rev. Iminunol 9:457-92 (1991); Capel et al., linmunotnethods 4:25-34 (1994); and de Haas et al., J. Lab. Clin. Med. 126:330-41 (1995). Other FcRs, including those to be identified in the future, are encompassed by the term "FcR" herein.
The term also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. hninunol. 117:587 (1976) and Kim et al., J. hnmunol.
24:249 (1994)).
"Complement dependent cytotoxicity" or "CDC" refers to the ability of a molecule to lyse a target in the presence of complement. The complement activation pathway is initiated by the binding of the first component of the complement system (Clq) to a molecule (e.g. an antibody) complexed with a cognate antigen.
To assess complement activation, a CDC assay, e.g. as described in Gazzano-Santoro et at., J. Immunol.
Methods 202:163 (1996), may be performed.
"Native antibodies" are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges.
Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains. Each light chain has a variable domain at one end (VL) and a constant domain at its other end. The constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light-chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
The term "variable" refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions both in the light chain and the heavy chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FRs). The variable domains of native heavy and light chains each comprise four FRs, largely adopting a (3-sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the (3-sheet structure. The hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et at., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC).
The term "hypervariable region" when used herein refers to the amino acid residues of an antibody which are responsible for antigen-binding. The hypervariable region generally comprises amino acid residues from a "complementarity determining region" or "CDR" (e.g. residues 24-34 (Li), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and 31-35 (HI), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain;
Kabat et at., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)) and/or those residues from a "hypervariable loop" (e.g. residues 26-32 (L1), 50-52 (L2) and 91-96 (L3) in the light chain variable domain and 26-32 (H1), 53-55 (H2) and 96-101 (H3) in the heavy chain variable domain; Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)). "Framework Region" or "FR" residues are those variable domain residues other than the hypervariable region residues as herein defined.
Papain digestion of antibodies produces two identical antigen-binding fragments, called "Fab"
fragments, each with a single antigen-binding site, and a residual "Fc"
fragment, whose name reflects its ability to crystallize readily. Pepsin treatment yields an F(ab')2 fragment that has two antigen-binding sites and is still capable of cross-linking antigen.
"Fv" is the minimum antibody fragment which contains a complete antigen-recognition and antigen-binding site. This region consists of a dimer of one heavy chain and one light chain variable domain in tight, non-covalent association. It is in this configuration that the three hypervariable regions of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer.
Collectively, the six hypervariable regions confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three hypervariable regions specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
The Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region. Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear at least one free thiol group. F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
The "light chains" of antibodies from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (K) and lambda (X), based on the amino acid sequences of their constant domains.
"Single-chain Fv" or "scFv" antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain. Preferably, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding. For a review of scFv see Pliickthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994). HER2 antibody scFv fragments are described in WO93/16185; U.S. Patent No. 5,571,894; and U.S. Patent No.
5,587,458.
The term "diabodies" refers to small antibody fragments with two antigen-binding sites, which fragments comprise a variable heavy domain (VH) connected to a variable light domain (VL) in the same polypeptide chain (VH - VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. Diabodies are described more fully in, for example, EP
404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
"Humanized" forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired-specificity, affinity, and capacity. In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
Furthermore, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones el al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).
Humanized HER2 antibodies include huMAb4D5-1, huMAb4D5-2, huMAb4D5-3, huMAb4D5-4, huMAb4D5-5, huMAb4D5-6, huMAb4D5-7 and huMAb4D5-8 or Trastuzumab (HERCEPTIN ) as described in Table 3 of U.S. Patent 5,821,337, humanized 520C9 (W093121319) and humanized 2C4 antibodies as described herein.
For the purposes herein, "Trastuzumab," "HERCEPTIN ," and "huMAb4D5-8" refer to an antibody comprising the light and heavy chain amino acid sequences in SEQ ID NOS. 13 and 14, respectively.
Herein, "Pertuzumab," "rhuMAb 2C4," and "OMNITARGTM" refer to an antibody comprising the variable light and variable heavy amino acid sequences in SEQ ID Nos. 3 and 4, respectfully. Where Pertuzumab is a full length antibody, it preferably comprises the light chain and heavy chain amino acid sequences in SEQ ID NOS. 15 and 16, respectively.
A "naked antibody" is an antibody (as herein defined) that is not conjugated to a heterologous molecule, such as a cytotoxic moiety or radiolabel.
An "affinity matured" antibody is one with one or more alterations in one or more hypervariable regions thereof which result an improvement in the affinity of the antibody for antigen, compared to a parent antibody which does not possess those alteration(s). Preferred affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen. Affinity matured antibodies are produced by procedures known in the art. Marks et al. Bio/Technology 10:779-783 (1992) describes affinity maturation by VH and VL
domain shuffling. Random mutagenesis of CDR and/or framework residues is described by: Barbas et al. Proc Nat. Acad. Sci, USA 91:3809-3813 (1994); Schier et al. Gene 169:147-155 (1995); Melton et al. J. hnmunol.
155:1994-2004 (1995); Jackson et al., J. Lnmunol. 154(7):3310-9 (1995); and Hawkins et al, J. Mol. Biol.
226:889-896 (1992).
An "agonist antibody" is an antibody which binds to and activates a receptor.
Generally, the receptor activation capability of the agonist antibody will be at least qualitatively similar (and may be essentially quantitatively similar) to a native agonist ligand of the receptor. An example of an agonist antibody is one which binds to a receptor in the TNF receptor superfamily, such as DRS, and induces apoptosis of cells expressing the TNF receptor (e.g. DR5). Assays for determining induction of apoptosis are described in W098/51793 and W099/37684.
An "isolated" antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. In preferred embodiments, the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain.
Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
Methods 202:163 (1996), may be performed.
"Native antibodies" are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges.
Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains. Each light chain has a variable domain at one end (VL) and a constant domain at its other end. The constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light-chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
The term "variable" refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions both in the light chain and the heavy chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FRs). The variable domains of native heavy and light chains each comprise four FRs, largely adopting a (3-sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the (3-sheet structure. The hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et at., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC).
The term "hypervariable region" when used herein refers to the amino acid residues of an antibody which are responsible for antigen-binding. The hypervariable region generally comprises amino acid residues from a "complementarity determining region" or "CDR" (e.g. residues 24-34 (Li), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and 31-35 (HI), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain;
Kabat et at., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)) and/or those residues from a "hypervariable loop" (e.g. residues 26-32 (L1), 50-52 (L2) and 91-96 (L3) in the light chain variable domain and 26-32 (H1), 53-55 (H2) and 96-101 (H3) in the heavy chain variable domain; Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)). "Framework Region" or "FR" residues are those variable domain residues other than the hypervariable region residues as herein defined.
Papain digestion of antibodies produces two identical antigen-binding fragments, called "Fab"
fragments, each with a single antigen-binding site, and a residual "Fc"
fragment, whose name reflects its ability to crystallize readily. Pepsin treatment yields an F(ab')2 fragment that has two antigen-binding sites and is still capable of cross-linking antigen.
"Fv" is the minimum antibody fragment which contains a complete antigen-recognition and antigen-binding site. This region consists of a dimer of one heavy chain and one light chain variable domain in tight, non-covalent association. It is in this configuration that the three hypervariable regions of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer.
Collectively, the six hypervariable regions confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three hypervariable regions specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
The Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region. Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear at least one free thiol group. F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
The "light chains" of antibodies from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (K) and lambda (X), based on the amino acid sequences of their constant domains.
"Single-chain Fv" or "scFv" antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain. Preferably, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding. For a review of scFv see Pliickthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994). HER2 antibody scFv fragments are described in WO93/16185; U.S. Patent No. 5,571,894; and U.S. Patent No.
5,587,458.
The term "diabodies" refers to small antibody fragments with two antigen-binding sites, which fragments comprise a variable heavy domain (VH) connected to a variable light domain (VL) in the same polypeptide chain (VH - VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. Diabodies are described more fully in, for example, EP
404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
"Humanized" forms of non-human (e.g., rodent) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired-specificity, affinity, and capacity. In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
Furthermore, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones el al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).
Humanized HER2 antibodies include huMAb4D5-1, huMAb4D5-2, huMAb4D5-3, huMAb4D5-4, huMAb4D5-5, huMAb4D5-6, huMAb4D5-7 and huMAb4D5-8 or Trastuzumab (HERCEPTIN ) as described in Table 3 of U.S. Patent 5,821,337, humanized 520C9 (W093121319) and humanized 2C4 antibodies as described herein.
For the purposes herein, "Trastuzumab," "HERCEPTIN ," and "huMAb4D5-8" refer to an antibody comprising the light and heavy chain amino acid sequences in SEQ ID NOS. 13 and 14, respectively.
Herein, "Pertuzumab," "rhuMAb 2C4," and "OMNITARGTM" refer to an antibody comprising the variable light and variable heavy amino acid sequences in SEQ ID Nos. 3 and 4, respectfully. Where Pertuzumab is a full length antibody, it preferably comprises the light chain and heavy chain amino acid sequences in SEQ ID NOS. 15 and 16, respectively.
A "naked antibody" is an antibody (as herein defined) that is not conjugated to a heterologous molecule, such as a cytotoxic moiety or radiolabel.
An "affinity matured" antibody is one with one or more alterations in one or more hypervariable regions thereof which result an improvement in the affinity of the antibody for antigen, compared to a parent antibody which does not possess those alteration(s). Preferred affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen. Affinity matured antibodies are produced by procedures known in the art. Marks et al. Bio/Technology 10:779-783 (1992) describes affinity maturation by VH and VL
domain shuffling. Random mutagenesis of CDR and/or framework residues is described by: Barbas et al. Proc Nat. Acad. Sci, USA 91:3809-3813 (1994); Schier et al. Gene 169:147-155 (1995); Melton et al. J. hnmunol.
155:1994-2004 (1995); Jackson et al., J. Lnmunol. 154(7):3310-9 (1995); and Hawkins et al, J. Mol. Biol.
226:889-896 (1992).
An "agonist antibody" is an antibody which binds to and activates a receptor.
Generally, the receptor activation capability of the agonist antibody will be at least qualitatively similar (and may be essentially quantitatively similar) to a native agonist ligand of the receptor. An example of an agonist antibody is one which binds to a receptor in the TNF receptor superfamily, such as DRS, and induces apoptosis of cells expressing the TNF receptor (e.g. DR5). Assays for determining induction of apoptosis are described in W098/51793 and W099/37684.
An "isolated" antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. In preferred embodiments, the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain.
Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
A. HER2 antibody which "inhibits HER dimerization more effectively than Trastuzumab" is one which reduces or eliminates HER dimers more effectively (for example at least about 2-fold more effectively) than Trastuzumab. Preferably, such an antibody inhibits HER2 dimerization at least about as effectively as an antibody selected from the group consisting of murine monoclonal antibody 2C4, a Fab fragment of murine monoclonal antibody 2C4, Pertuzumab, and a Fab fragment of Pertuzumab. One can evaluate HER
dimerization inhibition by studying HER dimers directly, or by evaluating HER
activation, or downstream signaling, which results from HER dimerization, and/or by evaluating the antibody-HER2 binding site, etc.
Assays for screening for antibodies with the ability to inhibit HER
dimerization more effectively than Trastuzumab are described in Agus et al. Cancer Cell 2: 127-137 (2002) and WOO
1/00245 (Adams et al.). By way of example only, one may assay for inhibition of HER dimerization by assessing, for example, inhibition of HER dimer formation (see, e.g., Fig. lA-B of Agus et al. Cancer Cell 2: 127-137 (2002); and WOO1/00245);
reduction in HER ligand activation of cells which express HER dimers (WOO1/00245and Fig. 2A-B of Agus et al. Cancer Cell 2: 127-137 (2002), for example); blocking of HER ligand binding to cells which express HER
dimers (WOO 1/00245, and Fig. 2E of Agus et al. Cancer Cell 2: 127-137 (2002), for example); cell growth inhibition of cancer cells (e.g. MCF7, MDA-MD-134, ZR-75-1, MD-MB-175, T-47D
cells) which express HER
dimers in the presence (or absence) of HER ligand (WO01/00245and Figs. 3A-D of Agus et al. Cancer Cell 2:
127-137 (2002), for instance); inhibition of downstream signaling (for instance, inhibition of HRG-dependent AKT phosphorylation or inhibition of HRG- or TGFa- dependent MAPK
phosphorylation) (see, WOO 1/00245, and Fig. 2C-D of Agus et al. Cancer Cell 2: 127-137 (2002), for example). One may also assess whether the antibody inhibits HER dimerization by studying the antibody-HER2 binding site, for instance, by evaluating a structure or model, such as a crystal structure, of the antibody bound to HER2 (See, for example, Franklin et al.
Cancer Cell 5:317-328 (2004)).
The HER2 antibody may "inhibit HRG-dependent AKT phosphorylation" and/or inhibit "HRG- or TGFa-dependent MAPK phosphorylation" more effectively (for instance at least 2-fold more effectively) than Trastuzumab (see Agus et al. Cancer Cell 2: 127-137 (2002) and WOO 1/00245, by way of example).
The HER2 antibody may be one which does "not inhibit HER2 ectodomain cleavage"
(Molina et al.
Cancer Res. 61:4744-4749(2001).
A HER2 antibody that "binds to a heterodimeric binding site" of HER2, binds to residues in domain II
(and optionally also binds to residues in other of the domains of the HER2 extracellular d(>main, such as domains I and III), and can sterically hinder, at least to some extent, formation of a HER2-EGFR, 14ER2-HER3, or HER2-HER4 heterodimer. Franklin et al. Cancer Cell 5:317-328 (2004) characterize the HER2-Pertuzumab crystal structure, deposited with the RCSB Protein Data Bank (ID Code IS78), illustrating an exemplary antibody that binds to the heterodimeric binding site of HER2.
An antibody that "binds to domain II" of HER2 binds to residues in domain II
and optionally residues in other domain(s) of HER2, such as domains I and III. Preferably the antibody that binds to domain II binds to the junction between domains I, II and III of HER2.
A. "growth inhibitory agent" when used herein refers to a compound or composition which inhibits growth of a cell, especially a HER expressing cancer cell either in vitro or in vivo. Thus, the growth inhibitory agent may be one which significantly reduces the percentage of HER expressing cells in S phase. Examples of growth inhibitory agents include agents that block cell cycle progression (at a place other than S phase), such as agents that induce GI arrest and M-phase arrest. Classical M-phase blockers include the vincas (vincristine and vinblastine), taxanes, and topo II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin. Those agents that arrest G 1 also spill over into S-phase arrest, for example, DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
Further information can be found in The Molecular Basis of Cancer, Mendelsohn and Israel, eds., Chapter 1, entitled "Cell cycle regulation, oncogenes, and antineoplastic drugs" by Murakami et al. (WB Saunders:
Philadelphia, 1995), especially p. 13.
Examples of "growth inhibitory" antibodies are those which bind to HER2 and inhibit the growth of cancer cells overexpressing HER2. Preferred growth inhibitory HER2 antibodies inhibit growth of SK-BR-3 breast tumor cells in cell culture by greater than 20%, and preferably greater than 50% (e.g. from about 50% to about 100%) at an antibody concentration of about 0.5 to 30 pg/ml, where the growth inhibition is determined six days after exposure of the SK-BR-3 cells to the antibody (see U.S. Patent No. 5,677,171 issued October 14, 1997). The SK-BR-3 cell growth inhibition assay is described in more detail in that patent and hereinbelow.
The preferred growth inhibitory antibody is a humanized variant of murine monoclonal antibody 4D5, e.g., Trastuzumab.
An antibody which "induces apoptosis" is one which induces programmed cell death as determined by binding of annexin V, fragmentation of DNA, cell shrinkage, dilation of endoplasmic reticulum, cell fragmentation, and/or formation of membrane vesicles (called apoptotic bodies). The cell is usually one which expresses the antigen to which the antibody binds. Preferably the cell is a tumor cell. For example, phosphatidyl serine (PS) translocation can be measured by annexin binding; DNA
fragmentation can be evaluated through DNA laddering; and nuclear/chromatin condensation along with DNA fragmentation can be evaluated by any increase in hypodiploid cells. Preferably, the antibody which induces apoptosis is one which results in about 2 to 50 fold, preferably about 5 to 50 fold, and most preferably about 10 to 50 fold, induction of annexin binding relative to "untreated cell in an annexin binding assay using cells that express an antigen to which the antibody binds. Examples of antibodies that induce apoptosis are HER2 antibodies 7C2 and 7F3, and certain DR5 antibodies.
The "epitope 2C4" is the region in the extracellular domain of HER2 to which the antibody 2C4 binds.
In order to screen for antibodies which bind to the 2C4 epitope, a routine cross-blocking assay such as that described in Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1988), can be performed. Alternatively, epitope mapping can be performed to assess whether the antibody binds to the 2C4 epitope of HER2. Epitope 2C4 comprises residues from domain II in the extracellular domain of HER2. 2C4 and Pertuzumab bind to the extracellular domain of HER2 at the junction of domains I, II and III.
Franklin et al. Cancer Cell 5:317-328 (2004).
The "epitope 4D5" is the region in the extracellular domain of HER2 to which the antibody 4D5 (ATCC
CRL 10463) and Trastuzumab bind. This epitope is close to the transmembrane domain of HER2, and within Domain IV of HER2. To screen for antibodies which bind to the 4D5 epitope, a routine cross-blocking assay such as that described in Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1988), can be performed. Alternatively, epitope mapping can be performed to assess whether the antibody binds to the 4D5 epitope of HER2 (e.g. any one or more residues in the region from about residue 529 to about residue 625, inclusive, of HER2).
dimerization inhibition by studying HER dimers directly, or by evaluating HER
activation, or downstream signaling, which results from HER dimerization, and/or by evaluating the antibody-HER2 binding site, etc.
Assays for screening for antibodies with the ability to inhibit HER
dimerization more effectively than Trastuzumab are described in Agus et al. Cancer Cell 2: 127-137 (2002) and WOO
1/00245 (Adams et al.). By way of example only, one may assay for inhibition of HER dimerization by assessing, for example, inhibition of HER dimer formation (see, e.g., Fig. lA-B of Agus et al. Cancer Cell 2: 127-137 (2002); and WOO1/00245);
reduction in HER ligand activation of cells which express HER dimers (WOO1/00245and Fig. 2A-B of Agus et al. Cancer Cell 2: 127-137 (2002), for example); blocking of HER ligand binding to cells which express HER
dimers (WOO 1/00245, and Fig. 2E of Agus et al. Cancer Cell 2: 127-137 (2002), for example); cell growth inhibition of cancer cells (e.g. MCF7, MDA-MD-134, ZR-75-1, MD-MB-175, T-47D
cells) which express HER
dimers in the presence (or absence) of HER ligand (WO01/00245and Figs. 3A-D of Agus et al. Cancer Cell 2:
127-137 (2002), for instance); inhibition of downstream signaling (for instance, inhibition of HRG-dependent AKT phosphorylation or inhibition of HRG- or TGFa- dependent MAPK
phosphorylation) (see, WOO 1/00245, and Fig. 2C-D of Agus et al. Cancer Cell 2: 127-137 (2002), for example). One may also assess whether the antibody inhibits HER dimerization by studying the antibody-HER2 binding site, for instance, by evaluating a structure or model, such as a crystal structure, of the antibody bound to HER2 (See, for example, Franklin et al.
Cancer Cell 5:317-328 (2004)).
The HER2 antibody may "inhibit HRG-dependent AKT phosphorylation" and/or inhibit "HRG- or TGFa-dependent MAPK phosphorylation" more effectively (for instance at least 2-fold more effectively) than Trastuzumab (see Agus et al. Cancer Cell 2: 127-137 (2002) and WOO 1/00245, by way of example).
The HER2 antibody may be one which does "not inhibit HER2 ectodomain cleavage"
(Molina et al.
Cancer Res. 61:4744-4749(2001).
A HER2 antibody that "binds to a heterodimeric binding site" of HER2, binds to residues in domain II
(and optionally also binds to residues in other of the domains of the HER2 extracellular d(>main, such as domains I and III), and can sterically hinder, at least to some extent, formation of a HER2-EGFR, 14ER2-HER3, or HER2-HER4 heterodimer. Franklin et al. Cancer Cell 5:317-328 (2004) characterize the HER2-Pertuzumab crystal structure, deposited with the RCSB Protein Data Bank (ID Code IS78), illustrating an exemplary antibody that binds to the heterodimeric binding site of HER2.
An antibody that "binds to domain II" of HER2 binds to residues in domain II
and optionally residues in other domain(s) of HER2, such as domains I and III. Preferably the antibody that binds to domain II binds to the junction between domains I, II and III of HER2.
A. "growth inhibitory agent" when used herein refers to a compound or composition which inhibits growth of a cell, especially a HER expressing cancer cell either in vitro or in vivo. Thus, the growth inhibitory agent may be one which significantly reduces the percentage of HER expressing cells in S phase. Examples of growth inhibitory agents include agents that block cell cycle progression (at a place other than S phase), such as agents that induce GI arrest and M-phase arrest. Classical M-phase blockers include the vincas (vincristine and vinblastine), taxanes, and topo II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin. Those agents that arrest G 1 also spill over into S-phase arrest, for example, DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
Further information can be found in The Molecular Basis of Cancer, Mendelsohn and Israel, eds., Chapter 1, entitled "Cell cycle regulation, oncogenes, and antineoplastic drugs" by Murakami et al. (WB Saunders:
Philadelphia, 1995), especially p. 13.
Examples of "growth inhibitory" antibodies are those which bind to HER2 and inhibit the growth of cancer cells overexpressing HER2. Preferred growth inhibitory HER2 antibodies inhibit growth of SK-BR-3 breast tumor cells in cell culture by greater than 20%, and preferably greater than 50% (e.g. from about 50% to about 100%) at an antibody concentration of about 0.5 to 30 pg/ml, where the growth inhibition is determined six days after exposure of the SK-BR-3 cells to the antibody (see U.S. Patent No. 5,677,171 issued October 14, 1997). The SK-BR-3 cell growth inhibition assay is described in more detail in that patent and hereinbelow.
The preferred growth inhibitory antibody is a humanized variant of murine monoclonal antibody 4D5, e.g., Trastuzumab.
An antibody which "induces apoptosis" is one which induces programmed cell death as determined by binding of annexin V, fragmentation of DNA, cell shrinkage, dilation of endoplasmic reticulum, cell fragmentation, and/or formation of membrane vesicles (called apoptotic bodies). The cell is usually one which expresses the antigen to which the antibody binds. Preferably the cell is a tumor cell. For example, phosphatidyl serine (PS) translocation can be measured by annexin binding; DNA
fragmentation can be evaluated through DNA laddering; and nuclear/chromatin condensation along with DNA fragmentation can be evaluated by any increase in hypodiploid cells. Preferably, the antibody which induces apoptosis is one which results in about 2 to 50 fold, preferably about 5 to 50 fold, and most preferably about 10 to 50 fold, induction of annexin binding relative to "untreated cell in an annexin binding assay using cells that express an antigen to which the antibody binds. Examples of antibodies that induce apoptosis are HER2 antibodies 7C2 and 7F3, and certain DR5 antibodies.
The "epitope 2C4" is the region in the extracellular domain of HER2 to which the antibody 2C4 binds.
In order to screen for antibodies which bind to the 2C4 epitope, a routine cross-blocking assay such as that described in Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1988), can be performed. Alternatively, epitope mapping can be performed to assess whether the antibody binds to the 2C4 epitope of HER2. Epitope 2C4 comprises residues from domain II in the extracellular domain of HER2. 2C4 and Pertuzumab bind to the extracellular domain of HER2 at the junction of domains I, II and III.
Franklin et al. Cancer Cell 5:317-328 (2004).
The "epitope 4D5" is the region in the extracellular domain of HER2 to which the antibody 4D5 (ATCC
CRL 10463) and Trastuzumab bind. This epitope is close to the transmembrane domain of HER2, and within Domain IV of HER2. To screen for antibodies which bind to the 4D5 epitope, a routine cross-blocking assay such as that described in Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1988), can be performed. Alternatively, epitope mapping can be performed to assess whether the antibody binds to the 4D5 epitope of HER2 (e.g. any one or more residues in the region from about residue 529 to about residue 625, inclusive, of HER2).
The "epitope 7C2/7F3" is the region at the amino terminus, within Domain I, of the extracellular domain of HER2 to which the 7C2 and/or 7F3 antibodies (each deposited with the ATCC, see below) bind. To screen for antibodies which bind to the 7C2/7F3 epitope, a routine cross-blocking assay such as that described in Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1988), can be performed. Alternatively, epitope mapping can be performed to establish whether the antibody binds to the 7C2/7F3 epitope on HER2 (e.g. any one or more of residues in the region from about residue 22 to about residue 53 of HER2).
"Treatment" refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment include those already with the disease as well as those in which the disease is to be prevented.
Hence, the patient to be treated herein may have been diagnosed as having the disease or may be predisposed or susceptible to the disease.
The terms "cancer" and "cancerous" refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Exarrrples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma (including medulloblastoma and retinoblastoma), sarcoma (including liposarcoma and synovial cell sarcoma), neuroendocrine tumors (including carcinoid tumors, gastrinoma,and islet cell cancer), mesothelioma, schwannoma (including acoustic neuroma), meningioma, adenocarcinoma, melanoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g. epithelial squamous cell cancer), lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, testicular cancer, esophagael cancer, tumors of the biliary tract, as well as head and neck cancer.
The term "effective amount" refers to an amount of a drug effective to a disease in the patient. Where the disease is cancer, the effective amount of the drug may reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the cancer.
To the extent the drug may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic. The effective amount may extend progression free survival, result in an objective response (including a partial response, PR, or complete response, CR), increase overall survival time, and/or improve one or more symptoms of cancer.
A "HER2-expressing cancer" is one comprising cells which have HER2 protein present at their cell surface.
A cancer which "overexpresses" a HER receptor is one which has significantly higher levels of a HER
receptor, such as HER2, at the cell surface thereof, compared to a noncancerous cell of the same tissue type.
Such overexpression may be caused by gene amplification or by increased transcription or translation. HER
receptor overexpression may be determined in a diagnostic or prognostic assay by evaluating increased levels of the HER protein present on the surface of a cell (e.g. via an immunohistochemistry assay; IHC). Alternatively, or additionally, one may measure levels of HER-encoding nucleic acid in the cell, e.g. via fluorescent in situ hybridization (FISH; see W098/45479 published October, 1998), southern blotting, or polymerase chain reaction (PCR) techniques, such as real time quantitative PCR (RT-PCR). One may also study HER receptor overexpression by measuring shed antigen (e.g., HER extracellular domain) in a biological fluid such as serum (see, e.g., U.S. Patent No. 4,933,294 issued June 12, 1990; W091/05264 published April 18, 1991; U.S. Patent 5,401,638 issued March 28, 1995; and Sias et al. J. Immunol. Methods 132: 73-80 (1990)). Aside from the above assays, various in vivo assays are available to the skilled practitioner. For example, one may expose cells within the body of the patient to an antibody which is optionally labeled with a detectable label, e.g. a radioactive isotope, and binding of the antibody to cells in the patient can be evaluated, e.g. by external scanning for radioactivity or by analyzing a biopsy taken from a patient previously exposed to the antibody.
Conversely, a cancer which "does not overexpress HER2 receptor" is one which does not express higher than normal levels of HER2 receptor compared to a noncancerous cell of the same tissue type.
A cancer which "overexpresses" a HER ligand is one which produces significantly higher levels of that ligand compared to a noncancerous cell of the same tissue type. Such overexpression may be caused by gene amplification or by increased transcription or translation. Overexpression of the HER ligand may be determined diagnostically by evaluating levels of the ligand (or nucleic acid encoding it) in the patient, e.g. in a tumor biopsy or by various diagnostic assays such as the IHC, FISH, southern blotting, PCR or in vivo assays described above.
The term "cytotoxic agent" as used herein refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells. The term is intended to include radioactive isotopes (e.g. At , I , I , Y , Re , Re , Sm , Bi , P and radioactive isotopes of Lu), chemotherapeutic agents, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof.
A "chemotherapeutic agent" is a chemical compound useful in the treatment of cancer. Examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide (CYTOXAN );
alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelarnine; acetogenins (especially bullatacin and bullatacinone); delta-9-tetrahydrocannabinol (dronabinol, MARLNOL ); beta-lapachone;
lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topotecan (HYCAMTIN ), CPT- 11 (irinotecan, CAMPTOSAR ), acetylcamptothecin, scopolectin, and 9-aminocamptothecin); bryostatin; callystatin; CC-1065 (including its adozelesia, carzelesin and bizelesin synthetic analogues); podophyllotoxin; podophyllinic acid; teniposide;
cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB 1-TM1);
eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfarnide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranirnnustine; antibiotics such as the enediyne antibiotics (e. g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Agnew, Chem Intl. Ed. Engl., 33: 183-186 (1994)); dynemicin, including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinornycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin (including ADRIAMYCIN , morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin, doxorubicin HCl liposome injection (DOXIL ), liposomal doxorubicin TLC D-99 (MYOCET ), peglylated liposomal doxorubicin (CAELYX ), and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate, gemcitabine (GEMZAR ), tegafur (UFTORAL ), capecitabine (XELODA ), an epothilone, and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone;
aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine;
demecolcine; diaziquone;
elfornithine; elliptinium acetate; etoglucid; gallium nitrate; hydroxyurea;
lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol;
nitraerine; pentostatin;
phenamet; pirarubicin; losoxantrone; 2-ethylhydrazide; procarbazine; PSK
polysaccharide complex (JHS
Natural Products, Eugene, OR); razoxane; rhizoxin; sizofiran; spirogermanium;
tenuazonic acid; triaziquone;
2,2',2"-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine);
urethan; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman;
gacytosine; arabinoside ("Ara-C");
thiotepa; taxoid, e.g., paclitaxel (TAXOL ), albumin-engineered nanoparticle formulation of paclitaxel (ABRAXANETM), and docetaxel (TAXOTERE ); chloranbucil; 6-thioguanine;
mercaptopurine; methotrexate;
platinum agents such as cisplatin, oxaliplatin, and carboplatin; vincas, which prevent tubulin polymerization from forming microtubules, including vinblastine (VELBAN ), vincristine (ONCOVIN ), vindesine (ELDISINE , FILDESIN ), and vinorelbine (NAVELBINE ); etoposide (VP-16);
ifosfamide; mitoxantrone;
leucovovin; novantrone; edatrexate; daunomycin; aminopterin; ibandronate;
topoisomerase inhibitor RFS 2000;
difluorometlhylornithine (DMFO); retinoids such as retinoic acid, including bexarotene (TARGRETIN );
bisphosphonates such as clodronate (for example, BONEFOS or OSTAC ), etidronate (DIDROCAL ), NE-58095, zoledronic acid/zoledronate (ZOMETA ), alendronate (FOSAMA.X ), pamidronate (AREDIA ), tiludronate (SKELID ), or risedronate (ACTONEL ); troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); antisense oligonucleotides, particularly those that inhibit expression of genes in signaling pathways implicated in aberrant cell proliferation, such as, for example, PKC-alpha, Raf, H-Ras, and epidermal growth factor receptor (EGF-R); vaccines such as THERATOPE vaccine and gene therapy vaccines, for example, ALLOVECTIN vaccine, LEUVECTIN vaccine, and VAXID vaccine; topoisomerase 1 inhibitor (e.g., LURTOTECAN ); rmRH (e.g., ABARELIX ); BAY439006 (sorafenib; Bayer); SU-11248 (Pfizer); perifosine, COX-2 inhibitor (e.g. celecoxib or etoricoxib), proteosome inhibitor (e.g.
PS341); bortezomib (VELCADE );
CCI-779; tipifarnib (R11577); orafenib, ABT5 10; Bcl-2 inhibitor such as oblimersen sodium (GENASENSE );
pixantrone; EGFR inhibitors (see definition below); tyrosine kinase inhibitors (see definition below); and pharmaceutically acceptable salts, acids or derivatives of any of the above;
as well as combinations of two or more of the above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, doxorubicin, vincristine, and prednisolone, and FOLFOX, an abbreviation for a treatment regimen with oxaliplatin (ELOXATINTM) combined with 5-FU and leucovovin.
Also included in this definition are anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens with mixed agonist/antagonist profile, including, tamoxifen (NOLVADEX ), 4-hydroxytamoxifen, toremifene (FARESTON ), idoxifene, droloxifene, raloxifene (EVISTA ), trioxifene, keoxifene, and selective estrogen receptor modulators (SERMs) such as SERM3;
pure anti-estrogens without agonist properties, such as fulvestrant (FASLODEX ), and EM800 (such agents may block estrogen receptor (ER) dimerization, inhibit DNA binding, increase ER turnover, and/or suppress ER levels); aromatase inhibitors, including steroidal aromatase inhibitors such as formestane and exemestane (AROMASIN ), and nonsteroidal aromatase inhibitors such as anastrazole (ARIMIDEX ), letrozole (FEMARA ) and aminoglutethimide, and other aromatase inhibitors including vorozole (RIVISOR ), megestrol acetate (MEGASE ), fadrozole, imidazole; lutenizing hormone-releaseing hormone agonists, including leuprolide (LUPRON and ELIGARD ), goserelin, buserelin, and tripterelin; sex steroids, including progestines such as megestrol acetate and medroxyprogesterone acetate, estrogens such as diethylstilbestrol and premarin, and androgens/retinoids such as fluoxymesterone, all transretionic acid and fenretinide; onapristone;
anti-progesterones; estrogen receptor down-regulators (ERDs); anti-androgens such as flutamide, nilutamide and bicalutamide; testolactone;
and pharmaceutically acceptable salts, acids or derivatives of any of the above; as well as combinations of two or more of the above.
As used herein, the term "EGFR-targeted drug" refers to a therapeutic agent that binds to EGFR and, optionally, inhibits EGFR activation. Examples of such agents include antibodies and small molecules that bind to EGFR. Examples of antibodies which bind to EGFR include MAb 579 (ATCC CRL
HB 8506), MAb 455 (ATCC CRL HB8507), MAb 225 (ATCC CRL 8508), MAb 528 (ATCC CRL 8509) (see, US
Patent No. 4,943, 533, Mendelsohn et al.) and variants thereof, such as chimerized 225 (C225 or Cetuximab; ERBUTIX ) and reshaped human 225 (H225) (see, WO 96/40210, Imclone Systems Inc.); antibodies that bind type II mutant EGFR (US Patent No. 5,212,290); humanized and chimeric antibodies that bind EGFR as described in US Patent No. 5,891,996; and human antibodies that bind EGFR, such as ABX-EGF (see W098/50433, Abgenix). The anti-EGFR antibody may be conjugated with a cytotoxic agent, thus generating an immunoconjugate (see, e.g., EP659,439A2, Merck Patent GmbH). Examples of small molecules that bind to EGFR
include ZD1839 or Gefitinib (IRESSATM; Astra Zeneca), CP-358774 or Erlotinib HCL (TARCEVATM;
Genentech/OSI) and AG1478, AG1571 (SU 5271; Sugen).
A "tyrosine kinase inhibitor"is a molecule which inhibits to some extent tyrosine kinase activity of a tyrosine kinase such as a HER receptor. Examples of such inhibitors include the EGFR-targeted drugs noted in the preceding paragraph as well as small molecule HER2 tyrosine kinase inhibitor such as TAK165 available from Takeda, dual-HER inhibitors such as EKB-569 (available from Wyeth) which preferentially binds EGFR
but inhibits both HER2 & EGFR-overexpressing cells, GW572016 (available from Glaxo) an oral HER2 and EGFR tyrosine kinase inhibitor, and PKI-166 (available from Novartis); pan-HER
inhibitors such as canertinib (CI-1033; Pharmacia); Raf-1 inhibitors such as antisense agent ISIS-5132 available from ISIS Pharmaceuticals which inhibits Raf-1 signaling; non-HER targeted TK inhibitors such as Imatinib mesylate (GleevacTM) available from Glaxo; MAPK extracellular regulated kinase I inhibitor CI-1040 (available from Pharmacia); quinazolines, such as PD 153035,4-(3-chloroanilino) quinazoline; pyridopyrimidines;
pyrimidopyrimidines;
"Treatment" refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment include those already with the disease as well as those in which the disease is to be prevented.
Hence, the patient to be treated herein may have been diagnosed as having the disease or may be predisposed or susceptible to the disease.
The terms "cancer" and "cancerous" refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Exarrrples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma (including medulloblastoma and retinoblastoma), sarcoma (including liposarcoma and synovial cell sarcoma), neuroendocrine tumors (including carcinoid tumors, gastrinoma,and islet cell cancer), mesothelioma, schwannoma (including acoustic neuroma), meningioma, adenocarcinoma, melanoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g. epithelial squamous cell cancer), lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, testicular cancer, esophagael cancer, tumors of the biliary tract, as well as head and neck cancer.
The term "effective amount" refers to an amount of a drug effective to a disease in the patient. Where the disease is cancer, the effective amount of the drug may reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the cancer.
To the extent the drug may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic. The effective amount may extend progression free survival, result in an objective response (including a partial response, PR, or complete response, CR), increase overall survival time, and/or improve one or more symptoms of cancer.
A "HER2-expressing cancer" is one comprising cells which have HER2 protein present at their cell surface.
A cancer which "overexpresses" a HER receptor is one which has significantly higher levels of a HER
receptor, such as HER2, at the cell surface thereof, compared to a noncancerous cell of the same tissue type.
Such overexpression may be caused by gene amplification or by increased transcription or translation. HER
receptor overexpression may be determined in a diagnostic or prognostic assay by evaluating increased levels of the HER protein present on the surface of a cell (e.g. via an immunohistochemistry assay; IHC). Alternatively, or additionally, one may measure levels of HER-encoding nucleic acid in the cell, e.g. via fluorescent in situ hybridization (FISH; see W098/45479 published October, 1998), southern blotting, or polymerase chain reaction (PCR) techniques, such as real time quantitative PCR (RT-PCR). One may also study HER receptor overexpression by measuring shed antigen (e.g., HER extracellular domain) in a biological fluid such as serum (see, e.g., U.S. Patent No. 4,933,294 issued June 12, 1990; W091/05264 published April 18, 1991; U.S. Patent 5,401,638 issued March 28, 1995; and Sias et al. J. Immunol. Methods 132: 73-80 (1990)). Aside from the above assays, various in vivo assays are available to the skilled practitioner. For example, one may expose cells within the body of the patient to an antibody which is optionally labeled with a detectable label, e.g. a radioactive isotope, and binding of the antibody to cells in the patient can be evaluated, e.g. by external scanning for radioactivity or by analyzing a biopsy taken from a patient previously exposed to the antibody.
Conversely, a cancer which "does not overexpress HER2 receptor" is one which does not express higher than normal levels of HER2 receptor compared to a noncancerous cell of the same tissue type.
A cancer which "overexpresses" a HER ligand is one which produces significantly higher levels of that ligand compared to a noncancerous cell of the same tissue type. Such overexpression may be caused by gene amplification or by increased transcription or translation. Overexpression of the HER ligand may be determined diagnostically by evaluating levels of the ligand (or nucleic acid encoding it) in the patient, e.g. in a tumor biopsy or by various diagnostic assays such as the IHC, FISH, southern blotting, PCR or in vivo assays described above.
The term "cytotoxic agent" as used herein refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells. The term is intended to include radioactive isotopes (e.g. At , I , I , Y , Re , Re , Sm , Bi , P and radioactive isotopes of Lu), chemotherapeutic agents, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof.
A "chemotherapeutic agent" is a chemical compound useful in the treatment of cancer. Examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide (CYTOXAN );
alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelarnine; acetogenins (especially bullatacin and bullatacinone); delta-9-tetrahydrocannabinol (dronabinol, MARLNOL ); beta-lapachone;
lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topotecan (HYCAMTIN ), CPT- 11 (irinotecan, CAMPTOSAR ), acetylcamptothecin, scopolectin, and 9-aminocamptothecin); bryostatin; callystatin; CC-1065 (including its adozelesia, carzelesin and bizelesin synthetic analogues); podophyllotoxin; podophyllinic acid; teniposide;
cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB 1-TM1);
eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfarnide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranirnnustine; antibiotics such as the enediyne antibiotics (e. g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Agnew, Chem Intl. Ed. Engl., 33: 183-186 (1994)); dynemicin, including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinornycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin (including ADRIAMYCIN , morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin, doxorubicin HCl liposome injection (DOXIL ), liposomal doxorubicin TLC D-99 (MYOCET ), peglylated liposomal doxorubicin (CAELYX ), and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate, gemcitabine (GEMZAR ), tegafur (UFTORAL ), capecitabine (XELODA ), an epothilone, and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone;
aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine;
demecolcine; diaziquone;
elfornithine; elliptinium acetate; etoglucid; gallium nitrate; hydroxyurea;
lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol;
nitraerine; pentostatin;
phenamet; pirarubicin; losoxantrone; 2-ethylhydrazide; procarbazine; PSK
polysaccharide complex (JHS
Natural Products, Eugene, OR); razoxane; rhizoxin; sizofiran; spirogermanium;
tenuazonic acid; triaziquone;
2,2',2"-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine);
urethan; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman;
gacytosine; arabinoside ("Ara-C");
thiotepa; taxoid, e.g., paclitaxel (TAXOL ), albumin-engineered nanoparticle formulation of paclitaxel (ABRAXANETM), and docetaxel (TAXOTERE ); chloranbucil; 6-thioguanine;
mercaptopurine; methotrexate;
platinum agents such as cisplatin, oxaliplatin, and carboplatin; vincas, which prevent tubulin polymerization from forming microtubules, including vinblastine (VELBAN ), vincristine (ONCOVIN ), vindesine (ELDISINE , FILDESIN ), and vinorelbine (NAVELBINE ); etoposide (VP-16);
ifosfamide; mitoxantrone;
leucovovin; novantrone; edatrexate; daunomycin; aminopterin; ibandronate;
topoisomerase inhibitor RFS 2000;
difluorometlhylornithine (DMFO); retinoids such as retinoic acid, including bexarotene (TARGRETIN );
bisphosphonates such as clodronate (for example, BONEFOS or OSTAC ), etidronate (DIDROCAL ), NE-58095, zoledronic acid/zoledronate (ZOMETA ), alendronate (FOSAMA.X ), pamidronate (AREDIA ), tiludronate (SKELID ), or risedronate (ACTONEL ); troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); antisense oligonucleotides, particularly those that inhibit expression of genes in signaling pathways implicated in aberrant cell proliferation, such as, for example, PKC-alpha, Raf, H-Ras, and epidermal growth factor receptor (EGF-R); vaccines such as THERATOPE vaccine and gene therapy vaccines, for example, ALLOVECTIN vaccine, LEUVECTIN vaccine, and VAXID vaccine; topoisomerase 1 inhibitor (e.g., LURTOTECAN ); rmRH (e.g., ABARELIX ); BAY439006 (sorafenib; Bayer); SU-11248 (Pfizer); perifosine, COX-2 inhibitor (e.g. celecoxib or etoricoxib), proteosome inhibitor (e.g.
PS341); bortezomib (VELCADE );
CCI-779; tipifarnib (R11577); orafenib, ABT5 10; Bcl-2 inhibitor such as oblimersen sodium (GENASENSE );
pixantrone; EGFR inhibitors (see definition below); tyrosine kinase inhibitors (see definition below); and pharmaceutically acceptable salts, acids or derivatives of any of the above;
as well as combinations of two or more of the above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, doxorubicin, vincristine, and prednisolone, and FOLFOX, an abbreviation for a treatment regimen with oxaliplatin (ELOXATINTM) combined with 5-FU and leucovovin.
Also included in this definition are anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens with mixed agonist/antagonist profile, including, tamoxifen (NOLVADEX ), 4-hydroxytamoxifen, toremifene (FARESTON ), idoxifene, droloxifene, raloxifene (EVISTA ), trioxifene, keoxifene, and selective estrogen receptor modulators (SERMs) such as SERM3;
pure anti-estrogens without agonist properties, such as fulvestrant (FASLODEX ), and EM800 (such agents may block estrogen receptor (ER) dimerization, inhibit DNA binding, increase ER turnover, and/or suppress ER levels); aromatase inhibitors, including steroidal aromatase inhibitors such as formestane and exemestane (AROMASIN ), and nonsteroidal aromatase inhibitors such as anastrazole (ARIMIDEX ), letrozole (FEMARA ) and aminoglutethimide, and other aromatase inhibitors including vorozole (RIVISOR ), megestrol acetate (MEGASE ), fadrozole, imidazole; lutenizing hormone-releaseing hormone agonists, including leuprolide (LUPRON and ELIGARD ), goserelin, buserelin, and tripterelin; sex steroids, including progestines such as megestrol acetate and medroxyprogesterone acetate, estrogens such as diethylstilbestrol and premarin, and androgens/retinoids such as fluoxymesterone, all transretionic acid and fenretinide; onapristone;
anti-progesterones; estrogen receptor down-regulators (ERDs); anti-androgens such as flutamide, nilutamide and bicalutamide; testolactone;
and pharmaceutically acceptable salts, acids or derivatives of any of the above; as well as combinations of two or more of the above.
As used herein, the term "EGFR-targeted drug" refers to a therapeutic agent that binds to EGFR and, optionally, inhibits EGFR activation. Examples of such agents include antibodies and small molecules that bind to EGFR. Examples of antibodies which bind to EGFR include MAb 579 (ATCC CRL
HB 8506), MAb 455 (ATCC CRL HB8507), MAb 225 (ATCC CRL 8508), MAb 528 (ATCC CRL 8509) (see, US
Patent No. 4,943, 533, Mendelsohn et al.) and variants thereof, such as chimerized 225 (C225 or Cetuximab; ERBUTIX ) and reshaped human 225 (H225) (see, WO 96/40210, Imclone Systems Inc.); antibodies that bind type II mutant EGFR (US Patent No. 5,212,290); humanized and chimeric antibodies that bind EGFR as described in US Patent No. 5,891,996; and human antibodies that bind EGFR, such as ABX-EGF (see W098/50433, Abgenix). The anti-EGFR antibody may be conjugated with a cytotoxic agent, thus generating an immunoconjugate (see, e.g., EP659,439A2, Merck Patent GmbH). Examples of small molecules that bind to EGFR
include ZD1839 or Gefitinib (IRESSATM; Astra Zeneca), CP-358774 or Erlotinib HCL (TARCEVATM;
Genentech/OSI) and AG1478, AG1571 (SU 5271; Sugen).
A "tyrosine kinase inhibitor"is a molecule which inhibits to some extent tyrosine kinase activity of a tyrosine kinase such as a HER receptor. Examples of such inhibitors include the EGFR-targeted drugs noted in the preceding paragraph as well as small molecule HER2 tyrosine kinase inhibitor such as TAK165 available from Takeda, dual-HER inhibitors such as EKB-569 (available from Wyeth) which preferentially binds EGFR
but inhibits both HER2 & EGFR-overexpressing cells, GW572016 (available from Glaxo) an oral HER2 and EGFR tyrosine kinase inhibitor, and PKI-166 (available from Novartis); pan-HER
inhibitors such as canertinib (CI-1033; Pharmacia); Raf-1 inhibitors such as antisense agent ISIS-5132 available from ISIS Pharmaceuticals which inhibits Raf-1 signaling; non-HER targeted TK inhibitors such as Imatinib mesylate (GleevacTM) available from Glaxo; MAPK extracellular regulated kinase I inhibitor CI-1040 (available from Pharmacia); quinazolines, such as PD 153035,4-(3-chloroanilino) quinazoline; pyridopyrimidines;
pyrimidopyrimidines;
pyrrolopyrimidines, such as CGP 59326, CGP 60261 and CGP 62706;
pyrazolopyrimidines, 4-(phenylamino)-7H-pyrrolo[2,3-d] pyrimidines; curcumin (diferuloyl methane, 4,5-bis (4-fluoroanilino)phthalimide);
tyrphostines containing nitrothiophene moieties; PD-0183805 (Warner-Larnber);
antisense molecules (e.g. those that bind to HER-encoding nucleic acid); quinoxalines (US Patent No.
5,804,396); tryphostins (US Patent No.
5,804,396); ZD6474 (Astra Zeneca); PTK-787 (Novartis/Schering AG); pan-HER
inhibitors such as CI-1033 (Pfizer); Affinitac (ISIS 3521; Isis/Lilly); Imatinib mesylate (Gleevac;
Novartis); PKI 166 (Novartis); GW2016 (Glaxo SmithKline); CI-1033 (Pfizer); EKB-569 (Wyeth); Semaxinib (Sugen);
ZD6474 (AstraZeneca); PTK-787 (Novartis/Schering AG); INC-1011 (Imclone); or as described in any of the following patent publications:
US Patent No. 5,804,396; W099/09016 (American Cyanimid); W098/43960 (American Cyanamid);
W097/38983 (Warner Lambert); W099/06378 (Warner Lambert); W099/06396 (Warner Lambert);
W096/30347 (Pfizer, Inc); W096/33978 (Zeneca); W096/3397 (Zeneca); and W096/33980 (Zeneca).
An "anti-angiogenic agent" refers to a compound which blocks, or interferes with to some degree, the development of blood vessels. The anti-angiogenic factor may, for instance, be a small molecule or antibody that binds to a growth factor or growth factor receptor involved in promoting angiogenesis. The preferred anti-angiogenic factor herein is an antibody that binds to Vascular Endothelial Growth Factor (VEGF), such as Bevacizumab (AVASTIN ).
The term "cytokine" is a generic term for proteins released by one cell population which act on another cell as intercellular mediators. Examples of such cytokines are lymphokiries, monokines, and traditional polypeptide hormones. Included among the cytokines are growth hormone such as human growth hormone, N-methionyl human growth hormone, and bovine growth hormone; parathyroid hormone; thyroxine; insulin;
proinsulin; relaxin; prorelaxin; glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH); hepatic growth factor; fibroblast growth factor;
prolactin; placental lactogen; tumor necrosis factor-a and -(3; mullerian-inhibiting substance; mouse gonadotropin-associated peptide; inhibin; activin; vascular endothelial growth factor; integrin; thrombopoietin (TPO); nerve growth factors such as NGF-(3; platelet-growth factor;
transforming growth factors (TGFs) such as TGF-a and TGF-(3; insulin-like growth factor-I and -II; erythropoietin (EPO);
osteoinductive factors; interferons such as interferon-a, -(3, and -y; colony stimulating factors (CSFs) such as macrophage-CSF (M-CSF);
granulocyte-macrophage-CSF (GM-CSF); and granulocyte-CSF (G-CSF); interleukins (ILs) such as IL-1, IL-1a, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12; a tumor necrosis factor such as TNF-a or TNF-(3; and other polypeptide factors including LIF and kit ligand (KL). As used herein, the term cytokine includes proteins from natural sources or from recombinant cell culture and biologically active equivalents of the native sequence cytokines.
The antibody which is formulated is preferably essentially pure and desirably essentially homogeneous (i.e. free from contaminating proteins etc). "Essentially pure" antibody means a composition comprising at least about 90% by weight of the antibody, based on total weight of the composition, preferably at least about 95% by weight. "Essentially homogeneous" antibody means a composition comprising at least about 99% by weight of antibody, based on total weight of the composition.
A "B-cell surface marker" or "B-cell surface antigen" herein is an antigen expressed on the surface of a B cell that can be targeted with an antibody that binds thereto. Exemplary B-cell surface markers include the CD10, CD19, CD20, CD21, CD22, CD23, CD24, CD37, CD40, CD53, CD72, CD73, CD74, CDw75, CDw76, CD77, CDw78, CD79a, CD79b, CD80, CD81, CD82, CD83, CDw84, CD85 and CD86 leukocyte surface markers (for descriptions, see The Leukocyte Antigen Facts Book, 2d Edition.
1997, ed. Barclay et al.
Academic Press, Harcourt Brace & Co., New York). Other B-cell surface markers include RP105, FcRH2, B-cell CR2, CCR6, P2X5, HLA-DOB, CXCR5, FCER2, BR3, Btig, NAG14, SLGC16270, FCRHI, IRTA2, ATWD578, FcRH3, IRTA1, FcRH6, BCMA, and 239287. The B-cell surface marker of particular interest herein is preferentially expressed on B cells compared to other non-B-cell tissues of a mammal and may be expressed on both precursor B cells and mature B cells. The preferred B-cell surface marker herein is CD20 or BR3.
The "CD20" antigen, or "CD20," is an about 35-kDa, non-glycosylated phosphoprotein found on the surface of greater than 90% of B cells from peripheral blood or lymphoid organs. CD20 is present on both normal B cells as well as malignant B cells, but is not expressed on stem cells. Other names for CD20 in the literature include "B-lymphocyte-restricted antigen" and "Bp35". The CD20 antigen is described in Clark et al.
Proc. Natl. Acad. Sci. (USA) 82:1766 (1985), for example.
Purely for the purposes herein, "humanized 2H7" refers to a humanized variant of the 2H7 antibody whose CDR sequences are disclosed in US Patent No. 5,500,362 (Figs. 5 and 6).
Examples of humanized 2H7 antibodies herein include the variants described in W02004/056312, as well as other variants, including, but not limited to: ZIH7v16, 2H7v31, 2H7v73, 2H7v75, 2H7v96, 2H7v114, 2H7v115, 2H7v116, 2H7v138, 2147v477, 2H7075, etc.
In one embodiment, the humanized 2H7 antibody comprises one, two, three, four, five or six of the following CDR sequences:
CDR Ll sequence RASSSVSYXH wherein X is M or L (SEQ ID No. 67), for example SEQ ID No. 57 (Fig.
18A), CDR L2 sequence of SEQ ID No. 58 (Fig. i SA), CDR L3 sequence QQWXFNPPT wherein X is S or A (SEQ ID No. 68), for example SEQ
ID No. 59 (Pig. 18A), CDR H1 sequence of SEQ ID No. 60 (Fig. 18B), CDR H2 sequence of AIYPGNGXTSYNQKFKG wherein X is D or A (SEQ ID No. 69), for example SI/Q ID
No. 61 (Fig. 18B), and CDR H3 sequence of VVYYSXXYWYFDV wherein the X at position 6 is N, A, Y, W or D, and the X at position 7 is S or R (SEQ ID No. 70), for example SEQ ID No. 62 (Fig. 18B).
The CDR sequences above are generally present within human variable light and variable heavy framework sequences, such as substantially the human consensus FR residues of human light chain kappa subgroup I (VLicI), and substantially the human consensus FR residues of human heavy chain subgroup III
(VHIII). See also WO 2004/056312 (Lowman et al.).
The variable heavy region may be joined to a human IgG chain constant region, wherein the region may be, for example, IgGl or IgG3, including native sequence and variant constant regions.
In a preferred embodiment, such antibody comprises the variable heavy domain sequence of SBQ ID
No. 29 (v16, as shown in Fig. 18B), optionally also comprising the variable light domain sequence of SBQ ID
No. 26 (v16, as shown in Fig. 18A), which optionally comprises one or more amino acid substitution(s) at positions 56, 100, and/or 100a, e.g. D56A, N100A or N100Y, and/or S100aR in the variable heavy domain and one or more amino acid substitution(s) at positions 32 and/or 92, e.g. M32L
and/or S92A, in the variable light domain. Preferably, the antibody is an intact antibody comprising the light chain amino acid sequences of SEQ
ID Nos. 63 or 64, and heavy chain amino acid sequences of SEQ ID No. 65, 66, 71 or 72.
A preferred humanized 2H7 antibody is ocrelizumab (Genentech).
The antibody herein may further comprise at least one amino acid substitution in the Fc region that improves ADCC activity, such as one wherein the amino acid substitutions are at positions 298, 333, and 334, preferably S298A, E333A, and K334A, using Eu numbering of heavy chain residues. See also US Patent No.
6,737,056B 1, Presta.
Any of these antibodies may comprise at least one substitution in the Fc region that improves FcRn binding or serum half-life, for example a substitution at heavy chain position 434, such as N434W. See also US
Patent No. 6,737,056B 1, Presta.
Any of these antibodies may further comprise at least one amino acid substitution in the Fc region that increases CDC activity, for example, comprising at least a substitution at position 326, preferably K326A or K326W. See also US Patent No. 6,528,624B 1 (Idusogie et al.).
Some preferred humanized 2H7 variants are those comprising the variable light domain of SEQ ID No.
26 and the variable heavy domain of SEQ ID No. 29, including those with or without substitutions in an Fc region (if present), and those comprising a variable heavy domain with alteration N100A; or D56A and N100A;
or D56A, N100Y, and S100aR; in SEQ ID No. 29 and a variable light domain with alteration M32L; or S92A; or M32L and S92A; in SEQ ID No. 26.
M34 in the variable heavy chain of 2H7v16 has been identified as a potential source of antibody stability and is another potential candidate for substitution.
In a summary of some various preferred embodiments of the invention, the variable region of variants based on 2H7v16 comprise the amino acid sequences of v16 except at the positions of amino acid substitutions that are indicated in the Table below. Unless otherwise indicated, the 2H7 variants will have the same light chain as that of v16.
Exemplary Humanized 2H7 Antibody Variants 2H7 Heavy chain Light chain Fc changes Version (VH) changes (VL) changes 16 for reference -31 S298A, E333A, K334A
75 N100A M32L S298A, E333A, K334A
96 D56A,N100A S92A
114 D56A, N100A M32L, S92A S298A, E333A, K334A
115 D56A, N100A M32L, S92A S298A, E333A, K334A, E356D, M358L
116 D56A, N100A M32L, S92A S298A, K334A, K322A
138 D56A, N100A M32L, S92A S298A, E333A, K334A, K326A
477 D56A, N100A M32L, S92A S298A, E333A, K334A, K326A, N434W
588 S298A, E333A, K334A, K326A
D56A, N100Y, 511 S100aR M32L, S92A S298A, E333A, K334A, K326A
pyrazolopyrimidines, 4-(phenylamino)-7H-pyrrolo[2,3-d] pyrimidines; curcumin (diferuloyl methane, 4,5-bis (4-fluoroanilino)phthalimide);
tyrphostines containing nitrothiophene moieties; PD-0183805 (Warner-Larnber);
antisense molecules (e.g. those that bind to HER-encoding nucleic acid); quinoxalines (US Patent No.
5,804,396); tryphostins (US Patent No.
5,804,396); ZD6474 (Astra Zeneca); PTK-787 (Novartis/Schering AG); pan-HER
inhibitors such as CI-1033 (Pfizer); Affinitac (ISIS 3521; Isis/Lilly); Imatinib mesylate (Gleevac;
Novartis); PKI 166 (Novartis); GW2016 (Glaxo SmithKline); CI-1033 (Pfizer); EKB-569 (Wyeth); Semaxinib (Sugen);
ZD6474 (AstraZeneca); PTK-787 (Novartis/Schering AG); INC-1011 (Imclone); or as described in any of the following patent publications:
US Patent No. 5,804,396; W099/09016 (American Cyanimid); W098/43960 (American Cyanamid);
W097/38983 (Warner Lambert); W099/06378 (Warner Lambert); W099/06396 (Warner Lambert);
W096/30347 (Pfizer, Inc); W096/33978 (Zeneca); W096/3397 (Zeneca); and W096/33980 (Zeneca).
An "anti-angiogenic agent" refers to a compound which blocks, or interferes with to some degree, the development of blood vessels. The anti-angiogenic factor may, for instance, be a small molecule or antibody that binds to a growth factor or growth factor receptor involved in promoting angiogenesis. The preferred anti-angiogenic factor herein is an antibody that binds to Vascular Endothelial Growth Factor (VEGF), such as Bevacizumab (AVASTIN ).
The term "cytokine" is a generic term for proteins released by one cell population which act on another cell as intercellular mediators. Examples of such cytokines are lymphokiries, monokines, and traditional polypeptide hormones. Included among the cytokines are growth hormone such as human growth hormone, N-methionyl human growth hormone, and bovine growth hormone; parathyroid hormone; thyroxine; insulin;
proinsulin; relaxin; prorelaxin; glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH); hepatic growth factor; fibroblast growth factor;
prolactin; placental lactogen; tumor necrosis factor-a and -(3; mullerian-inhibiting substance; mouse gonadotropin-associated peptide; inhibin; activin; vascular endothelial growth factor; integrin; thrombopoietin (TPO); nerve growth factors such as NGF-(3; platelet-growth factor;
transforming growth factors (TGFs) such as TGF-a and TGF-(3; insulin-like growth factor-I and -II; erythropoietin (EPO);
osteoinductive factors; interferons such as interferon-a, -(3, and -y; colony stimulating factors (CSFs) such as macrophage-CSF (M-CSF);
granulocyte-macrophage-CSF (GM-CSF); and granulocyte-CSF (G-CSF); interleukins (ILs) such as IL-1, IL-1a, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12; a tumor necrosis factor such as TNF-a or TNF-(3; and other polypeptide factors including LIF and kit ligand (KL). As used herein, the term cytokine includes proteins from natural sources or from recombinant cell culture and biologically active equivalents of the native sequence cytokines.
The antibody which is formulated is preferably essentially pure and desirably essentially homogeneous (i.e. free from contaminating proteins etc). "Essentially pure" antibody means a composition comprising at least about 90% by weight of the antibody, based on total weight of the composition, preferably at least about 95% by weight. "Essentially homogeneous" antibody means a composition comprising at least about 99% by weight of antibody, based on total weight of the composition.
A "B-cell surface marker" or "B-cell surface antigen" herein is an antigen expressed on the surface of a B cell that can be targeted with an antibody that binds thereto. Exemplary B-cell surface markers include the CD10, CD19, CD20, CD21, CD22, CD23, CD24, CD37, CD40, CD53, CD72, CD73, CD74, CDw75, CDw76, CD77, CDw78, CD79a, CD79b, CD80, CD81, CD82, CD83, CDw84, CD85 and CD86 leukocyte surface markers (for descriptions, see The Leukocyte Antigen Facts Book, 2d Edition.
1997, ed. Barclay et al.
Academic Press, Harcourt Brace & Co., New York). Other B-cell surface markers include RP105, FcRH2, B-cell CR2, CCR6, P2X5, HLA-DOB, CXCR5, FCER2, BR3, Btig, NAG14, SLGC16270, FCRHI, IRTA2, ATWD578, FcRH3, IRTA1, FcRH6, BCMA, and 239287. The B-cell surface marker of particular interest herein is preferentially expressed on B cells compared to other non-B-cell tissues of a mammal and may be expressed on both precursor B cells and mature B cells. The preferred B-cell surface marker herein is CD20 or BR3.
The "CD20" antigen, or "CD20," is an about 35-kDa, non-glycosylated phosphoprotein found on the surface of greater than 90% of B cells from peripheral blood or lymphoid organs. CD20 is present on both normal B cells as well as malignant B cells, but is not expressed on stem cells. Other names for CD20 in the literature include "B-lymphocyte-restricted antigen" and "Bp35". The CD20 antigen is described in Clark et al.
Proc. Natl. Acad. Sci. (USA) 82:1766 (1985), for example.
Purely for the purposes herein, "humanized 2H7" refers to a humanized variant of the 2H7 antibody whose CDR sequences are disclosed in US Patent No. 5,500,362 (Figs. 5 and 6).
Examples of humanized 2H7 antibodies herein include the variants described in W02004/056312, as well as other variants, including, but not limited to: ZIH7v16, 2H7v31, 2H7v73, 2H7v75, 2H7v96, 2H7v114, 2H7v115, 2H7v116, 2H7v138, 2147v477, 2H7075, etc.
In one embodiment, the humanized 2H7 antibody comprises one, two, three, four, five or six of the following CDR sequences:
CDR Ll sequence RASSSVSYXH wherein X is M or L (SEQ ID No. 67), for example SEQ ID No. 57 (Fig.
18A), CDR L2 sequence of SEQ ID No. 58 (Fig. i SA), CDR L3 sequence QQWXFNPPT wherein X is S or A (SEQ ID No. 68), for example SEQ
ID No. 59 (Pig. 18A), CDR H1 sequence of SEQ ID No. 60 (Fig. 18B), CDR H2 sequence of AIYPGNGXTSYNQKFKG wherein X is D or A (SEQ ID No. 69), for example SI/Q ID
No. 61 (Fig. 18B), and CDR H3 sequence of VVYYSXXYWYFDV wherein the X at position 6 is N, A, Y, W or D, and the X at position 7 is S or R (SEQ ID No. 70), for example SEQ ID No. 62 (Fig. 18B).
The CDR sequences above are generally present within human variable light and variable heavy framework sequences, such as substantially the human consensus FR residues of human light chain kappa subgroup I (VLicI), and substantially the human consensus FR residues of human heavy chain subgroup III
(VHIII). See also WO 2004/056312 (Lowman et al.).
The variable heavy region may be joined to a human IgG chain constant region, wherein the region may be, for example, IgGl or IgG3, including native sequence and variant constant regions.
In a preferred embodiment, such antibody comprises the variable heavy domain sequence of SBQ ID
No. 29 (v16, as shown in Fig. 18B), optionally also comprising the variable light domain sequence of SBQ ID
No. 26 (v16, as shown in Fig. 18A), which optionally comprises one or more amino acid substitution(s) at positions 56, 100, and/or 100a, e.g. D56A, N100A or N100Y, and/or S100aR in the variable heavy domain and one or more amino acid substitution(s) at positions 32 and/or 92, e.g. M32L
and/or S92A, in the variable light domain. Preferably, the antibody is an intact antibody comprising the light chain amino acid sequences of SEQ
ID Nos. 63 or 64, and heavy chain amino acid sequences of SEQ ID No. 65, 66, 71 or 72.
A preferred humanized 2H7 antibody is ocrelizumab (Genentech).
The antibody herein may further comprise at least one amino acid substitution in the Fc region that improves ADCC activity, such as one wherein the amino acid substitutions are at positions 298, 333, and 334, preferably S298A, E333A, and K334A, using Eu numbering of heavy chain residues. See also US Patent No.
6,737,056B 1, Presta.
Any of these antibodies may comprise at least one substitution in the Fc region that improves FcRn binding or serum half-life, for example a substitution at heavy chain position 434, such as N434W. See also US
Patent No. 6,737,056B 1, Presta.
Any of these antibodies may further comprise at least one amino acid substitution in the Fc region that increases CDC activity, for example, comprising at least a substitution at position 326, preferably K326A or K326W. See also US Patent No. 6,528,624B 1 (Idusogie et al.).
Some preferred humanized 2H7 variants are those comprising the variable light domain of SEQ ID No.
26 and the variable heavy domain of SEQ ID No. 29, including those with or without substitutions in an Fc region (if present), and those comprising a variable heavy domain with alteration N100A; or D56A and N100A;
or D56A, N100Y, and S100aR; in SEQ ID No. 29 and a variable light domain with alteration M32L; or S92A; or M32L and S92A; in SEQ ID No. 26.
M34 in the variable heavy chain of 2H7v16 has been identified as a potential source of antibody stability and is another potential candidate for substitution.
In a summary of some various preferred embodiments of the invention, the variable region of variants based on 2H7v16 comprise the amino acid sequences of v16 except at the positions of amino acid substitutions that are indicated in the Table below. Unless otherwise indicated, the 2H7 variants will have the same light chain as that of v16.
Exemplary Humanized 2H7 Antibody Variants 2H7 Heavy chain Light chain Fc changes Version (VH) changes (VL) changes 16 for reference -31 S298A, E333A, K334A
75 N100A M32L S298A, E333A, K334A
96 D56A,N100A S92A
114 D56A, N100A M32L, S92A S298A, E333A, K334A
115 D56A, N100A M32L, S92A S298A, E333A, K334A, E356D, M358L
116 D56A, N100A M32L, S92A S298A, K334A, K322A
138 D56A, N100A M32L, S92A S298A, E333A, K334A, K326A
477 D56A, N100A M32L, S92A S298A, E333A, K334A, K326A, N434W
588 S298A, E333A, K334A, K326A
D56A, N100Y, 511 S100aR M32L, S92A S298A, E333A, K334A, K326A
One preferred humanized 2H7 comprises 2H7v16 variable light domain sequence:
DIQMTQSPSSLSAS VGDRVTITCRASSS VSYMHWYQQKPGKAPKPLIYAPSNLASG VPSRFSGSGSGTDF
TLTISSLQPEDFATYYCQQWSFNPPTFGQGTKVEIKR (SEQ ID No. 26);
and 2H7v 16 variable heavy domain sequence:
EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYNMHW VRQAPGKGLEW V GAIYPGNGDTSYNQKFKGR
FTISVDKSKNTLYLQMNSLRAEDTAVYYCARVVYYSNSYWYFDVW GQGTLVTVSS (SEQ ID No. 29).
Where the humanized 2H7vl6 antibody is an intact antibody, it may comprise the light chain amino acid sequence:
DIQMTQSPSSLSAS VGDRVTITCRASSS VSYMHWYQQKPGKAPKPLIYAPSNLASGVPSRFSGSGSGTDF
TLTISSLQPEDFATYYCQQWSFNPPTFGQGTKVEIKRTVAAPS VFIFPPSDEQLKSGTAS V VCLLNNFYPR
EAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFN
RGEC (SEQ ID No. 63);
and the heavy chain amino acid sequence of SEQ ID No. 65 or:
EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYNMHWVRQAPGKGLEW VGAIYPGNGDTSYNQKFKGR
FTIS VDKSKNTLYLQMNSLRAEDTAVYYCARV VYYSNSYWYFDVV~TGQGTLVTV SSASTKGPS VFPLAP
SSKSTSGGTAALGCLVKDYFPEPVTV SWNSGALTSGVHTFPAVLQSS GLYSLSS V VTVPS SSLGTQTYIC
NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKP KDTLMISRTPEVTC V V VD VSHE
DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI
SKAKGQPREPQVYTLPPSREEMTKNQV SLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID No. 71).
Another preferred humanized 2H7 antibody comprises 2H7v511 variable light domain sequence:
DIQMTQSPSSLSAS VGDRVTITCRASSSVSYLHWYQQKPGKAPKPLIYAPSNLASGVPSRFSGSGSGTDF
TLTISSLQPEDFATYYCQQWAFNPPTFGQGTKVEIKR (SEQ ID No. 73) and 2H7v511 variable heavy domain sequence:
EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYNMHWVRQAPGKGLEW VGAIYPGNGATSYNQKFKGR
FTISVDKSKNTLYLQMNSLRAEDTAVYYCARVVYYSYRYWYFDVWGQGTLVTVSS (SEQ ID No. 74).
Where the humanized 2H7v5 11 antibody is an intact antibody, it criay comprise the light chain amino acid sequence:
DIQMTQSPSSLSAS VGDRVTITCRASSS VSYLHWYQQKPGKAPKPLIYAPSNLASGVPSRFSGSGSGTDF
TLTISSLQPEDFATYYCQQWAFNPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPR
EAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFN
RGEC (SEQ ID No. 64) and the heavy chain amino acid sequence of SEQ ID No. 66 or:
EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYNMHWVRQAPGKGLEW VGAIYPGNGATSYNQKFKGR
FTIS VDKSKNTLYLQMNSLRAEDTAVYYCARV VYYSYRYWYFDV WGQGTLVTVSSASTKGPS VFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKV DKKVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPE VTC V V V D V SH
EDPEVKFNWYVDGVEVHNAKTKPREEQYNATYRV V S VLTVLHQDWLNGKEYKCKVSNAALPAPIAA
TISKAKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID No. 72).
DIQMTQSPSSLSAS VGDRVTITCRASSS VSYMHWYQQKPGKAPKPLIYAPSNLASG VPSRFSGSGSGTDF
TLTISSLQPEDFATYYCQQWSFNPPTFGQGTKVEIKR (SEQ ID No. 26);
and 2H7v 16 variable heavy domain sequence:
EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYNMHW VRQAPGKGLEW V GAIYPGNGDTSYNQKFKGR
FTISVDKSKNTLYLQMNSLRAEDTAVYYCARVVYYSNSYWYFDVW GQGTLVTVSS (SEQ ID No. 29).
Where the humanized 2H7vl6 antibody is an intact antibody, it may comprise the light chain amino acid sequence:
DIQMTQSPSSLSAS VGDRVTITCRASSS VSYMHWYQQKPGKAPKPLIYAPSNLASGVPSRFSGSGSGTDF
TLTISSLQPEDFATYYCQQWSFNPPTFGQGTKVEIKRTVAAPS VFIFPPSDEQLKSGTAS V VCLLNNFYPR
EAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFN
RGEC (SEQ ID No. 63);
and the heavy chain amino acid sequence of SEQ ID No. 65 or:
EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYNMHWVRQAPGKGLEW VGAIYPGNGDTSYNQKFKGR
FTIS VDKSKNTLYLQMNSLRAEDTAVYYCARV VYYSNSYWYFDVV~TGQGTLVTV SSASTKGPS VFPLAP
SSKSTSGGTAALGCLVKDYFPEPVTV SWNSGALTSGVHTFPAVLQSS GLYSLSS V VTVPS SSLGTQTYIC
NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKP KDTLMISRTPEVTC V V VD VSHE
DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI
SKAKGQPREPQVYTLPPSREEMTKNQV SLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID No. 71).
Another preferred humanized 2H7 antibody comprises 2H7v511 variable light domain sequence:
DIQMTQSPSSLSAS VGDRVTITCRASSSVSYLHWYQQKPGKAPKPLIYAPSNLASGVPSRFSGSGSGTDF
TLTISSLQPEDFATYYCQQWAFNPPTFGQGTKVEIKR (SEQ ID No. 73) and 2H7v511 variable heavy domain sequence:
EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYNMHWVRQAPGKGLEW VGAIYPGNGATSYNQKFKGR
FTISVDKSKNTLYLQMNSLRAEDTAVYYCARVVYYSYRYWYFDVWGQGTLVTVSS (SEQ ID No. 74).
Where the humanized 2H7v5 11 antibody is an intact antibody, it criay comprise the light chain amino acid sequence:
DIQMTQSPSSLSAS VGDRVTITCRASSS VSYLHWYQQKPGKAPKPLIYAPSNLASGVPSRFSGSGSGTDF
TLTISSLQPEDFATYYCQQWAFNPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASV VCLLNNFYPR
EAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFN
RGEC (SEQ ID No. 64) and the heavy chain amino acid sequence of SEQ ID No. 66 or:
EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYNMHWVRQAPGKGLEW VGAIYPGNGATSYNQKFKGR
FTIS VDKSKNTLYLQMNSLRAEDTAVYYCARV VYYSYRYWYFDV WGQGTLVTVSSASTKGPS VFPLA
PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKV DKKVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPE VTC V V V D V SH
EDPEVKFNWYVDGVEVHNAKTKPREEQYNATYRV V S VLTVLHQDWLNGKEYKCKVSNAALPAPIAA
TISKAKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID No. 72).
A "B-cell malignancy" herein includes non-Hodgkin's lymphoma (NHL), including low grade/follicular NHL, small lymphocytic (SL) NHL, intermediate grade/follicular NHL, intermediate grade diffuse NHL, high grade immunoblastic NHL, high grade lymphoblastic NHL, high grade small non-cleaved cell NHL, bulky disease NHL, mantle cell lymphoma, AIDS-related lymphoma, and Waldenstrom's Macroglobulinemia; leukemia, including acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), Hairy cell leukemia and chronic myeloblastic leukemia; and other hematologic malignancies. Such malignancies may be treated with antibodies directed against B-cell surface markers, such as CD20.
The term "non-Hodgkin's lymphoma" or "NHL", as used herein, refers to a cancer of the lymphatic system other than Hodgkin's lymphomas. Hodgkin's lymphomas can generally be distinguished from non-Hodgkin's lymphomas by the presence of Reed-Sternberg cells in Hodgkin's lymphomas and the absence of said cells in non-Hodgkin's lymphomas. Examples of non-Hodgkin's lymphomas encompassed by the term as used herein include any that would be identified as such by one skilled in the art (e.g., an oncologist or pathologist) in accordance with classification schemes known in the art, such as the Revised European-American Lymphoma (REAL) scheme as described in Color Atlas of Clinical Hematology, Third Edition; A. Victor Hoffbrand and John E. Pettit (eds.) (Harcourt Publishers Limited 2000) (see, in particular Fig. 11.57, 11.58 and/or 11.59). More specific examples include, but are not limited to, relapsed or refractory NHL, front line low grade NHL, Stage IIUIV NHL, chemotherapy resistant NHL, precursor B lymphoblastic leukemia and/or lymphoma, small lymphocytic lymphoma, B cell chronic lymphacytic leukemia and/or prolymphocytic leukemia and/or small lymphocytic lymphoma, B-cell prolymphocytic lymphoma, immunocytoma and/or lymphoplasmacytic lymphoma, marginal zone B cell lymphoma, splenic marginal zone lymphoma, extranodal marginal zone -MALT lymphoma, nodal marginal zone lymphoma, hairy cell leukemia, plasmacytoma and/or plasma cell myeloma, low grade/follicular lymphoma, intermediate grade/follicular NHL, mantle cell lymphoma, follicle center lymphoma (follicular), intermediate grade diffuse NHL, diffuse large B-cell lymphoma, aggressive NHL
(including aggressive front-line NHL and aggressive relapsed NHL), NHL
relapsing after or refractory to autologous stem cell transplantation, primary mediastinal large B-cell lymphoma, primary effusion lymphoma, high grade immunoblastic NHL, high grade lymphoblastic NHL, high grade small non-cleaved cell NHL, bulky disease NHL, Burkitt's lymphoma, precursor (peripheral) T-cell lymphoblastic leukemia and/or lymphoma, adult T-cell lymphoma and/or leukemia, T cell chronic lymphocytic leukemia and/or prolymphacytic leukemia, large granular lymphocytic leukemia, mycosis fungoides and/or Sezary syndrome, extranodal natural killer/T-cell (nasal type) lymphoma, enteropathy type T-cell lymphoma, hepatosplenic T-cell lymphoma, subcutaneous panniculitis like T-cell lymphoma, skin (cutaneous) lymphomas, anaplastic large cell lymphoma, angiocentric lymphoma, intestinal T cell lymphoma, peripheral T-cell (not otherwise specified) lymphoma and angioimmunoblastic T-cell lymphoma.
An "autoimmune disease" herein is a disease or disorder arising from and directed against an individual's own tissues or a co-segregate or manifestation thereof or resulting condition therefrom. Examples of autoimmune diseases or disorders include, but are not limited to arthritis (rheumatoid arthritis, juvenile-onset rheumatoid arthritis, osteoarthritis, psoriatic arthritis, and ankylosing spondylitis), psoriasis, dermatitis including atopic dermatitis, chronic idiopathic urticaria, including chronic autoimmune urticaria, polymyositis/dermatomyositis, toxic epidermal necrolysis, scleroderma (including systemic scleroderma), sclerosis such as progressive systemic sclerosis, inflammatory bowel disease (IBD) (for example, Crohn's disease, ulcerative colitis, autoimmune inflammatory bowel disease), pyoderma gangrenosum, erythema nodosum, primary sclerosing cholangitis, episcleritis), respiratory distress syndrome, including adult respiratory distress syndrome (ARDS), meningitis, IgE-mediated diseases such as anaphylaxis and allergic and atopic rhinitis, encephalitis such as Rasmussen's encephalitis, uveitis or autoimmune uveitis, colitis such as microscopic colitis and collagenous colitis, glomerulonephritis (GN) such as membranous GN
(membranous nephropathy), idiopathic membranous GN, membranous proliferative GN (MPGN), including Type I
and Type II, and rapidly progressive GN, allergic conditions, allergic reaction, eczema, asthma, conditions involving infiltration of T cells and chronic inflammatory responses, atherosclerosis, autoimmune myocarditis, leukocyte adhesion deficiency, systemic lupus erythematosus (SLE) such as cutaneous SLE, subacute cutaneous lupus erythematosus, lupus (including nephritis, cerebritis, pediatric, non-renal, discoid, alopecia), juvenile onset (Type I) diabetes mellitus, including pediatric insulin-dependent diabetes mellitus (IDDM), adult onset diabetes mellitus (Type II diabetes), multiple sclerosis (MS) such as spino-optical MS, immune responses associated with acute and delayed hypersensitivity mediated by cytokines and T-lymphocytes, tuberculosis, sarcoidosis, granulomatosis including lymphomatoid granulomatosis, Wegener's granulomatosis, agranulocytosis, vasculitis (including large vessel vasculitis (including polymyalgia rheumatica and giant cell (Takayasu's) arteritis), medium vessel vasculitis (including Kawasaki's disease and polyarteritis nodosa), CNS vasculitis, systemic necrotizing vasculitis, and ANCA-associated vasculitis , such as Churg-Strauss vasculitis or syndrome (CSS)), temporal arteritis, aplastic anemia, Coombs positive anemia, Diamond Blackfan anemia, hemolytic anemia or immune hemolytic anemia including autoimmune hemolytic anemia (AIHA), pernicious anemia, pure red cell aplasia (PRCA), Factor VIII
deficiency, hemophilia A, autoimmune neutropenia, pancytopenia, leukopenia, diseases involving leukocyte diapedesis, CNS inflammatory disorders, multiple organ injury syndrome, antigen-antibody complex mediated diseases, anti-glomerular basement membrane disease, anti-phospholipid antibody syndrome, allergic neuritis, Bechet's or Behcet's disease, Castleman's syndrome, Goodpasture's syndrome, Reynaud's syndrome, Sjogren's syndrome, Stevens-Johnson syndrome, pemphigoid such as pemphigoid bullous, pemphigus (including vulgaris, foliaceus, and pemphigus mucus-membrane pemphigoid), autoimmune polyendocrinopathies, Reiter's disease, immune complex nephritis, chronic neuropathy such as IgM polyneuropathies or IgM-mediated neuropathy, thrombocytopenia (as developed by myocardial infarction patients, for example), including thrombotic thrombocytopenic purpura (TTP) and autoimmune or immune-mediated thrombocytopenia such as idiopathic thrombocytopenic purpura (ITP) including chronic or acute ITP, autoimmune disease of the testis and ovary including autoimune orchitis and oophoritis, primary hypothyroidism, hypoparathyroidism, autoimmune endocrine diseases including thyroiditis such as autoimmune thyroiditis, chronic thyroiditis (Hashimoto's thyroiditis), or subacute thyroiditis, autoimmune thyroid disease, idiopathic hypothyroidism, Addison's disease, Grave's disease, polyglandular syndromes such as autoimmune polyglandular syndromes (or polyglandular endocrinopathy syndromes), paraneoplastic syndromes, including neurologic paraneoplastic syndromes such as Lambert-Eaton myasthenic syndrome or Eaton-Lambert syndrome, stiff-man or stiff-person syndrome, encephalomyelitis such as allergic encephalomyelitis, myasthenia gravis, cerebellar degeneration, limbic and/or brainstem encephalitis, neuromyotonia, opsoclonus or opsoclonus myoclonus syndrome (OMS), and sensory neuropathy, Sheehan's syndrome, autoimmune hepatitis, chronic hepatitis, lupoid hepatitis, chronic active hepatitis or autoimmune chronic active hepatitis, lymphoid interstitial pneumonitis, bronchiolitis obliterans (non-transplant) vs NSIP, Guillain-Barre syndrome, Berger's disease (IgA
nephropathy), primary biliary cirrhosis, celiac sprue (gluten enteropathy), refractory sprue, dermatitis herpetiformis, cryoglobulinemia, amylotrophic lateral sclerosis (ALS; Lou Gehrig's disease), coronary artery disease, autoimmune inner ear disease (AIED); or autoimmune hearing loss, opsoclonus myoclonus syndrome (OMS), polychondritis such as refractory polychondritis, pulmonary alveolar proteinosis, amyloidosis, giant cell hepatitis, scleritis, a non-cancerous lymphocytosis, a primary lymphocytosis, which includes monoclonal B cell lymphocytosis (e.g., benign monoclonal gammopathy and monoclonal garnmopathy of undetermined significance, MGUS), peripheral neuropathy, paraneoplastic syndrome, channelopathies such as epilepsy, migraine, arrhythmia, muscular disorders, deafness, blindness, periodic paralysis, and channelopathies of the CNS, autism, inflammatory myopathy, focal segmental glomerulosclerosis (FSGS), endocrine ophthalmopathy, uveoretinitis, autoimmune hepatological disorder, fibromyalgia, multiple endocrine failure, Schmidt's syndrome, adrenalitis, gastric atrophy, presenile dementia, demyelinating diseases, Dressier's syndrome, alopecia arcata, CREST syndrome (calcinosis, Raynaud's phenomenon, esophageal dysmotility, sclerodactyly, and telangiectasia), male and female autoimmune infertility, ankylosing spondolytis, mixed connective tissue disease, Chagas' disease, rheumatic fever, recurrent abortion, farmer's lung, erythema multiforrrie, post-cardiotomy syndrome, Cushing's syndrome, bird-fancier's lung, Alport's syndrome, alveolitis such as allergic alveolitis and fibrosing alveolitis, interstitial lung disease, transfusion reaction, leprosy, malaria, leishmaniasis, kypanosomiasis, schistosomiasis, ascariasis, aspergillosis, Sampter's syndrome, Caplan's syndrome, dengue, endocarditis, endomyocardial fibrosis, endophthalmitis, erythema elevatum et diutinum, erythroblastosis fetalis, eosinophilic faciitis, Shulman's syndrome, Felty's syndrome, flariasis, cyclitis such as chronic cyclitis, heterochronic cyclitis, or Fuch's cyclitis, Henoch-Schonlein purpura, human immunodeficiency virus (HIV) infection, echovirus infection, cardiomyopathy, Alzheimer's disease, parvovirus infection, rubella virus infection, post-vaccination syndromes, congenital rubella infection, Epstein-Barr virus infection, mumps, Evan's syndrome, autoimmune gonadal failure, Sydenham's chorea, post-streptococcal nephritis, thromboangitis ubiterans, thyrotoxicosis, tabes dorsalis, and giant cell polymyalgia.
The "tumor necrosis factor receptor superfamily" or "TNF receptor superfamily"
herein refers to receptor polypeptides bound by cytokines in the TNF family- Generally, these receptors are Type I
transmembrane receptors with one or more cysteine rich repeat sequences in their extracellular domain. The TNF receptor superfamily may be further subdivided into (1> death receptors;
(2) decoy receptors; and (3) signaling receptors that lack death domains. The "death receptors" contain in their cytoplasmic or intracellular region a "death domain", i.e., a region or sequence which acts to transduce signals in the cell which can result in apoptosis or in induction of certain genes. The "decoy receptors" lack a functional death domain and are incapable of transducing signals which result in apoptosis. Examples of cytokines in the TNF gene family include Tumor Necrosis Factor- alpha (TNF-alpha), Tumor Necrosis Factor-beta (TNF-beta or lymphotoxin), CD30 ligand, CD27 ligand, CD40 ligand, OX-40 ligand, 4-113B ligand, Apo-1 ligand (also referred to as Fas ligand or CD95 ligand), Apo-2 ligand (also referred to as TRAIL), Apo-3 ligand (also referred to as TWEAK), osteoprotegerin (OPG), APRIL, RANK ligand (also referred to as TRANCE), and TALL-1 (also referred to as BlyS, BAFF or THANK). Examples of receptors in the TNF receptor superfamily include: type 1 Tumor Necrosis Factor Receptor (TNFRI ), type 2 Tumor Necrosis ]Factor Receptor (TNFR2), p75 Nerve Growth Factor receptor (NGFR), the B cell surface antigen CD40, the T cell antigen OX-40, Apo- 1 receptor (also called Fas or CD95), Apo-3 receptor (also called DR3, swl-1, TRAMP and LARD), the receptor called "Transmembrane Activator and CAML-Interactor" or "TACI", BCMA protein, DR4, DR5 (alternatively referred to as Apo-2;
TRAIL-R2, TR6, Tango-63, hAPO8, TRICK2 or KILLER), DR6, DcR 1 (also referred to as TRID, LIT or-TRAIL-R3), DcR2 (also called TRAIL-R4 or TRUNDD), OPG, DcR3 (also called TR6 or M68), CAR 1, HVEM
(also called ATAR or TR2), GITR, ZTNFR-5, NTR-1, TNFL1, CD30, Lymphotoxin beta receptor (LTBr), 4-1BB receptor and TR9 (EP988, 371A1).
The terms "Apo-2 ligand", "Apo-2L", "Apo2L", Apo-2 ligand/TRAIL" and "TRAIL"
are used herein interchangeably to refer to a polypeptide sequence which includes amino acid residues 114-281, inclusive, 95-281, inclusive, residues 92-281, inclusive, residues 91-281, inclusive, residues 41-281, inclusive, residues 39-281, inclusive, residues 15-28 1, inclusive, or residues 1-28 1, inclusive, of the amino acid sequence shown in Fig.
24 (SEQ ID No. 46), as well as biologically active fragments, deletional, insertional, and/or substitutional variants of the above sequences. In one embodiment, the polypeptide sequence comprises residues 114-281 of Fig. 24 (SEQ ID No. 46). Optionally, the polypeptide sequence comprises residues 92-281 or residues 91-281 of Fig. 24 (SEQ ID No. 46). The Apo-2L polypeptides may be encoded by the native nucleotide sequence shown in Fig. 24 (SEQ ID No. 45). Optionally, the codon which encodes residue Prol19 (Fig. 24; SEQ ID No. 4-5) may be "CCT" or "CCG". Optionally, the fragments or variants are biologically active and have at least about 80%
amino acid sequence identity, or at least about 90% sequence identity, or at least 95%, 96%, 97%, 98%, or 99%
sequence identity with any one of the above sequences. The definition encompasses substitutional variants of Apo-2 ligand in which at least one of its native amino acids are substituted by another amino acid such as an alanine residue. The definition also encompasses a native sequence Apo-2 ligand isolated from an Apo-2 ligand source or prepared by recombinant and/or synthetic methods. The Apo-2 ligand of the invention includes the polypeptides referred to as Apo-2 ligand or TRAIL disclosed in W097/01633 published January 16, 1997, W097/25428 published July 17, 1997, W099/36535 published July 22, 1999, WO
01/00832 published January 4, 2001, W002/09755 published February 7, 2002, WO 00/75191 published December 14, 2000, and U.S.
Patent No. 6,030,945 issued February 29, 2000. The terms are used to refer generally to forms of the Apo-2 ligand which include monomer, dimer, trimer, hexamer or hight oligomer forms of the polypeptide. All numbering of amino acid residues referred to in the Apo-2L sequence use the numbering according to Fig_ 24 (SEQ ID No. 46), unless specifically stated otherwise.
"Apo-2 ligand receptor" includes the receptors referred to in the art as "DR4"
and "DR5." Pan et at.
have described the TNF receptor family member referred to as "DR4" (Pan et al., Science, 276:111-113 (1997);
see also W098/32856 published July 30, 1998; WO 99/37684 published July 29, 1999; WO 00/73349 published December 7, 2000; US 6,433,147 issued August 13, 2002; US 6,461,823 issued October 8, 2002, and US
6,342,383 issued January 29, 2002). Sheridan et al., Science, 277:818-821 (1997) and Pan et at., Science, 277:815-818 (1997) described another receptor for Apo2L/TRAIL (see also, W098/51793 published November 19, 1998; W098/41629 published September 24, 1998). This receptor is referred to as DR5 (the receptor has also been alternatively referred to as Apo-2; TRAIL-R, TR6, Tango-63, hAPO8, TRICK2 or KILLER; Screaton et al., Curr. Biol., 7:693-696 (1997); Walczak et al., EMBO J., 16:5386-5387 (1997); Wu et at., Nature Genetics, 17:141-143 (1997); W098/35986 published August 20, 1998; EP870,827 published October 14, 1998;
W098/46643 published October 22, 1998; W099/02653 published January 21, 1999;
W099/09165 published February 25, 1999; W099/11791 published March 11, 1999; US 2002/0072091 published August 13, 2002; US
2002/0098550 published December 7, 2001; US 6,313,269 issued December 6, 2001;
The term "non-Hodgkin's lymphoma" or "NHL", as used herein, refers to a cancer of the lymphatic system other than Hodgkin's lymphomas. Hodgkin's lymphomas can generally be distinguished from non-Hodgkin's lymphomas by the presence of Reed-Sternberg cells in Hodgkin's lymphomas and the absence of said cells in non-Hodgkin's lymphomas. Examples of non-Hodgkin's lymphomas encompassed by the term as used herein include any that would be identified as such by one skilled in the art (e.g., an oncologist or pathologist) in accordance with classification schemes known in the art, such as the Revised European-American Lymphoma (REAL) scheme as described in Color Atlas of Clinical Hematology, Third Edition; A. Victor Hoffbrand and John E. Pettit (eds.) (Harcourt Publishers Limited 2000) (see, in particular Fig. 11.57, 11.58 and/or 11.59). More specific examples include, but are not limited to, relapsed or refractory NHL, front line low grade NHL, Stage IIUIV NHL, chemotherapy resistant NHL, precursor B lymphoblastic leukemia and/or lymphoma, small lymphocytic lymphoma, B cell chronic lymphacytic leukemia and/or prolymphocytic leukemia and/or small lymphocytic lymphoma, B-cell prolymphocytic lymphoma, immunocytoma and/or lymphoplasmacytic lymphoma, marginal zone B cell lymphoma, splenic marginal zone lymphoma, extranodal marginal zone -MALT lymphoma, nodal marginal zone lymphoma, hairy cell leukemia, plasmacytoma and/or plasma cell myeloma, low grade/follicular lymphoma, intermediate grade/follicular NHL, mantle cell lymphoma, follicle center lymphoma (follicular), intermediate grade diffuse NHL, diffuse large B-cell lymphoma, aggressive NHL
(including aggressive front-line NHL and aggressive relapsed NHL), NHL
relapsing after or refractory to autologous stem cell transplantation, primary mediastinal large B-cell lymphoma, primary effusion lymphoma, high grade immunoblastic NHL, high grade lymphoblastic NHL, high grade small non-cleaved cell NHL, bulky disease NHL, Burkitt's lymphoma, precursor (peripheral) T-cell lymphoblastic leukemia and/or lymphoma, adult T-cell lymphoma and/or leukemia, T cell chronic lymphocytic leukemia and/or prolymphacytic leukemia, large granular lymphocytic leukemia, mycosis fungoides and/or Sezary syndrome, extranodal natural killer/T-cell (nasal type) lymphoma, enteropathy type T-cell lymphoma, hepatosplenic T-cell lymphoma, subcutaneous panniculitis like T-cell lymphoma, skin (cutaneous) lymphomas, anaplastic large cell lymphoma, angiocentric lymphoma, intestinal T cell lymphoma, peripheral T-cell (not otherwise specified) lymphoma and angioimmunoblastic T-cell lymphoma.
An "autoimmune disease" herein is a disease or disorder arising from and directed against an individual's own tissues or a co-segregate or manifestation thereof or resulting condition therefrom. Examples of autoimmune diseases or disorders include, but are not limited to arthritis (rheumatoid arthritis, juvenile-onset rheumatoid arthritis, osteoarthritis, psoriatic arthritis, and ankylosing spondylitis), psoriasis, dermatitis including atopic dermatitis, chronic idiopathic urticaria, including chronic autoimmune urticaria, polymyositis/dermatomyositis, toxic epidermal necrolysis, scleroderma (including systemic scleroderma), sclerosis such as progressive systemic sclerosis, inflammatory bowel disease (IBD) (for example, Crohn's disease, ulcerative colitis, autoimmune inflammatory bowel disease), pyoderma gangrenosum, erythema nodosum, primary sclerosing cholangitis, episcleritis), respiratory distress syndrome, including adult respiratory distress syndrome (ARDS), meningitis, IgE-mediated diseases such as anaphylaxis and allergic and atopic rhinitis, encephalitis such as Rasmussen's encephalitis, uveitis or autoimmune uveitis, colitis such as microscopic colitis and collagenous colitis, glomerulonephritis (GN) such as membranous GN
(membranous nephropathy), idiopathic membranous GN, membranous proliferative GN (MPGN), including Type I
and Type II, and rapidly progressive GN, allergic conditions, allergic reaction, eczema, asthma, conditions involving infiltration of T cells and chronic inflammatory responses, atherosclerosis, autoimmune myocarditis, leukocyte adhesion deficiency, systemic lupus erythematosus (SLE) such as cutaneous SLE, subacute cutaneous lupus erythematosus, lupus (including nephritis, cerebritis, pediatric, non-renal, discoid, alopecia), juvenile onset (Type I) diabetes mellitus, including pediatric insulin-dependent diabetes mellitus (IDDM), adult onset diabetes mellitus (Type II diabetes), multiple sclerosis (MS) such as spino-optical MS, immune responses associated with acute and delayed hypersensitivity mediated by cytokines and T-lymphocytes, tuberculosis, sarcoidosis, granulomatosis including lymphomatoid granulomatosis, Wegener's granulomatosis, agranulocytosis, vasculitis (including large vessel vasculitis (including polymyalgia rheumatica and giant cell (Takayasu's) arteritis), medium vessel vasculitis (including Kawasaki's disease and polyarteritis nodosa), CNS vasculitis, systemic necrotizing vasculitis, and ANCA-associated vasculitis , such as Churg-Strauss vasculitis or syndrome (CSS)), temporal arteritis, aplastic anemia, Coombs positive anemia, Diamond Blackfan anemia, hemolytic anemia or immune hemolytic anemia including autoimmune hemolytic anemia (AIHA), pernicious anemia, pure red cell aplasia (PRCA), Factor VIII
deficiency, hemophilia A, autoimmune neutropenia, pancytopenia, leukopenia, diseases involving leukocyte diapedesis, CNS inflammatory disorders, multiple organ injury syndrome, antigen-antibody complex mediated diseases, anti-glomerular basement membrane disease, anti-phospholipid antibody syndrome, allergic neuritis, Bechet's or Behcet's disease, Castleman's syndrome, Goodpasture's syndrome, Reynaud's syndrome, Sjogren's syndrome, Stevens-Johnson syndrome, pemphigoid such as pemphigoid bullous, pemphigus (including vulgaris, foliaceus, and pemphigus mucus-membrane pemphigoid), autoimmune polyendocrinopathies, Reiter's disease, immune complex nephritis, chronic neuropathy such as IgM polyneuropathies or IgM-mediated neuropathy, thrombocytopenia (as developed by myocardial infarction patients, for example), including thrombotic thrombocytopenic purpura (TTP) and autoimmune or immune-mediated thrombocytopenia such as idiopathic thrombocytopenic purpura (ITP) including chronic or acute ITP, autoimmune disease of the testis and ovary including autoimune orchitis and oophoritis, primary hypothyroidism, hypoparathyroidism, autoimmune endocrine diseases including thyroiditis such as autoimmune thyroiditis, chronic thyroiditis (Hashimoto's thyroiditis), or subacute thyroiditis, autoimmune thyroid disease, idiopathic hypothyroidism, Addison's disease, Grave's disease, polyglandular syndromes such as autoimmune polyglandular syndromes (or polyglandular endocrinopathy syndromes), paraneoplastic syndromes, including neurologic paraneoplastic syndromes such as Lambert-Eaton myasthenic syndrome or Eaton-Lambert syndrome, stiff-man or stiff-person syndrome, encephalomyelitis such as allergic encephalomyelitis, myasthenia gravis, cerebellar degeneration, limbic and/or brainstem encephalitis, neuromyotonia, opsoclonus or opsoclonus myoclonus syndrome (OMS), and sensory neuropathy, Sheehan's syndrome, autoimmune hepatitis, chronic hepatitis, lupoid hepatitis, chronic active hepatitis or autoimmune chronic active hepatitis, lymphoid interstitial pneumonitis, bronchiolitis obliterans (non-transplant) vs NSIP, Guillain-Barre syndrome, Berger's disease (IgA
nephropathy), primary biliary cirrhosis, celiac sprue (gluten enteropathy), refractory sprue, dermatitis herpetiformis, cryoglobulinemia, amylotrophic lateral sclerosis (ALS; Lou Gehrig's disease), coronary artery disease, autoimmune inner ear disease (AIED); or autoimmune hearing loss, opsoclonus myoclonus syndrome (OMS), polychondritis such as refractory polychondritis, pulmonary alveolar proteinosis, amyloidosis, giant cell hepatitis, scleritis, a non-cancerous lymphocytosis, a primary lymphocytosis, which includes monoclonal B cell lymphocytosis (e.g., benign monoclonal gammopathy and monoclonal garnmopathy of undetermined significance, MGUS), peripheral neuropathy, paraneoplastic syndrome, channelopathies such as epilepsy, migraine, arrhythmia, muscular disorders, deafness, blindness, periodic paralysis, and channelopathies of the CNS, autism, inflammatory myopathy, focal segmental glomerulosclerosis (FSGS), endocrine ophthalmopathy, uveoretinitis, autoimmune hepatological disorder, fibromyalgia, multiple endocrine failure, Schmidt's syndrome, adrenalitis, gastric atrophy, presenile dementia, demyelinating diseases, Dressier's syndrome, alopecia arcata, CREST syndrome (calcinosis, Raynaud's phenomenon, esophageal dysmotility, sclerodactyly, and telangiectasia), male and female autoimmune infertility, ankylosing spondolytis, mixed connective tissue disease, Chagas' disease, rheumatic fever, recurrent abortion, farmer's lung, erythema multiforrrie, post-cardiotomy syndrome, Cushing's syndrome, bird-fancier's lung, Alport's syndrome, alveolitis such as allergic alveolitis and fibrosing alveolitis, interstitial lung disease, transfusion reaction, leprosy, malaria, leishmaniasis, kypanosomiasis, schistosomiasis, ascariasis, aspergillosis, Sampter's syndrome, Caplan's syndrome, dengue, endocarditis, endomyocardial fibrosis, endophthalmitis, erythema elevatum et diutinum, erythroblastosis fetalis, eosinophilic faciitis, Shulman's syndrome, Felty's syndrome, flariasis, cyclitis such as chronic cyclitis, heterochronic cyclitis, or Fuch's cyclitis, Henoch-Schonlein purpura, human immunodeficiency virus (HIV) infection, echovirus infection, cardiomyopathy, Alzheimer's disease, parvovirus infection, rubella virus infection, post-vaccination syndromes, congenital rubella infection, Epstein-Barr virus infection, mumps, Evan's syndrome, autoimmune gonadal failure, Sydenham's chorea, post-streptococcal nephritis, thromboangitis ubiterans, thyrotoxicosis, tabes dorsalis, and giant cell polymyalgia.
The "tumor necrosis factor receptor superfamily" or "TNF receptor superfamily"
herein refers to receptor polypeptides bound by cytokines in the TNF family- Generally, these receptors are Type I
transmembrane receptors with one or more cysteine rich repeat sequences in their extracellular domain. The TNF receptor superfamily may be further subdivided into (1> death receptors;
(2) decoy receptors; and (3) signaling receptors that lack death domains. The "death receptors" contain in their cytoplasmic or intracellular region a "death domain", i.e., a region or sequence which acts to transduce signals in the cell which can result in apoptosis or in induction of certain genes. The "decoy receptors" lack a functional death domain and are incapable of transducing signals which result in apoptosis. Examples of cytokines in the TNF gene family include Tumor Necrosis Factor- alpha (TNF-alpha), Tumor Necrosis Factor-beta (TNF-beta or lymphotoxin), CD30 ligand, CD27 ligand, CD40 ligand, OX-40 ligand, 4-113B ligand, Apo-1 ligand (also referred to as Fas ligand or CD95 ligand), Apo-2 ligand (also referred to as TRAIL), Apo-3 ligand (also referred to as TWEAK), osteoprotegerin (OPG), APRIL, RANK ligand (also referred to as TRANCE), and TALL-1 (also referred to as BlyS, BAFF or THANK). Examples of receptors in the TNF receptor superfamily include: type 1 Tumor Necrosis Factor Receptor (TNFRI ), type 2 Tumor Necrosis ]Factor Receptor (TNFR2), p75 Nerve Growth Factor receptor (NGFR), the B cell surface antigen CD40, the T cell antigen OX-40, Apo- 1 receptor (also called Fas or CD95), Apo-3 receptor (also called DR3, swl-1, TRAMP and LARD), the receptor called "Transmembrane Activator and CAML-Interactor" or "TACI", BCMA protein, DR4, DR5 (alternatively referred to as Apo-2;
TRAIL-R2, TR6, Tango-63, hAPO8, TRICK2 or KILLER), DR6, DcR 1 (also referred to as TRID, LIT or-TRAIL-R3), DcR2 (also called TRAIL-R4 or TRUNDD), OPG, DcR3 (also called TR6 or M68), CAR 1, HVEM
(also called ATAR or TR2), GITR, ZTNFR-5, NTR-1, TNFL1, CD30, Lymphotoxin beta receptor (LTBr), 4-1BB receptor and TR9 (EP988, 371A1).
The terms "Apo-2 ligand", "Apo-2L", "Apo2L", Apo-2 ligand/TRAIL" and "TRAIL"
are used herein interchangeably to refer to a polypeptide sequence which includes amino acid residues 114-281, inclusive, 95-281, inclusive, residues 92-281, inclusive, residues 91-281, inclusive, residues 41-281, inclusive, residues 39-281, inclusive, residues 15-28 1, inclusive, or residues 1-28 1, inclusive, of the amino acid sequence shown in Fig.
24 (SEQ ID No. 46), as well as biologically active fragments, deletional, insertional, and/or substitutional variants of the above sequences. In one embodiment, the polypeptide sequence comprises residues 114-281 of Fig. 24 (SEQ ID No. 46). Optionally, the polypeptide sequence comprises residues 92-281 or residues 91-281 of Fig. 24 (SEQ ID No. 46). The Apo-2L polypeptides may be encoded by the native nucleotide sequence shown in Fig. 24 (SEQ ID No. 45). Optionally, the codon which encodes residue Prol19 (Fig. 24; SEQ ID No. 4-5) may be "CCT" or "CCG". Optionally, the fragments or variants are biologically active and have at least about 80%
amino acid sequence identity, or at least about 90% sequence identity, or at least 95%, 96%, 97%, 98%, or 99%
sequence identity with any one of the above sequences. The definition encompasses substitutional variants of Apo-2 ligand in which at least one of its native amino acids are substituted by another amino acid such as an alanine residue. The definition also encompasses a native sequence Apo-2 ligand isolated from an Apo-2 ligand source or prepared by recombinant and/or synthetic methods. The Apo-2 ligand of the invention includes the polypeptides referred to as Apo-2 ligand or TRAIL disclosed in W097/01633 published January 16, 1997, W097/25428 published July 17, 1997, W099/36535 published July 22, 1999, WO
01/00832 published January 4, 2001, W002/09755 published February 7, 2002, WO 00/75191 published December 14, 2000, and U.S.
Patent No. 6,030,945 issued February 29, 2000. The terms are used to refer generally to forms of the Apo-2 ligand which include monomer, dimer, trimer, hexamer or hight oligomer forms of the polypeptide. All numbering of amino acid residues referred to in the Apo-2L sequence use the numbering according to Fig_ 24 (SEQ ID No. 46), unless specifically stated otherwise.
"Apo-2 ligand receptor" includes the receptors referred to in the art as "DR4"
and "DR5." Pan et at.
have described the TNF receptor family member referred to as "DR4" (Pan et al., Science, 276:111-113 (1997);
see also W098/32856 published July 30, 1998; WO 99/37684 published July 29, 1999; WO 00/73349 published December 7, 2000; US 6,433,147 issued August 13, 2002; US 6,461,823 issued October 8, 2002, and US
6,342,383 issued January 29, 2002). Sheridan et al., Science, 277:818-821 (1997) and Pan et at., Science, 277:815-818 (1997) described another receptor for Apo2L/TRAIL (see also, W098/51793 published November 19, 1998; W098/41629 published September 24, 1998). This receptor is referred to as DR5 (the receptor has also been alternatively referred to as Apo-2; TRAIL-R, TR6, Tango-63, hAPO8, TRICK2 or KILLER; Screaton et al., Curr. Biol., 7:693-696 (1997); Walczak et al., EMBO J., 16:5386-5387 (1997); Wu et at., Nature Genetics, 17:141-143 (1997); W098/35986 published August 20, 1998; EP870,827 published October 14, 1998;
W098/46643 published October 22, 1998; W099/02653 published January 21, 1999;
W099/09165 published February 25, 1999; W099/11791 published March 11, 1999; US 2002/0072091 published August 13, 2002; US
2002/0098550 published December 7, 2001; US 6,313,269 issued December 6, 2001;
published August 2, 2001; US 2003/01255540 published July 3, 2003; US
2002/0160446 published October 31, 2002, US 2002/0048785 published April 25, 2002; US 6,569,642 issued May 27, 2003, US 6,072,047 issued June 6, 2000, US 6,642,358 issued November 4, 2003). As described above, other receptors for Apo-2L include DcRl, DcR2, and OPG. The term "Apo-2L receptor" when used herein encompasses native sequence receptor and receptor variants. These terms encompass Apo-2L receptor expressed in a variety of mammals, including humans. Apo-2L receptor may be endogenously expressed as occurs naturally in a variety of human tissue lineages, or may be expressed by recombinant or synthetic methods. A "native sequence Apo-2L receptor"
comprises a polypeptide having the same amino acid sequence as an Apo-2L
receptor derived from nature. Thus, a native sequence Apo-2L receptor can have the amino acid sequence of naturally-occurring Apo-2L receptor from any mammal, including humans. Such native sequence Apo-2L receptor can be isolated from nature or can be produced by recombinant or synthetic means. The term "native sequence Apo-2L receptor" specifically encompasses naturally-occurring truncated or secreted forms of the receptor (e.g., a soluble form containing, for instance, an extracellular domain sequence), naturally-occurring variant forms (e.g., alternatively spliced forms) and naturally-occurring allelic variants. Receptor variants may include fragments or deletion mutants of the native sequence Apo-2L receptor. Figs. 25A-C show the 411 amino acid sequence of human DR5 receptor, along with its nucleotide sequence (SEQ ID Nos. 47 and 48) as published in WO
98/51793 on November 19, 1998. A transcriptional splice variant of human DR5 receptor is known in the art. This splice variant encodes the 440 amino acid sequence of human DR5 receptor as shown in Figs. 26A-C, along with its nucleotide sequence (SEQ ID Nos. 49 and 50), and as published in WO 98/35986 on August 20, 1998.
"Death receptor antibody" is used herein to refer generally to antibody or antibodies directed to a receptor in the tumor necrosis factor receptor superfamily and containing a death domain capable of signalling apoptosis, and such antibodies include DR5 antibody and DR4 antibody.
"DR5 receptor antibody", "DR5 antibody", or "anti-DR5 antibody" is used in a broad sense to refer to antibodies that bind to at least one form of a DR5 receptor or extracellular domain thereof. Optionally the DR5 antibody is fused or linked to a heterologous sequence or molecule. Preferably the heterologous sequence allows or assists the antibody to form higher order or oligomeric complexes.
Optionally, the DR5 antibody binds to DR5 receptor but does not bind or cross-react with any additional Apo-2L
receptor (e.g. DR4, DcRI, or DcR2).
Optionally the antibody is an agonist of DR5 signalling activity.
Optionally, the DR5 antibody of the invention binds to a DR5 receptor at a concentration range of about 0.1 nM to about 20 mM as measured in a BlAcore binding assay. Optionally, the DR5 antibodies of the invention exhibit an IC50 value of about 0.6 nM to about 18 mM as measured in a BlAcore binding assay.
Purely for the purposes herein, the term "Apomab" refers to an agonist antibody which binds to DR5 and comprises the variable heavy and variable light amino acid sequences of SEQ ID Nos. 55 and 56. Preferably Apomab comprises the heavy and light chains of SEQ ID Nos. 51 and 52, respectively.
2002/0160446 published October 31, 2002, US 2002/0048785 published April 25, 2002; US 6,569,642 issued May 27, 2003, US 6,072,047 issued June 6, 2000, US 6,642,358 issued November 4, 2003). As described above, other receptors for Apo-2L include DcRl, DcR2, and OPG. The term "Apo-2L receptor" when used herein encompasses native sequence receptor and receptor variants. These terms encompass Apo-2L receptor expressed in a variety of mammals, including humans. Apo-2L receptor may be endogenously expressed as occurs naturally in a variety of human tissue lineages, or may be expressed by recombinant or synthetic methods. A "native sequence Apo-2L receptor"
comprises a polypeptide having the same amino acid sequence as an Apo-2L
receptor derived from nature. Thus, a native sequence Apo-2L receptor can have the amino acid sequence of naturally-occurring Apo-2L receptor from any mammal, including humans. Such native sequence Apo-2L receptor can be isolated from nature or can be produced by recombinant or synthetic means. The term "native sequence Apo-2L receptor" specifically encompasses naturally-occurring truncated or secreted forms of the receptor (e.g., a soluble form containing, for instance, an extracellular domain sequence), naturally-occurring variant forms (e.g., alternatively spliced forms) and naturally-occurring allelic variants. Receptor variants may include fragments or deletion mutants of the native sequence Apo-2L receptor. Figs. 25A-C show the 411 amino acid sequence of human DR5 receptor, along with its nucleotide sequence (SEQ ID Nos. 47 and 48) as published in WO
98/51793 on November 19, 1998. A transcriptional splice variant of human DR5 receptor is known in the art. This splice variant encodes the 440 amino acid sequence of human DR5 receptor as shown in Figs. 26A-C, along with its nucleotide sequence (SEQ ID Nos. 49 and 50), and as published in WO 98/35986 on August 20, 1998.
"Death receptor antibody" is used herein to refer generally to antibody or antibodies directed to a receptor in the tumor necrosis factor receptor superfamily and containing a death domain capable of signalling apoptosis, and such antibodies include DR5 antibody and DR4 antibody.
"DR5 receptor antibody", "DR5 antibody", or "anti-DR5 antibody" is used in a broad sense to refer to antibodies that bind to at least one form of a DR5 receptor or extracellular domain thereof. Optionally the DR5 antibody is fused or linked to a heterologous sequence or molecule. Preferably the heterologous sequence allows or assists the antibody to form higher order or oligomeric complexes.
Optionally, the DR5 antibody binds to DR5 receptor but does not bind or cross-react with any additional Apo-2L
receptor (e.g. DR4, DcRI, or DcR2).
Optionally the antibody is an agonist of DR5 signalling activity.
Optionally, the DR5 antibody of the invention binds to a DR5 receptor at a concentration range of about 0.1 nM to about 20 mM as measured in a BlAcore binding assay. Optionally, the DR5 antibodies of the invention exhibit an IC50 value of about 0.6 nM to about 18 mM as measured in a BlAcore binding assay.
Purely for the purposes herein, the term "Apomab" refers to an agonist antibody which binds to DR5 and comprises the variable heavy and variable light amino acid sequences of SEQ ID Nos. 55 and 56. Preferably Apomab comprises the heavy and light chains of SEQ ID Nos. 51 and 52, respectively.
H. Production of Antibodies Techniques for producing antibodies which can be formulated according to the present invention follow.
(i) Antigen selection and preparation Preferably, the antigen to which the antibody binds is a biologically important glycoprotein and administration of the antibody to a mammal suffering from a disease or disorder can result in a therapeutic benefit in that mammal. However, antibodies directed against nonpolypeptide antigens (such as tumor-associated glycolipid antigens; see US Patent 5,091,178) are also contemplated.
Where the antigen is a polypeptide, it may be a transmembrane molecule (e.g.
receptor) or ligand such as a growth factor. Exemplary antigens include molecules such as renin; a growth hormone, including human growth hormone and bovine growth hormone; growth hormone releasing factor;
parathyroid hormone; thyroid stimulating hormone; lipoproteins; alpha-l-antitrypsin; insulin A-chain;
insulin B-chain; proinsulin; follicle stimulating hormone; calcitonin; luteinizing hormone; glucagon; clotting factors such as factor VIIIC, factor IX, tissue factor (TF), and von Willebrands factor; anti-clotting factors such as Protein C; atrial natriuretic factor;
lung surfactant; a plasminogen activator, such as urokinase or human urine or tissue-type plasminogen activator (t-PA); bombesin; thrombin; hemopoietic growth factor; tumor necrosis factor-alpha and -beta; enkephalinase;
RANTES (regulated on activation normally T-cell expressed and secreted); human macrophage inflammatory protein (MIP-1-alpha); a serum albumin such as human serum albumin; Muellerian-inhibiting substance; relaxin A-chain; relaxin B-chain; prorelaxin; mouse gonadotropin-associated peptide; a microbial protein, such as beta-lactamase; DNase; IgE; a cytotoxic T-lymphocyte associated antigen (CTLA), such as CTLA-4; inhibin; activin;
vascular endothelial growth factor (VEGF); receptors for hormones or growth factors; protein A or D;
rheumatoid factors; a neurotrophic factor such as bone-derived neurotrophic factor (BDNF), neurotrophin-3, -4, -5, or -6 (NT-3, NT-4, NT-5, or NT-6), or a nerve growth factor such as NGF-b;
platelet-derived growth factor (PDGF); fibroblast growth factor such as aFGF and bFGF; epidermal growth factor (EGF); transforming growth factor (TGF) such as TGF-alpha and TGF-beta, including TGF-b1, TGF-b2, TGF-b3, TGF-b4, or TGF-b5; a tumor necrosis factor (TNF) such as TNF-alpha or TNF-beta; insulin-like growth factor-I and -II (IGF-I and IGF-11); des(1-3)-IGF-I (brain IGF-I), insulin-like growth factor binding proteins; CD proteins such as CD3, CD4, CD8, CD19, CD20, CD22 and CD40; erythropoietin; osteoinductive factors;
immunotoxins; a bone morphogenetic protein (BMP); an interferon such as interferon-alpha, -beta, and -gamma; colony stimulating factors (CSFs), e.g., M-CSF, GM-CSF, and G-CSF; interleukins (ILs), e.g., IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9 and IL-10; superoxide dismutase; T-cell receptors; surface membrane proteins; decay accelerating factor; viral antigen such as, for example, a portion of the AIDS
envelope; transport proteins;
homing receptors; addressins; regulatory proteins; integrins such as CD1la, CD1lb, CD1lc, CD18, an ICAM, VLA-4 and VCAM; a tumor associated antigen such as HER2, HER3 or HER4 receptor; and fragments of any of the above-listed polypeptides.
Exemplary molecular targets for antibodies encompassed by the present invention include CD proteins such as CD3, CD4, CD8, CD19, CD20, CD22, CD34 and CD40; members of the ErbB
receptor family such as the EGF receptor, HER2, HER3 or HER4 receptor; B cell surface antigens, such as CD20 or BR3; a member of the tumor necrosis receptor superfamily, including DRS; prostate stem cell antigen (PSCA); cell adhesion molecules such as LFA-1, Macl, p150.95, VLA-4, ICAM-1, VCAM, alpha4/beta7 integrin, and alphav/beta3 integrin including either alpha or beta subunits thereof (e.g. anti-CD1la, anti-CD18 or anti-CD1 lb antibodies);
growth factors such as VEGF as well as receptors therefor; tissue factor (TF);
a tumor necrosis factor (TNF) such as TNF-alpha or TNF-beta, alpha interferon (alpha-IFN); an interleukin, such as IL-8; IgE; blood group antigens; flk2/flt3 receptor; obesity (OB) receptor; mpl receptor; CTLA-4;
protein C etc-Soluble antigens or fragments thereof, optionally conjugated to other molecules, can be used as inununogens for generating antibodies. For transmembrane molecules, such as receptors, fragments of these (e.g.
the extracellular domain of a receptor) can be used as the immunogen.
Alternatively, cells expressing the transmembrane molecule can be used as the immunogen. Such cells can be derived from a natural source (e.g.
cancer cell lines) or may be cells which have been transformed by recombinant techniques to express the transmembrane molecule. Other antigens and forms thereof useful for preparing antibodies will be apparent to those in the art.
For production of HER2 antibodies, the HER2 antigen to be used for production thereof may be, e.g., a soluble form of the extracellular domain of HER2 or a portion thereof, containing the desired epitope.
Alternatively, cells expressing HER2 at their cell surface (e.g. NIH-3T3 cells transforrne:d to overexpress HER2;
or a carcinoma cell line such as SK-BR-3 cells, see Stancovski et al. PNAS
(USA) 88:8691-8695 (1991)) can be used to generate antibodies.
(ii) Monoclonal antibodies Monoclonal antibodies are obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variants that may arise during production of the monoclonal antibody.
Thus, the modifier "monoclonal"
indicates the character of the antibody as not being a mixture of discrete antibodies.
For example, the monoclonal antibodies may be made using the hybridoma method first described by Kohler et al., Nature, 256:495 (1975), or may be made by recombinant DNA
methods (U.S. Patent No.
4,816,567).
In the hybridoma method, a mouse or other appropriate host animal, such as a hamster, is immunized as hereinabove described to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the protein used for immunization. Alternatively, lymphocytes may be immunized in vitro.
Lymphocytes then are fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp.59-103 (Academic Press, 1986)).
The hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphor-ibosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
Preferred myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. Among these, preferred myeloma cell lines are murine myeloma lines, such as those derived from MOPC-21 and MPC-1 1 mouse tumors available from the Salk Institute Cell Distribution Center, San Diego, California USA, and SP-2 or X63-Ag8-653 cells available from the American Type Culture Collection, Rockville, Maryland USA. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol., 133:3001 (1984); and Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987)).
Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against the antigen. Preferably, the binding specificity of monoclonal antibodies produced by hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA).
The binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson et al., Anal. Biochem., 107:220 (1980).
After hybridoma cells are identified that produce antibodies of the desired specificity, affinity, and/or activity, the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, Monoclonal Antibodies: Principles and Practice, pp.59-103 (Academic Press, 1986)). Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as ascites tumors in an animal.
The monoclonal antibodies secreted by the subclones are suitably separated from the culture medium.
ascites fluid, or serum by conventional antibody purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). The hybridoma cells serve as a preferred source of such DNA.
Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
Review articles on recombinant expression in bacteria of DNA encoding the antibody include Skerra et al., Curr.
Opinion in Immunol., 5:256-262 (1993) and Pliickthun, Immunol. Revs., 130:151-188 (1992).
In a further embodiment, monoclonal antibodies or antibody fragments can be isolated from antibodLy phage libraries generated using the techniques described in McCafferty et al., Nature, 348:552-554 (1990).
Clackson et al., Nature, 352:624-628 (1991) and Marks et al., J. Mol. Biol., 222:581-597 (1991) describe the isolation of murine and human antibodies, respectively, using phage libraries.
Subsequent publications describe the production of high affinity (nM range) human antibodies by chain shuffling (Marks et al., Bio/Technology,, 10:779-783 (1992)), as well as combinatorial infection and in vivo recombination as a strategy for constructing very large phage libraries (Waterhouse et al., Nuc. Acids. Res., 21:2265-2266 (1993)). Thus, these techniques are viable alternatives to traditional monoclonal antibody hybridoma techniques for isolation of monoclonal antibodies.
The DNA also may be modified, for example, by substituting the coding sequence for human heavy chain and light chain constant domains in place of the homologous murine sequences (U.S. Patent No. 4,816,567;
(i) Antigen selection and preparation Preferably, the antigen to which the antibody binds is a biologically important glycoprotein and administration of the antibody to a mammal suffering from a disease or disorder can result in a therapeutic benefit in that mammal. However, antibodies directed against nonpolypeptide antigens (such as tumor-associated glycolipid antigens; see US Patent 5,091,178) are also contemplated.
Where the antigen is a polypeptide, it may be a transmembrane molecule (e.g.
receptor) or ligand such as a growth factor. Exemplary antigens include molecules such as renin; a growth hormone, including human growth hormone and bovine growth hormone; growth hormone releasing factor;
parathyroid hormone; thyroid stimulating hormone; lipoproteins; alpha-l-antitrypsin; insulin A-chain;
insulin B-chain; proinsulin; follicle stimulating hormone; calcitonin; luteinizing hormone; glucagon; clotting factors such as factor VIIIC, factor IX, tissue factor (TF), and von Willebrands factor; anti-clotting factors such as Protein C; atrial natriuretic factor;
lung surfactant; a plasminogen activator, such as urokinase or human urine or tissue-type plasminogen activator (t-PA); bombesin; thrombin; hemopoietic growth factor; tumor necrosis factor-alpha and -beta; enkephalinase;
RANTES (regulated on activation normally T-cell expressed and secreted); human macrophage inflammatory protein (MIP-1-alpha); a serum albumin such as human serum albumin; Muellerian-inhibiting substance; relaxin A-chain; relaxin B-chain; prorelaxin; mouse gonadotropin-associated peptide; a microbial protein, such as beta-lactamase; DNase; IgE; a cytotoxic T-lymphocyte associated antigen (CTLA), such as CTLA-4; inhibin; activin;
vascular endothelial growth factor (VEGF); receptors for hormones or growth factors; protein A or D;
rheumatoid factors; a neurotrophic factor such as bone-derived neurotrophic factor (BDNF), neurotrophin-3, -4, -5, or -6 (NT-3, NT-4, NT-5, or NT-6), or a nerve growth factor such as NGF-b;
platelet-derived growth factor (PDGF); fibroblast growth factor such as aFGF and bFGF; epidermal growth factor (EGF); transforming growth factor (TGF) such as TGF-alpha and TGF-beta, including TGF-b1, TGF-b2, TGF-b3, TGF-b4, or TGF-b5; a tumor necrosis factor (TNF) such as TNF-alpha or TNF-beta; insulin-like growth factor-I and -II (IGF-I and IGF-11); des(1-3)-IGF-I (brain IGF-I), insulin-like growth factor binding proteins; CD proteins such as CD3, CD4, CD8, CD19, CD20, CD22 and CD40; erythropoietin; osteoinductive factors;
immunotoxins; a bone morphogenetic protein (BMP); an interferon such as interferon-alpha, -beta, and -gamma; colony stimulating factors (CSFs), e.g., M-CSF, GM-CSF, and G-CSF; interleukins (ILs), e.g., IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9 and IL-10; superoxide dismutase; T-cell receptors; surface membrane proteins; decay accelerating factor; viral antigen such as, for example, a portion of the AIDS
envelope; transport proteins;
homing receptors; addressins; regulatory proteins; integrins such as CD1la, CD1lb, CD1lc, CD18, an ICAM, VLA-4 and VCAM; a tumor associated antigen such as HER2, HER3 or HER4 receptor; and fragments of any of the above-listed polypeptides.
Exemplary molecular targets for antibodies encompassed by the present invention include CD proteins such as CD3, CD4, CD8, CD19, CD20, CD22, CD34 and CD40; members of the ErbB
receptor family such as the EGF receptor, HER2, HER3 or HER4 receptor; B cell surface antigens, such as CD20 or BR3; a member of the tumor necrosis receptor superfamily, including DRS; prostate stem cell antigen (PSCA); cell adhesion molecules such as LFA-1, Macl, p150.95, VLA-4, ICAM-1, VCAM, alpha4/beta7 integrin, and alphav/beta3 integrin including either alpha or beta subunits thereof (e.g. anti-CD1la, anti-CD18 or anti-CD1 lb antibodies);
growth factors such as VEGF as well as receptors therefor; tissue factor (TF);
a tumor necrosis factor (TNF) such as TNF-alpha or TNF-beta, alpha interferon (alpha-IFN); an interleukin, such as IL-8; IgE; blood group antigens; flk2/flt3 receptor; obesity (OB) receptor; mpl receptor; CTLA-4;
protein C etc-Soluble antigens or fragments thereof, optionally conjugated to other molecules, can be used as inununogens for generating antibodies. For transmembrane molecules, such as receptors, fragments of these (e.g.
the extracellular domain of a receptor) can be used as the immunogen.
Alternatively, cells expressing the transmembrane molecule can be used as the immunogen. Such cells can be derived from a natural source (e.g.
cancer cell lines) or may be cells which have been transformed by recombinant techniques to express the transmembrane molecule. Other antigens and forms thereof useful for preparing antibodies will be apparent to those in the art.
For production of HER2 antibodies, the HER2 antigen to be used for production thereof may be, e.g., a soluble form of the extracellular domain of HER2 or a portion thereof, containing the desired epitope.
Alternatively, cells expressing HER2 at their cell surface (e.g. NIH-3T3 cells transforrne:d to overexpress HER2;
or a carcinoma cell line such as SK-BR-3 cells, see Stancovski et al. PNAS
(USA) 88:8691-8695 (1991)) can be used to generate antibodies.
(ii) Monoclonal antibodies Monoclonal antibodies are obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variants that may arise during production of the monoclonal antibody.
Thus, the modifier "monoclonal"
indicates the character of the antibody as not being a mixture of discrete antibodies.
For example, the monoclonal antibodies may be made using the hybridoma method first described by Kohler et al., Nature, 256:495 (1975), or may be made by recombinant DNA
methods (U.S. Patent No.
4,816,567).
In the hybridoma method, a mouse or other appropriate host animal, such as a hamster, is immunized as hereinabove described to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the protein used for immunization. Alternatively, lymphocytes may be immunized in vitro.
Lymphocytes then are fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp.59-103 (Academic Press, 1986)).
The hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphor-ibosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
Preferred myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. Among these, preferred myeloma cell lines are murine myeloma lines, such as those derived from MOPC-21 and MPC-1 1 mouse tumors available from the Salk Institute Cell Distribution Center, San Diego, California USA, and SP-2 or X63-Ag8-653 cells available from the American Type Culture Collection, Rockville, Maryland USA. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol., 133:3001 (1984); and Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987)).
Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against the antigen. Preferably, the binding specificity of monoclonal antibodies produced by hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA).
The binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson et al., Anal. Biochem., 107:220 (1980).
After hybridoma cells are identified that produce antibodies of the desired specificity, affinity, and/or activity, the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, Monoclonal Antibodies: Principles and Practice, pp.59-103 (Academic Press, 1986)). Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as ascites tumors in an animal.
The monoclonal antibodies secreted by the subclones are suitably separated from the culture medium.
ascites fluid, or serum by conventional antibody purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). The hybridoma cells serve as a preferred source of such DNA.
Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
Review articles on recombinant expression in bacteria of DNA encoding the antibody include Skerra et al., Curr.
Opinion in Immunol., 5:256-262 (1993) and Pliickthun, Immunol. Revs., 130:151-188 (1992).
In a further embodiment, monoclonal antibodies or antibody fragments can be isolated from antibodLy phage libraries generated using the techniques described in McCafferty et al., Nature, 348:552-554 (1990).
Clackson et al., Nature, 352:624-628 (1991) and Marks et al., J. Mol. Biol., 222:581-597 (1991) describe the isolation of murine and human antibodies, respectively, using phage libraries.
Subsequent publications describe the production of high affinity (nM range) human antibodies by chain shuffling (Marks et al., Bio/Technology,, 10:779-783 (1992)), as well as combinatorial infection and in vivo recombination as a strategy for constructing very large phage libraries (Waterhouse et al., Nuc. Acids. Res., 21:2265-2266 (1993)). Thus, these techniques are viable alternatives to traditional monoclonal antibody hybridoma techniques for isolation of monoclonal antibodies.
The DNA also may be modified, for example, by substituting the coding sequence for human heavy chain and light chain constant domains in place of the homologous murine sequences (U.S. Patent No. 4,816,567;
and Morrison, et al., Proc. Natl Acad. Sci. USA, 81:6851 (1984)), or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide.
Typically such non-immunoglobulin polypeptides are substituted for the constant domains of an antibody, or they are substituted for the variable domains of one antigen-combining site of an antibody to create a chimeric bivalent antibody comprising one antigen-combining site having specificity for an antigen and another antigen-combining site having specificity for a different antigen.
(iii) Humanized antibodies Methods for humanizing non-human antibodies have been described in the art.
Preferably, a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import"
variable domain. Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting hypervariable region sequences for the corresponding sequences of a human antibody. Accordingly, such "humanized" antibodies are chimeric antibodies (U.S. Patent No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some FR
residues are substituted by residues from analogous sites in rodent antibodies.
The choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is very important to reduce antigenicity. According to the so-called "best-fit" method, the sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences. The human sequence which is closest to that of the rodent is then accepted as the human framework region (FR) for the humanized antibody (Sims et al., J. Inununol., 151:2296 (1993); Chothia et al., J. Mol. Biol., 196:901 (1987)). Another method uses a particular framework region derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains. The same framework may be used for several different humanized antibodies (Carter et al., Proc. Natl. Acad. Sci.
USA, 89:4285 (1992); Presta et al., J.
Immunol., 151:2623 (1993)).
It is further important that antibodies be humanized with retention of high affinity for the antigen and other favorable biological properties. To achieve this goal, according to a preferred method, humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen. In this way, FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved. In general, the hypervariable region residues are directly and most substantially involved in influencing antigen binding.
Typically such non-immunoglobulin polypeptides are substituted for the constant domains of an antibody, or they are substituted for the variable domains of one antigen-combining site of an antibody to create a chimeric bivalent antibody comprising one antigen-combining site having specificity for an antigen and another antigen-combining site having specificity for a different antigen.
(iii) Humanized antibodies Methods for humanizing non-human antibodies have been described in the art.
Preferably, a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import"
variable domain. Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting hypervariable region sequences for the corresponding sequences of a human antibody. Accordingly, such "humanized" antibodies are chimeric antibodies (U.S. Patent No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some FR
residues are substituted by residues from analogous sites in rodent antibodies.
The choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is very important to reduce antigenicity. According to the so-called "best-fit" method, the sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences. The human sequence which is closest to that of the rodent is then accepted as the human framework region (FR) for the humanized antibody (Sims et al., J. Inununol., 151:2296 (1993); Chothia et al., J. Mol. Biol., 196:901 (1987)). Another method uses a particular framework region derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains. The same framework may be used for several different humanized antibodies (Carter et al., Proc. Natl. Acad. Sci.
USA, 89:4285 (1992); Presta et al., J.
Immunol., 151:2623 (1993)).
It is further important that antibodies be humanized with retention of high affinity for the antigen and other favorable biological properties. To achieve this goal, according to a preferred method, humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen. In this way, FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved. In general, the hypervariable region residues are directly and most substantially involved in influencing antigen binding.
WOO 1/00245 describes production of exemplary humanized HER2 antibodies which bind HER2 and block ligand activation of a HER receptor. The humanized antibody of particular interest herein blocks EGF, TGF-a and/or HRG mediated activation of MAPK essentially as effectively as murine monoclonal antibody 2C4 (or a Fab fragment thereof) and/or binds HER2 essentially as effectively as murine monoclonal antibody 2C4 (or a Fab fragment thereof). The humanized antibody herein may, for example, comprise nonhuman hyper-variable region residues incorporated into a human variable heavy domain and may further comprise a framework region (FR) substitution at a position selected from the group consisting of 69H, 71H
and 73H utilizing the variable domain numbering system set forth in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed.
Public Health Service, National Institutes of Health, Bethesda, MD (1991). In one embodiment, the humanized antibody comprises FR substitutions at two or all of positions 69H, 71H and 73H.
An exemplary humanized antibody of interest herein comprises variable heavy domain complementarity determining residues GFTFI'DYTMX, where X is preferably D or S
(SEQ ID No. 7);
DVNPNSGGSIYNQRFKG (SEQ ID No. 8); and/or NLGPSFYFDY (SEQ ID No. 9), optionally comprising amino acid modifications of those CDR residues, e.g. where the modifications essentially maintain or improve affinity of the antibody. For example, the antibody variant of interest may have from about one to about seven or about five amino acid substitutions in the above variable heavy CDR
sequences. Such antibody variants may be prepared by affinity maturation, e.g., as described below. The most preferred humanized antibody comprises the variable heavy domain amino acid sequence in SEQ ID No. 4.
The humanized antibody may comprise variable light domain complementarity determining residues KASQDVSIGVA (SEQ ID No. 10); SASYXXX, where the X as position 5 is preferably R or L, wherein the X
at position 6 is preferably Y or E, and the X as position 7 is preferably T or S (SEQ ID No. 11); and/or QQYYIYPYT (SEQ ID No. 12), e.g. in addition to those variable heavy domain CDR
residues in the preceding paragraph. Such humanized antibodies optionally comprise amino acid modifications of the above CDR
residues, e.g. where the modifications essentially maintain or improve affinity of the antibody. For example, the antibody variant of interest may have from about one to about seven or about five amino acid substitutions in the above variable light CDR sequences. Such antibody variants may be prepared by affinity maturation, e.g., as described below. The most preferred humanized antibody comprises the variable light domain amino acid sequence in SEQ ID No. 3.
The present application also contemplates affinity matured antibodies which bind HER2 and block ligand activation of a HER receptor. The parent antibody may be a human antibody or a humanized antibody, e.g., one comprising the variable light and/or heavy sequences of SEQ ID Nos.
3 and 4, respectively (i. e. variant 574). The affinity matured antibody preferably binds to HER2 receptor with an affinity superior to that of murine 2C4 or variant 574 (e.g. from about two or about four fold, to about 100 fold or about 1000 fold improved affinity, e.g. as assessed using a HER2-extracellular domain (ECD) ELISA) . Exemplary variable heavy CDR residues for substitution include H28, H30, H34, H35, H64, H96, H99, or combinations of two or more (e.g. two, three, four, five, six, or seven of these residues). Examples of variable light CDR residues for alteration include L28, L50, L53, L56, L91, L92, L93, L94, L96, L97 or combinations of two or more (e.g. two to three, four, five or up to about ten of these residues).
and 73H utilizing the variable domain numbering system set forth in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed.
Public Health Service, National Institutes of Health, Bethesda, MD (1991). In one embodiment, the humanized antibody comprises FR substitutions at two or all of positions 69H, 71H and 73H.
An exemplary humanized antibody of interest herein comprises variable heavy domain complementarity determining residues GFTFI'DYTMX, where X is preferably D or S
(SEQ ID No. 7);
DVNPNSGGSIYNQRFKG (SEQ ID No. 8); and/or NLGPSFYFDY (SEQ ID No. 9), optionally comprising amino acid modifications of those CDR residues, e.g. where the modifications essentially maintain or improve affinity of the antibody. For example, the antibody variant of interest may have from about one to about seven or about five amino acid substitutions in the above variable heavy CDR
sequences. Such antibody variants may be prepared by affinity maturation, e.g., as described below. The most preferred humanized antibody comprises the variable heavy domain amino acid sequence in SEQ ID No. 4.
The humanized antibody may comprise variable light domain complementarity determining residues KASQDVSIGVA (SEQ ID No. 10); SASYXXX, where the X as position 5 is preferably R or L, wherein the X
at position 6 is preferably Y or E, and the X as position 7 is preferably T or S (SEQ ID No. 11); and/or QQYYIYPYT (SEQ ID No. 12), e.g. in addition to those variable heavy domain CDR
residues in the preceding paragraph. Such humanized antibodies optionally comprise amino acid modifications of the above CDR
residues, e.g. where the modifications essentially maintain or improve affinity of the antibody. For example, the antibody variant of interest may have from about one to about seven or about five amino acid substitutions in the above variable light CDR sequences. Such antibody variants may be prepared by affinity maturation, e.g., as described below. The most preferred humanized antibody comprises the variable light domain amino acid sequence in SEQ ID No. 3.
The present application also contemplates affinity matured antibodies which bind HER2 and block ligand activation of a HER receptor. The parent antibody may be a human antibody or a humanized antibody, e.g., one comprising the variable light and/or heavy sequences of SEQ ID Nos.
3 and 4, respectively (i. e. variant 574). The affinity matured antibody preferably binds to HER2 receptor with an affinity superior to that of murine 2C4 or variant 574 (e.g. from about two or about four fold, to about 100 fold or about 1000 fold improved affinity, e.g. as assessed using a HER2-extracellular domain (ECD) ELISA) . Exemplary variable heavy CDR residues for substitution include H28, H30, H34, H35, H64, H96, H99, or combinations of two or more (e.g. two, three, four, five, six, or seven of these residues). Examples of variable light CDR residues for alteration include L28, L50, L53, L56, L91, L92, L93, L94, L96, L97 or combinations of two or more (e.g. two to three, four, five or up to about ten of these residues).
Various forms of the humanized antibody or affinity matured antibody are contemplated. For example, the humanized antibody or affinity matured antibody may be an antibody fragment, such as a Fab, which is optionally conjugated with one or more cytotoxic agent(s) in order to generate an immunoconjugate.
Alternatively, the humanized antibody or affinity matured antibody may be an full length antibody, such as an full length IgG 1 antibody.
(iv) Human antibodies As an alternative to humanization, human antibodies can be generated. For example, it is now possible to produce transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production. For example, it has been described that the homozygous deletion of the antibody heavy-chain joining region (JH) gene in chimeric and germ-line mutant mice results in complete inhibition of endogenous antibody production.
Transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge. See, e.g., Jakobovits et al., Proc. Natl. Acad. Sci.
USA, 90:2551 (1993); Jakobovits et al., Nature, 362:255-258 (1993); Bruggermann et al., Year in Immuno., 7:33 (1993); and U.S. Patent Nos.
5,591,669, 5,589,369 and 5,545,807.
Alternatively, phage display technology (McCafferty et al., Nature 348:552-553 (1990)) can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors. According to this technique, antibody V
domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, such as M13 or fd, and displayed as functional antibody fragments on the surface of the phage particle. Because the filamentous particle contains a single-stranded DNA copy of the phage genome, selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties. Thus, the phage mimics some of the properties of the B-cell. Phage display can be performed in a variety of formats; for their review see, e.g., Johnson, Kevin S. and Chiswell, David J., Current Opinion in Structural Biology 3:564-571 (1993). Several sources of V-gene segments can be used for phage display.
Clackson et al., Nature, 352:624-628 (1991) isolated a diverse array of anti-oxazolone antibodies from a small random combinatorial library of V
genes derived from the spleens of immunized mice. A repertoire of V genes from unimmunized human donors can be constructed and antibodies to a diverse array of antigens (including self-antigens) can be isolated essentially following the techniques described by Marks et al., J. Mol. Biol.
222:581-597 (1991), or Griffith et al., EMBO J. 12:725-734 (1993). See, also, U.S. Patent Nos. 5,565,332 and 5,573,905.
As discussed above, human antibodies may also be generated by in vitro activated B cells (see U.S.
Patents 5,567,610 and 5,229,275).
Human HER2 antibodies are described in U.S. Patent No. 5,772,997 issued June 30, 1998 and WO
97/00271 published January 3, 1997.
(v) Antibody fragments Various techniques have been developed for the production of antibody fragments. Traditionally, these fragments were derived via proteolytic digestion of full length antibodies (see, e.g., Morimoto et al. , Journal of Biochemical and Biophysical Methods 24:107-117 (1992); and Brennan et al., Science, 229:81 (1985)).
Alternatively, the humanized antibody or affinity matured antibody may be an full length antibody, such as an full length IgG 1 antibody.
(iv) Human antibodies As an alternative to humanization, human antibodies can be generated. For example, it is now possible to produce transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production. For example, it has been described that the homozygous deletion of the antibody heavy-chain joining region (JH) gene in chimeric and germ-line mutant mice results in complete inhibition of endogenous antibody production.
Transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge. See, e.g., Jakobovits et al., Proc. Natl. Acad. Sci.
USA, 90:2551 (1993); Jakobovits et al., Nature, 362:255-258 (1993); Bruggermann et al., Year in Immuno., 7:33 (1993); and U.S. Patent Nos.
5,591,669, 5,589,369 and 5,545,807.
Alternatively, phage display technology (McCafferty et al., Nature 348:552-553 (1990)) can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors. According to this technique, antibody V
domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, such as M13 or fd, and displayed as functional antibody fragments on the surface of the phage particle. Because the filamentous particle contains a single-stranded DNA copy of the phage genome, selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties. Thus, the phage mimics some of the properties of the B-cell. Phage display can be performed in a variety of formats; for their review see, e.g., Johnson, Kevin S. and Chiswell, David J., Current Opinion in Structural Biology 3:564-571 (1993). Several sources of V-gene segments can be used for phage display.
Clackson et al., Nature, 352:624-628 (1991) isolated a diverse array of anti-oxazolone antibodies from a small random combinatorial library of V
genes derived from the spleens of immunized mice. A repertoire of V genes from unimmunized human donors can be constructed and antibodies to a diverse array of antigens (including self-antigens) can be isolated essentially following the techniques described by Marks et al., J. Mol. Biol.
222:581-597 (1991), or Griffith et al., EMBO J. 12:725-734 (1993). See, also, U.S. Patent Nos. 5,565,332 and 5,573,905.
As discussed above, human antibodies may also be generated by in vitro activated B cells (see U.S.
Patents 5,567,610 and 5,229,275).
Human HER2 antibodies are described in U.S. Patent No. 5,772,997 issued June 30, 1998 and WO
97/00271 published January 3, 1997.
(v) Antibody fragments Various techniques have been developed for the production of antibody fragments. Traditionally, these fragments were derived via proteolytic digestion of full length antibodies (see, e.g., Morimoto et al. , Journal of Biochemical and Biophysical Methods 24:107-117 (1992); and Brennan et al., Science, 229:81 (1985)).
However, these fragments can now be produced directly by recombinant host cells. For example, the antibody fragments can be isolated from the antibody phage libraries discussed above.
Alternatively, Fab'-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab')2 fragments (Carter et al., Bio/Technology 10:163-167 (1992)). According to another approach, F(ab')2 fragments can be isolated directly from recombinant host cell culture. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner. In other embodiments, the antibody of choice is a single chain Fv fragment (scFv).
See WO 93/16185; U.S. Patent No. 5,571,894; and U.S. Patent No. 5,587,458. The antibody fragment may also be a "linear antibody", e.g., as described in U.S. Patent 5,641,870 for example. Such linear antibody fragments may be monospecific or bispecific.
(vi) Bispecific antibodies Bispecific antibodies are antibodies that have binding specificities for at least two different epitopes.
Exemplary bispecific antibodies may bind to two different epitopes of the HER2 protein. Other such antibodies may combine a HER2 binding site with binding site(s) for EGFR, HERS and/or HER4- - Alternatively, a HER2 arm may be combined with an arm which binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g. CD2 or CD3), or Fc receptors for IgG (FcyR), such as FcyRI
(CD64), FcyRII (CD32) and FcyRIII
(CD16) so as to focus cellular defense mechanisms to the HER2-expressing cell.
Bispecific antibodies may also be used to localize cytotoxic agents to cells which express HER2. These antibodies possess a HER2-binding arm and an arm which binds the cytotoxic agent (e.g. saporin, anti-interferon-a, vinca alkaloid, ricin A chain, methotrexate or radioactive isotope hapten). Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab')2 bispecific antibodies).
WO 96/16673 describes a bispecific HER2/FcyRIII antibody and U.S. Patent No.
5,837,234 discloses a bispecific HER2/FcyRI antibody IDM1 (Osidem). A bispecific HER2/Fca antibody is shown in W098/02463.
U.S. Patent No. 5,821,337 teaches a bispecific HER2/CD3 antibody. MDX-210 is a bispecific HER2-FcyRIlI
Ab.
Methods for making bispecific antibodies are known in the art. Traditional production of full length bispecific antibodies is based on the coexpression of two immunoglobulin heavy chairs-light chain pairs, where the two chains have different specificities (Millstein et al., Nature, 305:537-539 (1983 )). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of 10 different antibody molecules, of which only one has the correct bispecifiic structure. Purification of the correct molecule, which is usually done by affinity chromatography steps, is rather cumbersome, and the product yields are low. Similar procedures are disclosed in WO 93/08829, and in Traunecker et al., EMBO J., 10:3655-3659 (1991).
According to a different approach, antibody variable domains with the desired binding specificities (antibody-antigen combining sites) are fused to immunoglobulin constant domain sequences. The fusion preferably is with an immunoglobulin heavy chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CH1) containing the site necessary for light chain binding, present in at least one of the fusions.
DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain, are inserted into separate expression vectors, and are co-transfected into a suitable host organism. This provides for great flexibility in adjusting the mutual proportions of the three polypeptide fragments in embodiments when unequal ratios of the three polypeptide chains used in the construction provide the optimum yields. It is, however, possible to insert the coding sequences for two or all three polypeptide chains in one expression vector when the expression of at least two polypeptide chains in equal ratios results in high yields or when the ratios are of no particular significance.
In a preferred embodiment of this approach, the bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm, and a hybrid iniinunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm. It was found that this asymmetric structure facilitates the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations, as the presence of an immunoglobulin light chain in only one half of the bispecific molecule provides for a facile way of separation. This approach is disclosed in WO 94/04690. For further details of generating bispecific antibodies see, for example, Suresh et al., Methods in Enzymology, 121:210 (1986).
According to another approach described in U.S. Patent No. 5,731,168, the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture. The preferred interface comprises at least a part of the CH3 domain of an antibody constant domain. In this method, one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan). Compensatory "cavities" of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
Bispecific antibodies include cross-linked or "heteroconjugate" antibodies.
For example, one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (U.S.
Patent No. 4,676,980), and for treatment of HIV infection (WO 91/00360, WO 92/200373, and EP 03089).
Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Patent No. 4,676,980, along with a number of cross-linking techniques.
Techniques for generating bispecific antibodies from antibody fragments have also been described in the literature. For example, bispecific antibodies can be prepared using chemical linkage. Brennan et al., Science, 229: 81 (1985) describe a procedure wherein full length antibodies are proteolytically cleaved to generate F(ab')2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation. The Fab' fragments generated are then converted to thionitrobenzoate (TNB) derivatives. One of the Fab'-TNB derivatives is then reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'-TNB derivative to form the bispecific antibody. The bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
Recent progress has facilitated the direct recovery of Fab'-SH fragments from E. coli, which can be chemically coupled to form bispecific antibodies. Shalaby et al., J. Exp.
Med., 175: 217-225 (1992) describe the production of a fully humanized bispecific antibody F(ab')2 molecule. Each Fab' fragment was separately secreted from E. coli and subjected to directed chemical coupling in vitro to form the bispecific antibody. The bispecific antibody thus formed was able to bind to cells overexpressing the HER2 receptor and normal human T cells, as well as trigger the lytic activity of human cytotoxic lymphocytes against human breast tumor targets.
Various techniques for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described. For example, bispecific antibodies have been produced using leucine zippers.
Kostelny et al., J. Immunol., 148(5):1547-1553 (1992). The leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion. The antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers.
This method can also be utilized for the production of antibody homodimers.
The "diabody" technology described by Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993) has provided an alternative mechanism for making bispecific antibody fragments. The fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding sites.
Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported. See Gruber et al., J. Immunol., 152:5368 (1994).
Antibodies with more than two valencies are contemplated. For example, trispecific antibodies can be prepared. Tutt et al. J. Immunol. 147: 60 (1991).
(vii) Other amino acid sequence modifications Amino acid sequence modification(s) of the antibodies described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody. Amino acid sequence variants of the Antibody are prepared by introducing appropriate nucleotide changes into the Antibody nucleic acid, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the Antibody. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct possesses the desired characteristics. The amino acid changes also may alter post-translational processes of the Antibody, such as changing the number or position of glycosylation sites.
A useful method for identification of certain residues or regions of the Antibody that are preferred locations for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells Science, 244:1081-1085 (1989). Here, a residue or group of target residues are identified (e.g-, charged residues such as arg, asp, his, lys, and glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with antigen. Those amino acid locations demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution. Thus, while the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined.
For example, to analyze the performance of a mutation at a given site, ala scanning or random mutagenesis is conducted at the target codon or region and the expressed Antibody variants are screened for the desired activity.
Alternatively, Fab'-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab')2 fragments (Carter et al., Bio/Technology 10:163-167 (1992)). According to another approach, F(ab')2 fragments can be isolated directly from recombinant host cell culture. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner. In other embodiments, the antibody of choice is a single chain Fv fragment (scFv).
See WO 93/16185; U.S. Patent No. 5,571,894; and U.S. Patent No. 5,587,458. The antibody fragment may also be a "linear antibody", e.g., as described in U.S. Patent 5,641,870 for example. Such linear antibody fragments may be monospecific or bispecific.
(vi) Bispecific antibodies Bispecific antibodies are antibodies that have binding specificities for at least two different epitopes.
Exemplary bispecific antibodies may bind to two different epitopes of the HER2 protein. Other such antibodies may combine a HER2 binding site with binding site(s) for EGFR, HERS and/or HER4- - Alternatively, a HER2 arm may be combined with an arm which binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g. CD2 or CD3), or Fc receptors for IgG (FcyR), such as FcyRI
(CD64), FcyRII (CD32) and FcyRIII
(CD16) so as to focus cellular defense mechanisms to the HER2-expressing cell.
Bispecific antibodies may also be used to localize cytotoxic agents to cells which express HER2. These antibodies possess a HER2-binding arm and an arm which binds the cytotoxic agent (e.g. saporin, anti-interferon-a, vinca alkaloid, ricin A chain, methotrexate or radioactive isotope hapten). Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab')2 bispecific antibodies).
WO 96/16673 describes a bispecific HER2/FcyRIII antibody and U.S. Patent No.
5,837,234 discloses a bispecific HER2/FcyRI antibody IDM1 (Osidem). A bispecific HER2/Fca antibody is shown in W098/02463.
U.S. Patent No. 5,821,337 teaches a bispecific HER2/CD3 antibody. MDX-210 is a bispecific HER2-FcyRIlI
Ab.
Methods for making bispecific antibodies are known in the art. Traditional production of full length bispecific antibodies is based on the coexpression of two immunoglobulin heavy chairs-light chain pairs, where the two chains have different specificities (Millstein et al., Nature, 305:537-539 (1983 )). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of 10 different antibody molecules, of which only one has the correct bispecifiic structure. Purification of the correct molecule, which is usually done by affinity chromatography steps, is rather cumbersome, and the product yields are low. Similar procedures are disclosed in WO 93/08829, and in Traunecker et al., EMBO J., 10:3655-3659 (1991).
According to a different approach, antibody variable domains with the desired binding specificities (antibody-antigen combining sites) are fused to immunoglobulin constant domain sequences. The fusion preferably is with an immunoglobulin heavy chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CH1) containing the site necessary for light chain binding, present in at least one of the fusions.
DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain, are inserted into separate expression vectors, and are co-transfected into a suitable host organism. This provides for great flexibility in adjusting the mutual proportions of the three polypeptide fragments in embodiments when unequal ratios of the three polypeptide chains used in the construction provide the optimum yields. It is, however, possible to insert the coding sequences for two or all three polypeptide chains in one expression vector when the expression of at least two polypeptide chains in equal ratios results in high yields or when the ratios are of no particular significance.
In a preferred embodiment of this approach, the bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm, and a hybrid iniinunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm. It was found that this asymmetric structure facilitates the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations, as the presence of an immunoglobulin light chain in only one half of the bispecific molecule provides for a facile way of separation. This approach is disclosed in WO 94/04690. For further details of generating bispecific antibodies see, for example, Suresh et al., Methods in Enzymology, 121:210 (1986).
According to another approach described in U.S. Patent No. 5,731,168, the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture. The preferred interface comprises at least a part of the CH3 domain of an antibody constant domain. In this method, one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan). Compensatory "cavities" of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
Bispecific antibodies include cross-linked or "heteroconjugate" antibodies.
For example, one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (U.S.
Patent No. 4,676,980), and for treatment of HIV infection (WO 91/00360, WO 92/200373, and EP 03089).
Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Patent No. 4,676,980, along with a number of cross-linking techniques.
Techniques for generating bispecific antibodies from antibody fragments have also been described in the literature. For example, bispecific antibodies can be prepared using chemical linkage. Brennan et al., Science, 229: 81 (1985) describe a procedure wherein full length antibodies are proteolytically cleaved to generate F(ab')2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation. The Fab' fragments generated are then converted to thionitrobenzoate (TNB) derivatives. One of the Fab'-TNB derivatives is then reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'-TNB derivative to form the bispecific antibody. The bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
Recent progress has facilitated the direct recovery of Fab'-SH fragments from E. coli, which can be chemically coupled to form bispecific antibodies. Shalaby et al., J. Exp.
Med., 175: 217-225 (1992) describe the production of a fully humanized bispecific antibody F(ab')2 molecule. Each Fab' fragment was separately secreted from E. coli and subjected to directed chemical coupling in vitro to form the bispecific antibody. The bispecific antibody thus formed was able to bind to cells overexpressing the HER2 receptor and normal human T cells, as well as trigger the lytic activity of human cytotoxic lymphocytes against human breast tumor targets.
Various techniques for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described. For example, bispecific antibodies have been produced using leucine zippers.
Kostelny et al., J. Immunol., 148(5):1547-1553 (1992). The leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion. The antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers.
This method can also be utilized for the production of antibody homodimers.
The "diabody" technology described by Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993) has provided an alternative mechanism for making bispecific antibody fragments. The fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding sites.
Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported. See Gruber et al., J. Immunol., 152:5368 (1994).
Antibodies with more than two valencies are contemplated. For example, trispecific antibodies can be prepared. Tutt et al. J. Immunol. 147: 60 (1991).
(vii) Other amino acid sequence modifications Amino acid sequence modification(s) of the antibodies described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody. Amino acid sequence variants of the Antibody are prepared by introducing appropriate nucleotide changes into the Antibody nucleic acid, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the Antibody. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct possesses the desired characteristics. The amino acid changes also may alter post-translational processes of the Antibody, such as changing the number or position of glycosylation sites.
A useful method for identification of certain residues or regions of the Antibody that are preferred locations for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells Science, 244:1081-1085 (1989). Here, a residue or group of target residues are identified (e.g-, charged residues such as arg, asp, his, lys, and glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with antigen. Those amino acid locations demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution. Thus, while the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined.
For example, to analyze the performance of a mutation at a given site, ala scanning or random mutagenesis is conducted at the target codon or region and the expressed Antibody variants are screened for the desired activity.
Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include a Antibody with an N-terminal methionyl residue or the antibody fused to a cytotoxic polypeptide. Other insertional variants of the Antibody molecule include the fusion to the N- or C-terminus of the Antibody to an enzyme (e.g. for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
Another type of variant is an amino acid substitution variant. These variants have at least one amino acid residue in the Antibody molecule replaced by a different residue. The sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR or Fc region alterations are also contemplated. Conservative substitutions are shown in Table 1 under the heading of "preferred substitutions". If such substitutions result in a change in biological activity, then more substantial changes, denominated "exemplary substitutions" in Table 1, or as further described below in reference to amino acid classes, may be introduced and the products screened.
Another type of variant is an amino acid substitution variant. These variants have at least one amino acid residue in the Antibody molecule replaced by a different residue. The sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR or Fc region alterations are also contemplated. Conservative substitutions are shown in Table 1 under the heading of "preferred substitutions". If such substitutions result in a change in biological activity, then more substantial changes, denominated "exemplary substitutions" in Table 1, or as further described below in reference to amino acid classes, may be introduced and the products screened.
Table 1 Original Exemplary Preferred Residue Substitutions Substitutions Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gin; Asn Lys Asn (N) Gin; His; Asp, Lys; Arg Gin Asp (D) Gin; Asn Glu Cys (C) Ser; Ala Ser Gin (Q) Asn; Glu Asn Glu (E) Asp; Gin Asp Gly (G) Ala Ala His (H) Asn; Gin; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Leu Phe; Norleucine Leu (L) Norleucine; Ile; Val; Ile Met; Ala; Phe Lys (K) Arg; Gin; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Val; Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Leu Ala; Norleucine Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Amino acids may be grouped according to similarities in the properties of their side chains (in A. L. Lehninger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)):
(1) non-polar: Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M) (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q) (3) acidic: Asp (D), Glu (E) (4) basic: Lys (K), Arg (R), His(H) Alternatively, naturally occurring residues may be divided into groups based on common side-chain properties:
(1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile;
(2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln;
(3) acidic: Asp, Glu;
(4) basic: His, Lys, Arg;
(5) residues that influence chain orientation: Gly, Pro;
(6) aromatic: Trp, Tyr, Phe.
Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
Any cysteine residue not involved in maintaining the proper conformation of the Antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking. Conversely, cysteine bond(s) may be added to the antibody to improve its stability (particularly where the antibody is an antibody fragment such as an Fv fragment).
A particularly preferred type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human antibody).
Generally, the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody from which they are generated. A convenient way for generating such substitutional variants involves affinity maturation using phage display. Briefly, several hypervariable region sites (e.g. 6-7 sites) are mutated to generate all possible amino substitutions at each site. The antibody variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III
product of M 13 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e. g. binding affinity) as herein disclosed. In order to identify candidate hypervariable region sites for modification., alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding. Alternatively, or additionally, it may be beneficial to analyze a crystal structure of the antigen-antibody complex to identify contact points between the antibody and its antigen. Such contact residues and neighboring residues are candidates for substitution according to the techniques elaborated herein. Once such variants are generated, the panel of variants is subjected to screening as described herein and antibodies with superior properties in one or more relevant assays may be selected for further development.
Another type of amino acid variant of the antibody alters the original glycosylation pattern of the antibody. By altering is meant deleting one or more carbohydrate moieties found in the antibody, and/or adding one or more glycosylation sites that are not present in the antibody.
(1) non-polar: Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M) (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q) (3) acidic: Asp (D), Glu (E) (4) basic: Lys (K), Arg (R), His(H) Alternatively, naturally occurring residues may be divided into groups based on common side-chain properties:
(1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile;
(2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln;
(3) acidic: Asp, Glu;
(4) basic: His, Lys, Arg;
(5) residues that influence chain orientation: Gly, Pro;
(6) aromatic: Trp, Tyr, Phe.
Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
Any cysteine residue not involved in maintaining the proper conformation of the Antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking. Conversely, cysteine bond(s) may be added to the antibody to improve its stability (particularly where the antibody is an antibody fragment such as an Fv fragment).
A particularly preferred type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human antibody).
Generally, the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody from which they are generated. A convenient way for generating such substitutional variants involves affinity maturation using phage display. Briefly, several hypervariable region sites (e.g. 6-7 sites) are mutated to generate all possible amino substitutions at each site. The antibody variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III
product of M 13 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e. g. binding affinity) as herein disclosed. In order to identify candidate hypervariable region sites for modification., alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding. Alternatively, or additionally, it may be beneficial to analyze a crystal structure of the antigen-antibody complex to identify contact points between the antibody and its antigen. Such contact residues and neighboring residues are candidates for substitution according to the techniques elaborated herein. Once such variants are generated, the panel of variants is subjected to screening as described herein and antibodies with superior properties in one or more relevant assays may be selected for further development.
Another type of amino acid variant of the antibody alters the original glycosylation pattern of the antibody. By altering is meant deleting one or more carbohydrate moieties found in the antibody, and/or adding one or more glycosylation sites that are not present in the antibody.
Glycosylation of antibodies is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
Addition of glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites). The alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
Where the antibody comprises an Fc region, the carbohydrate attached thereto may be altered. For example, antibodies with a mature carbohydrate structure that lacks fucose attached to an Fc region of the antibody are described in US Pat Appl No US 2003/0157108 Al, Presta, L. See also US 2004/0093621 Al (Kyowa Hakko Kogyo Co., Ltd). Antibodies with a bisecting N-acetylglucosamine (GIcNAc) in the carbohydrate attached to an Fc region of the antibody are referenced in W003/011878, Jean-Mairet et al. and US
Patent No. 6,602,684, Umana et al. Antibodies with at least one galactose residue in the oligosaccharide attached to an Fc region of the antibody are reported in W097/30087, Patel et al. See, also, W098/58964 (Raju, S.) and W099/22764 (Raju, S.) concerning antibodies with altered carbohydrate attached to the Fe region thereof. Antibody compositions comprising main species antibody with such carbohydrate structures attached to the Fc region are contemplated herein.
Nucleic acid molecules encoding amino acid sequence variants of the Antibody are prepared by a variety of methods known in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide-mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non-variant version of the antibody.
(viii) Screening for antibodies with the desired properties Techniques for generating antibodies have been described above. One may further select antibodies with certain biological characteristics, as desired.
To identify an antibody which blocks ligand activation of a HER receptor, the ability of the antibody to block HER ligand binding to cells expressing the HER receptor (e.g. in conjugation with another HER receptor with which the HER receptor of interest forms a HER hetero-oligomer) may be determined. For example, cells naturally expressing, or transfected to express, HER receptors of the HER
hetero-oligomer may be incubated with the antibody and then exposed to labeled HER ligand. The ability of the HER2 antibody to block ligand binding to the HER receptor in the HER hetero-oligomer may then be evaluated.
For example, inhibition of HRG binding to MCF7 breast tumor cell lines by HER2 antibodies may be performed using monolayer MCF7 cultures on ice in a 24-well-plate format essentially as described in W001/00245. HER2 monoclonal antibodies may be added to each well and incubated for 30 minutes. 125I-labeled rHRG(31177-224 (25 pm) may then be added, and the incubation may be continued for 4 to 16 hours.
Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
Addition of glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites). The alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
Where the antibody comprises an Fc region, the carbohydrate attached thereto may be altered. For example, antibodies with a mature carbohydrate structure that lacks fucose attached to an Fc region of the antibody are described in US Pat Appl No US 2003/0157108 Al, Presta, L. See also US 2004/0093621 Al (Kyowa Hakko Kogyo Co., Ltd). Antibodies with a bisecting N-acetylglucosamine (GIcNAc) in the carbohydrate attached to an Fc region of the antibody are referenced in W003/011878, Jean-Mairet et al. and US
Patent No. 6,602,684, Umana et al. Antibodies with at least one galactose residue in the oligosaccharide attached to an Fc region of the antibody are reported in W097/30087, Patel et al. See, also, W098/58964 (Raju, S.) and W099/22764 (Raju, S.) concerning antibodies with altered carbohydrate attached to the Fe region thereof. Antibody compositions comprising main species antibody with such carbohydrate structures attached to the Fc region are contemplated herein.
Nucleic acid molecules encoding amino acid sequence variants of the Antibody are prepared by a variety of methods known in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide-mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non-variant version of the antibody.
(viii) Screening for antibodies with the desired properties Techniques for generating antibodies have been described above. One may further select antibodies with certain biological characteristics, as desired.
To identify an antibody which blocks ligand activation of a HER receptor, the ability of the antibody to block HER ligand binding to cells expressing the HER receptor (e.g. in conjugation with another HER receptor with which the HER receptor of interest forms a HER hetero-oligomer) may be determined. For example, cells naturally expressing, or transfected to express, HER receptors of the HER
hetero-oligomer may be incubated with the antibody and then exposed to labeled HER ligand. The ability of the HER2 antibody to block ligand binding to the HER receptor in the HER hetero-oligomer may then be evaluated.
For example, inhibition of HRG binding to MCF7 breast tumor cell lines by HER2 antibodies may be performed using monolayer MCF7 cultures on ice in a 24-well-plate format essentially as described in W001/00245. HER2 monoclonal antibodies may be added to each well and incubated for 30 minutes. 125I-labeled rHRG(31177-224 (25 pm) may then be added, and the incubation may be continued for 4 to 16 hours.
Dose response curves may be prepared and an IC50 value may be calculated for the antibody of interest. In one embodiment, the antibody which blocks ligand activation of an HER receptor will have an IC50 for inhibiting HRG binding to MCF7 cells in this assay of about 50nM or less, more preferably lOnM or less. Where the antibody is an antibody fragment such as a Fab fragment, the IC50 for inhibiting HRG binding to MCF7 cells in this assay may, for example, be about IOOnM or less, more preferably 50nM or less.
Alternatively, or additionally, the ability of the HER2 antibody to block HER
ligand-stimulated tyrosine phosphorylation of a HER receptor present in a HER hetero-oligomer may be assessed. For example, cells endogenously expressing the HER receptors or transfected to expressed them may be incubated with the antibody and then assayed for HER ligand-dependent tyrosine phosphorylation activity using an anti-phosphotyrosine monoclonal (which is optionally conjugated with a detectable label). The kinase receptor activation assay described in U.S. Patent No. 5,766,863 is also available for determining HER receptor activation and blocking of that activity by an antibody.
In one embodiment, one may screen for an antibody which inhibits HRG
stimulation of p180 tyrosine phosphorylation in MCF7 cells essentially as described in WOO 1/00245. For example, the MCF7 cells may be plated in 24-well plates and monoclonal antibodies to HER2 may be added to each well and incubated for 30 minutes at room temperature; then rHRG(31177-244 may be added to each well to a final concentration of 0.2 nM, and the incubation may be continued for 8 minutes. Media may be aspirated from each well, and reactions may be stopped by the addition of 100 pl of SDS sample buffer (5% SDS, 25 mM DTT, and 25 mM Tris-HCI, pH
6.8). Each sample (25 l) may be electrophoresed on a 4-12% gradient gel (Novex) and then electrophoretically transferred to polyvinylidene difluoride membrane. Antiphosphotyrosine (at 1 g/ml) immunoblots may be developed, and the intensity of the predominant reactive band at Mr 180,000 may be quantified by reflectance densitometry. The antibody selected will preferably significantly inhibit HRG
stimulation of p180 tyrosine phosphorylation to about 0-35% of control in this assay. A dose-response curve for inhibition of HRG
stimulation of p180 tyrosine phosphorylation as determined by reflectance densitometry may be prepared and an IC50 for the antibody of interest may be calculated. In one embodiment, the antibody which blocks ligand activation of a HER receptor will have an IC50 for inhibiting HRG stimulation of p 180 tyrosine phosphorylation in this assay of about 5OnM or less, more preferably lOnM or less. Where the antibody is an antibody fragment such as a Fab fragment, the IC50 for inhibiting HRG stimulation of p180 tyrosine phosphorylation in this assay may, for example, be about lOOnM or less, more preferably 50nM or less.
One may also assess the growth inhibitory effects of the antibody on MDA-MB-175 cells, e.g, essentially as described in Schaefer et al. Oncogene 15:1385-1394 (1997).
According to this assay, MDA-MB-175 cells may treated with a HER2 monoclonal antibody (10 g/mL) for 4 days and stained with crystal violet.
Incubation with a HER2 antibody may show a growth inhibitory effect on this cell line similar to that displayed by monoclonal antibody 2C4. In a further embodiment, exogenous HRG will not significantly reverse this inhibition. Preferably, the antibody will be able to inhibit cell proliferation of MDA-MB-175 cells to a greater extent than monoclonal antibody 4D5 (and optionally to a greater extent than monoclonal antibody 7F3), both in the presence and absence of exogenous HRG.
Alternatively, or additionally, the ability of the HER2 antibody to block HER
ligand-stimulated tyrosine phosphorylation of a HER receptor present in a HER hetero-oligomer may be assessed. For example, cells endogenously expressing the HER receptors or transfected to expressed them may be incubated with the antibody and then assayed for HER ligand-dependent tyrosine phosphorylation activity using an anti-phosphotyrosine monoclonal (which is optionally conjugated with a detectable label). The kinase receptor activation assay described in U.S. Patent No. 5,766,863 is also available for determining HER receptor activation and blocking of that activity by an antibody.
In one embodiment, one may screen for an antibody which inhibits HRG
stimulation of p180 tyrosine phosphorylation in MCF7 cells essentially as described in WOO 1/00245. For example, the MCF7 cells may be plated in 24-well plates and monoclonal antibodies to HER2 may be added to each well and incubated for 30 minutes at room temperature; then rHRG(31177-244 may be added to each well to a final concentration of 0.2 nM, and the incubation may be continued for 8 minutes. Media may be aspirated from each well, and reactions may be stopped by the addition of 100 pl of SDS sample buffer (5% SDS, 25 mM DTT, and 25 mM Tris-HCI, pH
6.8). Each sample (25 l) may be electrophoresed on a 4-12% gradient gel (Novex) and then electrophoretically transferred to polyvinylidene difluoride membrane. Antiphosphotyrosine (at 1 g/ml) immunoblots may be developed, and the intensity of the predominant reactive band at Mr 180,000 may be quantified by reflectance densitometry. The antibody selected will preferably significantly inhibit HRG
stimulation of p180 tyrosine phosphorylation to about 0-35% of control in this assay. A dose-response curve for inhibition of HRG
stimulation of p180 tyrosine phosphorylation as determined by reflectance densitometry may be prepared and an IC50 for the antibody of interest may be calculated. In one embodiment, the antibody which blocks ligand activation of a HER receptor will have an IC50 for inhibiting HRG stimulation of p 180 tyrosine phosphorylation in this assay of about 5OnM or less, more preferably lOnM or less. Where the antibody is an antibody fragment such as a Fab fragment, the IC50 for inhibiting HRG stimulation of p180 tyrosine phosphorylation in this assay may, for example, be about lOOnM or less, more preferably 50nM or less.
One may also assess the growth inhibitory effects of the antibody on MDA-MB-175 cells, e.g, essentially as described in Schaefer et al. Oncogene 15:1385-1394 (1997).
According to this assay, MDA-MB-175 cells may treated with a HER2 monoclonal antibody (10 g/mL) for 4 days and stained with crystal violet.
Incubation with a HER2 antibody may show a growth inhibitory effect on this cell line similar to that displayed by monoclonal antibody 2C4. In a further embodiment, exogenous HRG will not significantly reverse this inhibition. Preferably, the antibody will be able to inhibit cell proliferation of MDA-MB-175 cells to a greater extent than monoclonal antibody 4D5 (and optionally to a greater extent than monoclonal antibody 7F3), both in the presence and absence of exogenous HRG.
In one embodiment, the HER2 antibody of interest may block heregulin dependent association of HER2 with HER3 in both MCF7 and SK-BR-3 cells as determined in a co-immunoprecipitation experiment such as that described in WOO1/00245 substantially more effectively than monoclonal antibody 4D5, and preferably substantially more effectively than monoclonal antibody 7F3.
To identify growth inhibitory HER2 antibodies, one may screen for antibodies which inhibit the growth of cancer cells which overexpress HER2. In one embodiment, the growth inhibitory antibody of choice is able to inhibit growth of SK-BR-3 cells in cell culture by about 20-100%
and preferably by about 50-100% at an antibody concentration of about 0.5 to 30 g/ml. To identify such antibodies, the SK-BR-3 assay described in U.S. Patent No. 5,677,171 can be performed. According to this assay, SK-BR-3 cells are grown in a 1:1 mixture of F12 and DMEM medium supplemented with 10% fetal bovine serum, glutamine and penicillin streptomycin.
The SK-BR-3 cells are plated at 20,000 cells in a 35mm cell culture dish (2mis/35mm dish). 0.5 to 30 g/ml of the HER2 antibody is added per dish. After six days, the number of cells, compared to untreated cells are counted using an electronic COULTERTM cell counter. Those antibodies which inhibit growth of the SK-BR-3 cells by about 20-100% or about 50-100% may be selected as growth inhibitory antibodies. See US Pat No.
5,677,171 for assays for screening for growth inhibitory antibodies, such as 4D5 and 3E8.
In order to select for HER2 antibodies which induce apoptosis, an annexin binding assay using BT474 cells is available. The BT474 cells are cultured and seeded in dishes as discussed in the preceding paragraph.
The medium is then removed and replaced with fresh medium alone or medium containing 10pg/ml of the monoclonal antibody. Following a three day incubation period, monolayers are washed with PBS and detached by trypsinization. Cells are then centrifuged, resuspended in Ca 2+ binding buffer and aliquotect into tubes as discussed above for the cell death assay. Tubes then receive labeled annexin (e.g. annexin V-FTIC) (l g/ml).
Samples may be analyzed using a FACSCANTM flow cytometer and FACSCONVERTTM
CellQuest software (Becton Dickinson). Those antibodies which induce statistically significant levels of annexin binding relative to control are selected as apoptosis-inducing antibodies. In addition to the annexin binding assay, a DNA staining assay using BT474 cells is available. In order to perform this assay, BT474 cells which have been treated with the antibody of interest as described in the preceding two paragraphs are incubated with 9 g/ml HOECHST
33342TM for 2 hr at 37 C, then analyzed on an EPICS ELITET' flow cytometer (Coulter Corporation) using MODFIT LTTM software (Verity Software House). Antibodies which induce a change in the percentage of apoptotic cells which is 2 fold or greater (and preferably 3 fold or greater) than untreated cells (up to 100%
apoptotic cells) may be selected as pro-apoptotic antibodies using this assay.
See W098/17797 for assays for screening for HER2 antibodies which induce apoptosis, such as 7C2 and 7F3.
To screen for antibodies which bind to an epitope on HER2 bound by an antibody of interest, a routine cross-blocking assay such as that described in Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1988), can be performed to assess whether the antibody cross-blocks binding of an antibody, such as 2C4 or Pertuzumab, to HER2. Alternatively, or additionally, epitope mapping can be performed by methods known in the art and/or one can study the antibody-HER2 structure (Fraxildin et al.
Cancer Cell 5:317-328 (2004)) to see what domain(s) of HER2 is/are bound by the antibody.
(ix) Inmaunoconjugates The invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g. a small molecule toxin or an enzymatically active toxin of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof), or a radioactive isotope (i.e., a radioconjugate).
Chemotherapeutic agents useful in the generation of such immunoconjugates have been described above. Conjugates of an antibody and one or more small molecule toxins, such as a calicheamicin, a maytansine (U.S. Patent No. 5,208,020), a trichothene, and CC1065 are also contemplated herein.
In one preferred embodiment of the invention, the antibody is conjugated to one or more maytansine molecules (e.g. about 1 to about 10 maytansine molecules per antibody molecule). Maytansine may, for example, be converted to May-SS-Me which may be reduced to May-SH3 and reacted with modified antibody (Chari et al. Cancer Research 52: 127-131 (1992)) to generate a maytansinoid-antibody immunoconjugate.
Another imrnunoconjugate of interest comprises a HER2 antibody conjugated to one or more calicheamicin molecules. The calicheamicin family of antibiotics are capable of producing double-stranded DNA breaks at sub-picomolar concentrations. Structural analogues of calicheamicin which may be used include, but are not limited to, yin, a2, a3t, N-acetyl-y11, PSAG and 01, (Hinman et al. Cancer Research 53: 3336-3342 (1993) and Lode et al. Cancer Research 58: 2925-2928 (1998)). See, also, US
Patent Nos. 5,714,586; 5,712,374;
5,264,586; and 5,773,001.
Enzymatically active toxins and fragments thereof which can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A
chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleuritesfordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPI1, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin and the tricothecenes. See, for example, WO 93/21232 published October 28, 1993.
The present invention further contemplates an immunoconjugate formed between an antibody and a compound with nucleolytic activity (e.g. a ribonuclease or a DNA endonuclease such as a deoxyribonuclease;
DNase).
A variety of radioactive isotopes are available for the production of radioconjugated HER2 antibodies.
Examples include At 211 1131 125 90 186 188 153 212 32 , I , Y , Re , Re , Sm , Bi , P and radioactive isotopes of Lu.
Conjugates of the antibody and cytotoxic agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane-l-carboxylate, iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al. Science 238: 1098 (1987). Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See W094/11026. The linker may be a "cleavable linker" facilitating release of the cytotoxic drug in the cell. For example, an acid-labile linker, peptidase-sensitive linker, dimethyl linker or disulfide-containing linker (Chari et al. Cancer Research 52: 127-131 (1992)) may be used.
Alternatively, a fusion protein comprising the HER2 antibody and cytotoxic agent may be made, e.g. by recombinant techniques or peptide synthesis.
To identify growth inhibitory HER2 antibodies, one may screen for antibodies which inhibit the growth of cancer cells which overexpress HER2. In one embodiment, the growth inhibitory antibody of choice is able to inhibit growth of SK-BR-3 cells in cell culture by about 20-100%
and preferably by about 50-100% at an antibody concentration of about 0.5 to 30 g/ml. To identify such antibodies, the SK-BR-3 assay described in U.S. Patent No. 5,677,171 can be performed. According to this assay, SK-BR-3 cells are grown in a 1:1 mixture of F12 and DMEM medium supplemented with 10% fetal bovine serum, glutamine and penicillin streptomycin.
The SK-BR-3 cells are plated at 20,000 cells in a 35mm cell culture dish (2mis/35mm dish). 0.5 to 30 g/ml of the HER2 antibody is added per dish. After six days, the number of cells, compared to untreated cells are counted using an electronic COULTERTM cell counter. Those antibodies which inhibit growth of the SK-BR-3 cells by about 20-100% or about 50-100% may be selected as growth inhibitory antibodies. See US Pat No.
5,677,171 for assays for screening for growth inhibitory antibodies, such as 4D5 and 3E8.
In order to select for HER2 antibodies which induce apoptosis, an annexin binding assay using BT474 cells is available. The BT474 cells are cultured and seeded in dishes as discussed in the preceding paragraph.
The medium is then removed and replaced with fresh medium alone or medium containing 10pg/ml of the monoclonal antibody. Following a three day incubation period, monolayers are washed with PBS and detached by trypsinization. Cells are then centrifuged, resuspended in Ca 2+ binding buffer and aliquotect into tubes as discussed above for the cell death assay. Tubes then receive labeled annexin (e.g. annexin V-FTIC) (l g/ml).
Samples may be analyzed using a FACSCANTM flow cytometer and FACSCONVERTTM
CellQuest software (Becton Dickinson). Those antibodies which induce statistically significant levels of annexin binding relative to control are selected as apoptosis-inducing antibodies. In addition to the annexin binding assay, a DNA staining assay using BT474 cells is available. In order to perform this assay, BT474 cells which have been treated with the antibody of interest as described in the preceding two paragraphs are incubated with 9 g/ml HOECHST
33342TM for 2 hr at 37 C, then analyzed on an EPICS ELITET' flow cytometer (Coulter Corporation) using MODFIT LTTM software (Verity Software House). Antibodies which induce a change in the percentage of apoptotic cells which is 2 fold or greater (and preferably 3 fold or greater) than untreated cells (up to 100%
apoptotic cells) may be selected as pro-apoptotic antibodies using this assay.
See W098/17797 for assays for screening for HER2 antibodies which induce apoptosis, such as 7C2 and 7F3.
To screen for antibodies which bind to an epitope on HER2 bound by an antibody of interest, a routine cross-blocking assay such as that described in Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1988), can be performed to assess whether the antibody cross-blocks binding of an antibody, such as 2C4 or Pertuzumab, to HER2. Alternatively, or additionally, epitope mapping can be performed by methods known in the art and/or one can study the antibody-HER2 structure (Fraxildin et al.
Cancer Cell 5:317-328 (2004)) to see what domain(s) of HER2 is/are bound by the antibody.
(ix) Inmaunoconjugates The invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g. a small molecule toxin or an enzymatically active toxin of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof), or a radioactive isotope (i.e., a radioconjugate).
Chemotherapeutic agents useful in the generation of such immunoconjugates have been described above. Conjugates of an antibody and one or more small molecule toxins, such as a calicheamicin, a maytansine (U.S. Patent No. 5,208,020), a trichothene, and CC1065 are also contemplated herein.
In one preferred embodiment of the invention, the antibody is conjugated to one or more maytansine molecules (e.g. about 1 to about 10 maytansine molecules per antibody molecule). Maytansine may, for example, be converted to May-SS-Me which may be reduced to May-SH3 and reacted with modified antibody (Chari et al. Cancer Research 52: 127-131 (1992)) to generate a maytansinoid-antibody immunoconjugate.
Another imrnunoconjugate of interest comprises a HER2 antibody conjugated to one or more calicheamicin molecules. The calicheamicin family of antibiotics are capable of producing double-stranded DNA breaks at sub-picomolar concentrations. Structural analogues of calicheamicin which may be used include, but are not limited to, yin, a2, a3t, N-acetyl-y11, PSAG and 01, (Hinman et al. Cancer Research 53: 3336-3342 (1993) and Lode et al. Cancer Research 58: 2925-2928 (1998)). See, also, US
Patent Nos. 5,714,586; 5,712,374;
5,264,586; and 5,773,001.
Enzymatically active toxins and fragments thereof which can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A
chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleuritesfordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPI1, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin and the tricothecenes. See, for example, WO 93/21232 published October 28, 1993.
The present invention further contemplates an immunoconjugate formed between an antibody and a compound with nucleolytic activity (e.g. a ribonuclease or a DNA endonuclease such as a deoxyribonuclease;
DNase).
A variety of radioactive isotopes are available for the production of radioconjugated HER2 antibodies.
Examples include At 211 1131 125 90 186 188 153 212 32 , I , Y , Re , Re , Sm , Bi , P and radioactive isotopes of Lu.
Conjugates of the antibody and cytotoxic agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane-l-carboxylate, iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al. Science 238: 1098 (1987). Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See W094/11026. The linker may be a "cleavable linker" facilitating release of the cytotoxic drug in the cell. For example, an acid-labile linker, peptidase-sensitive linker, dimethyl linker or disulfide-containing linker (Chari et al. Cancer Research 52: 127-131 (1992)) may be used.
Alternatively, a fusion protein comprising the HER2 antibody and cytotoxic agent may be made, e.g. by recombinant techniques or peptide synthesis.
In yet another embodiment, the antibody may be conjugated to a "receptor"
(such streptavidin) for utilization in tumor pretargeting wherein the antibody-receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a "ligand" (e.g. avidin) which is conjugated to a cytotoxic agent (e.g. a radionucleotide).
(x) Other antibody modifications Other modifications of the antibody are contemplated herein. For example, the antibody may be linked to one of a variety of nonproteinaceous polymers, e.g., polyethylene glycol, polypropylene glycol, polyoxyalkylenes, or copolymers of polyethylene glycol and polypropylene glycol. The antibody also may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization (for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively), in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules), or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences, IL 6th edition, Oslo, A., Ed., (1980).
It may be desirable to modify the antibody of the invention with respect to effector function, e.g. so as to enhance antigen-dependent cell-mediated cyotoxicity (ADCC) and/or complement dependent cytotoxicity (CDC) of the antibody. This may be achieved by introducing one or more amino acid substitutions in an Fc region of the antibody. Alternatively or additionally, cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region. The homodimeric antibody thus generated may have improved internalization capability and/or increased complement-mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC). See Caron et al., J. Exp Med. 176:1191-1195 (1992) and Shopes, B. J.
Immunol. 148:2918-2922 (1992). Homodimeric antibodies with enhanced anti-tumor activity may also be prepared using heterobifunctional cross-linkers as described in Wolff et al.
Cancer Research 53:2560-2565 (1993). Alternatively, an antibody can be engineered which has dual Fc regions and may thereby have enhanced complement lysis and ADCC capabilities. See Stevenson et al. Anti-Cancer Drug Design 3:219-230 (1989).
W000/42072 (Presta, L.) describes antibodies with improved ADCC function in the presence of human effector cells, where the antibodies comprise amino acid substitutions in the Fe region thereof. Preferably, the antibody with improved ADCC comprises substitutions at positions 298, 333, and/or 334 of the Fc region.
Preferably the altered Fc region is a human IgGl Fe region comprising or consisting of substitutions at one, two or three of these positions.
Antibodies with altered Clq binding and/or complement dependent cytotoxicity (CDC) are described in W099/51642, US Patent No. 6,194,55113 1, US Patent No. 6,242,195B 1, US Patent No. 6,528,624B 1 and US
Patent No. 6,538,124 (Idusogie et al.). The antibodies comprise an amino acid substitution at one or more of amino acid positions 270, 322, 326, 327, 329, 313, 333 and/or 334 of the Fe region thereof.
To increase the serum half life of the antibody, one may incorporate a salvage receptor binding epitope into the antibody (especially an antibody fragment) as described in US Patent 5,739,277, for example. As used herein, the term "salvage receptor binding epitope" refers to an epitope of the Fc region of an IgG molecule (e.g., IgG1, IgG2, IgG3, or IgG4) that is responsible for increasing the in vivo serum half-life of the IgG molecule.
Antibodies with substitutions in an Fc region thereof and increased serum half-lives are also described in W000/42072 (Presta, L.).
(such streptavidin) for utilization in tumor pretargeting wherein the antibody-receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a "ligand" (e.g. avidin) which is conjugated to a cytotoxic agent (e.g. a radionucleotide).
(x) Other antibody modifications Other modifications of the antibody are contemplated herein. For example, the antibody may be linked to one of a variety of nonproteinaceous polymers, e.g., polyethylene glycol, polypropylene glycol, polyoxyalkylenes, or copolymers of polyethylene glycol and polypropylene glycol. The antibody also may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization (for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively), in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules), or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences, IL 6th edition, Oslo, A., Ed., (1980).
It may be desirable to modify the antibody of the invention with respect to effector function, e.g. so as to enhance antigen-dependent cell-mediated cyotoxicity (ADCC) and/or complement dependent cytotoxicity (CDC) of the antibody. This may be achieved by introducing one or more amino acid substitutions in an Fc region of the antibody. Alternatively or additionally, cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region. The homodimeric antibody thus generated may have improved internalization capability and/or increased complement-mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC). See Caron et al., J. Exp Med. 176:1191-1195 (1992) and Shopes, B. J.
Immunol. 148:2918-2922 (1992). Homodimeric antibodies with enhanced anti-tumor activity may also be prepared using heterobifunctional cross-linkers as described in Wolff et al.
Cancer Research 53:2560-2565 (1993). Alternatively, an antibody can be engineered which has dual Fc regions and may thereby have enhanced complement lysis and ADCC capabilities. See Stevenson et al. Anti-Cancer Drug Design 3:219-230 (1989).
W000/42072 (Presta, L.) describes antibodies with improved ADCC function in the presence of human effector cells, where the antibodies comprise amino acid substitutions in the Fe region thereof. Preferably, the antibody with improved ADCC comprises substitutions at positions 298, 333, and/or 334 of the Fc region.
Preferably the altered Fc region is a human IgGl Fe region comprising or consisting of substitutions at one, two or three of these positions.
Antibodies with altered Clq binding and/or complement dependent cytotoxicity (CDC) are described in W099/51642, US Patent No. 6,194,55113 1, US Patent No. 6,242,195B 1, US Patent No. 6,528,624B 1 and US
Patent No. 6,538,124 (Idusogie et al.). The antibodies comprise an amino acid substitution at one or more of amino acid positions 270, 322, 326, 327, 329, 313, 333 and/or 334 of the Fe region thereof.
To increase the serum half life of the antibody, one may incorporate a salvage receptor binding epitope into the antibody (especially an antibody fragment) as described in US Patent 5,739,277, for example. As used herein, the term "salvage receptor binding epitope" refers to an epitope of the Fc region of an IgG molecule (e.g., IgG1, IgG2, IgG3, or IgG4) that is responsible for increasing the in vivo serum half-life of the IgG molecule.
Antibodies with substitutions in an Fc region thereof and increased serum half-lives are also described in W000/42072 (Presta, L.).
Engineered antibodies with three or more (preferably four) functional antigen binding sites are also contemplated (US Appln No. US2002/0004587 Al, Miller et al.).
The HER2 antibodies disclosed herein may also be formulated as irnmunoliposomes. Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., Proc. Natl.
Acad. Sci. USA, 82:3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA, 77:4030 (1980); U.S. Pat. Nos.
4,485,045 and 4,544,545; and W097/38731 published October 23, 1997. Liposomes with enhanced circulation time are disclosed in U.S. Patent No. 5,013,556.
Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
Fab' fragments of the antibody of the present invention can be conjugated to the liposomes as described in Martin et al. J. Biol. Chem. 257: 286-288 (1982) via a disulfide interchange reaction. A chemotherapeutic agent is optionally contained within the liposome. See Gabizon et al. J. National Cancer Inst. 81(19)1484 (1989).
(ix) Exemplary Antibodies Exemplary antibodies which can be formulated according to the present invention include, but are not limited to the following:
anti-ErbB antibodies, including anti-HER2 antibodies, such as those described in more detail herein;
antibodies that bind to a B-cell surface marker, such as CD19, CD20 (for example Rituximab (RITUXAN ) and humanized 2H7), CD22, CD40 or BR3;
antibodies that bind to IgE, including Omalizumab (XOLAIR ) commercially available from Genentech, E26 (Figs. 17A-B herein), HAE1 (Figs. 17A-B herein), IgE antibody with an amino acid substitution at position 265 of an Fc region thereof (US 2004/0191244 Al), Hu-901 (Figs. 17A-B herein), an IgE antibody as in W02004/07001 1, or an antibody (including antibody fragments and full length antibodies) comprising the variable domains of any of those IgE antibodies. See, also, Presta et al., J.
Trnmunol. 151:2623-2632 (1993);
International Publication No. WO 95/19181; US Patent No. 5,714,338, issued February 3, 1998; US Patent No.
5,091,313, issued February 25, 1992; WO 93/04173 published March 4, 1993; WO
99/01556 published January 14, 1999; and US Patent No. 5,714,338;
antibodies that bind to vascular endothelial growth factor (VEGF) or a receptor thereof, including Bevacizumab (AVASTINTM), commercially available from Genentech, and Ranibizumab (LUCENTISTM);
anti-IL-8 antibodies (St John et al., Chest, 103:932 (1993), and International Publication No. WO 95/23865);
anti-PSCA antibodies (WO01/40309);
anti-CD40 antibodies, including S2C6 and humanized variants thereof (WO40D/75348);
anti-CD1 la antibodies, including efalizumab (RAPTIVA ) (US Patent No_ 5,622,700, WO 98/23761, Steppe et al., Transplant Intl. 4:3-7 (1991), and Hourmant et al., Transplantation 58:377-380 (1994)); anti-CD18 antibodies (US Patent No. 5,622,700, issued April 22, 1997, or as in WO
97/26912, published July 31, 1997);
anti-Apo-2 receptor antibody (WO 98/51793 published November 19, 1998);
anti-TNF-alpha antibodies including cA2 (REMICADE ), CDP571 and MAK-195 (See, US Patent No.
5,672,347 issued September 30, 1997, Lorenz et al. J. Inununol. 156(4):1646-1653 (1996), and Dhainaut et al.
Crit. Care Med. 23(9):1461-1469 (1995));
anti-Tissue Factor (TF) (European Patent No. 0 420 937 B 1 granted November 9, 1994);
The HER2 antibodies disclosed herein may also be formulated as irnmunoliposomes. Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., Proc. Natl.
Acad. Sci. USA, 82:3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA, 77:4030 (1980); U.S. Pat. Nos.
4,485,045 and 4,544,545; and W097/38731 published October 23, 1997. Liposomes with enhanced circulation time are disclosed in U.S. Patent No. 5,013,556.
Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
Fab' fragments of the antibody of the present invention can be conjugated to the liposomes as described in Martin et al. J. Biol. Chem. 257: 286-288 (1982) via a disulfide interchange reaction. A chemotherapeutic agent is optionally contained within the liposome. See Gabizon et al. J. National Cancer Inst. 81(19)1484 (1989).
(ix) Exemplary Antibodies Exemplary antibodies which can be formulated according to the present invention include, but are not limited to the following:
anti-ErbB antibodies, including anti-HER2 antibodies, such as those described in more detail herein;
antibodies that bind to a B-cell surface marker, such as CD19, CD20 (for example Rituximab (RITUXAN ) and humanized 2H7), CD22, CD40 or BR3;
antibodies that bind to IgE, including Omalizumab (XOLAIR ) commercially available from Genentech, E26 (Figs. 17A-B herein), HAE1 (Figs. 17A-B herein), IgE antibody with an amino acid substitution at position 265 of an Fc region thereof (US 2004/0191244 Al), Hu-901 (Figs. 17A-B herein), an IgE antibody as in W02004/07001 1, or an antibody (including antibody fragments and full length antibodies) comprising the variable domains of any of those IgE antibodies. See, also, Presta et al., J.
Trnmunol. 151:2623-2632 (1993);
International Publication No. WO 95/19181; US Patent No. 5,714,338, issued February 3, 1998; US Patent No.
5,091,313, issued February 25, 1992; WO 93/04173 published March 4, 1993; WO
99/01556 published January 14, 1999; and US Patent No. 5,714,338;
antibodies that bind to vascular endothelial growth factor (VEGF) or a receptor thereof, including Bevacizumab (AVASTINTM), commercially available from Genentech, and Ranibizumab (LUCENTISTM);
anti-IL-8 antibodies (St John et al., Chest, 103:932 (1993), and International Publication No. WO 95/23865);
anti-PSCA antibodies (WO01/40309);
anti-CD40 antibodies, including S2C6 and humanized variants thereof (WO40D/75348);
anti-CD1 la antibodies, including efalizumab (RAPTIVA ) (US Patent No_ 5,622,700, WO 98/23761, Steppe et al., Transplant Intl. 4:3-7 (1991), and Hourmant et al., Transplantation 58:377-380 (1994)); anti-CD18 antibodies (US Patent No. 5,622,700, issued April 22, 1997, or as in WO
97/26912, published July 31, 1997);
anti-Apo-2 receptor antibody (WO 98/51793 published November 19, 1998);
anti-TNF-alpha antibodies including cA2 (REMICADE ), CDP571 and MAK-195 (See, US Patent No.
5,672,347 issued September 30, 1997, Lorenz et al. J. Inununol. 156(4):1646-1653 (1996), and Dhainaut et al.
Crit. Care Med. 23(9):1461-1469 (1995));
anti-Tissue Factor (TF) (European Patent No. 0 420 937 B 1 granted November 9, 1994);
anti-human a4P7 integrin (WO 98/06248 published February 19, 1998);
anti-EGFR antibodies, including chimerized or humanized 225 antibody as in WO
96/40210 published December 19, 1996;
anti-CD3 antibodies, such as OKT3 (US Patent No. 4,515,893 issued May 7, 1985);
anti-CD25 or anti-tac antibodies such as CHI-621 (SIMULECT ) and (ZENAPAX ) (See US Patent No.
5,693,762 issued December 2, 1997);
anti-CD4 antibodies such as the cM-7412 antibody (Choy et al. Arthritis Rheum 39(1):52-56 (1996));
anti-CD52 antibodies such as CAMPATH-1H (Riechmann et al. Nature 332:323-337 (1988);
anti-Fc receptor antibodies such as the M22 antibody directed against FcyRI as in Graziano et al. J. hnmunol.
155(10):4996-5002 (1995);
anti-carcinoembryonic antigen (CEA) antibodies such as hMN-14 (Sharkey et al.
Cancer Res. 55(23Suppl):
5935s-5945s (1995);
antibodies directed against breast epithelial cells including huBrE-3, hu-Mc 3 and CHL6 (Ceriani et al. Cancer Res. 55(23): 5852s-5856s (1995); and Richman et al. Cancer Res. 55(23 Supp):
5916s-5920s (1995));
antibodies that bind to colon carcinoma cells such as C242 (Litton et al. Eur J. Immunol. 26(1):1-9 (1996));
anti-CD38 antibodies, e.g. AT 13/5 (Ellis et al. J. Jinmunol. 155(2):925-937 (1995));
anti-CD33 antibodies such as Hu M195 (Jurcic et al. Cancer Res 55(23 Suppl):5908s-5910s (1995) and CMA-676 or CDP771;
anti-CD22 antibodies such as LL2 or LymphoCide (Juweid et al. Cancer Res 55(23 Suppl):5899s-5907s (1995);
anti-EpCAM antibodies such as 17-IA (PANOREX );
anti-GpIIb/Illa antibodies such as abciximab or c7E3 Fab (REOPRO );
anti-RSV antibodies such as MEDI-493 (SYNAGIS );
anti-CMV antibodies such as PROTOVIR ;
anti-HIV antibodies such as PR0542;
anti-hepatitis antibodies such as the anti-Hep B antibody OSTAVIR ;
anti-CA 125 antibody OvaRex;
anti-idiotypic GD3 epitope antibody BEC2;
anti-av(33 antibody VITAXIN ;
anti-human renal cell carcinoma antibody such as ch-G250; ING-1;
anti-human 17-1A antibody (3622W94);
anti-human colorectal tumor antibody (A33);
anti-human melanoma antibody R24 directed against GD3 ganglioside;
anti-human squamous-cell carcinoma (SF-25); and anti-human leukocyte antigen (HLA) antibodies such as Smart ID10 and the anti-HLA DR antibody Oncolym (Lym-1).
(xi) Antibody variant compositions The present invention, in at least one aspect, concerns formulations comprising a composition which comprises a mixture of a main species antibody and one or more variants thereof. Where the main species antibody binds HER2, preferably the HER2 antibody (either or both of the main species HER2 antibody and antibody variant thereof) is one which binds to Domain II of HER2, inhibits HER dimerization more effectively than Trastuzumab, and/or binds to a heterodimeric binding site of HER2. The preferred embodiment herein of the main species antibody is one comprising the variable light and variable heavy amino acid sequences in SEQ
ID Nos. 3 and 4, and most preferably comprising a light chain amino acid sequence selected from SEQ ID No.
15 and 23, and a heavy chain amino acid sequence selected from SEQ ID No. 16 and 24.
In one embodiment, the formulated HER2 antibody composition comprises a mixture of the main species HER2 antibody and an amino acid sequence variant thereof comprising an amino-terminal leader extension. Preferably, the amino-terminal leader extension is on a light chain of the antibody variant (e.g. on one or two light chains of the antibody variant). The main species HER2 antibody or the antibody variant may be an full length antibody or antibody fragment (e.g. Fab of F(ab')2 fragments), but preferably both are full length antibodies. The antibody variant herein may comprise an amino-terminal leader extension on any one or more of the heavy or light chains thereof. Preferably, the amino-terminal leader extension is on one or two light chains of the antibody. The amino-terminal leader extension preferably comprises or consists of VHS-. Presence of the amino-terminal leader extension in the composition can be detected by various analytical techniques including, but not limited to, N-terminal sequence analysis, assay for charge heterogeneity (for instance, cation exchange chromatography or capillary zone electrophoresis), mass spectrometry, etc. The amount of the antibody variant in the composition generally ranges from an amount that constitutes the detection limit of any assay (preferably N-terminal sequence analysis) used to detect the variant to an amount less than the amount of the main species antibody. Generally, about 20% or less (e.g. from about 1% to about 15%, for instance from 5% to about 15%) of the antibody molecules in the composition comprise an amino-terminal leader extension.
Such percentage amounts are preferably determined using quantitative N-terminal sequence analysis or cation exchange analysis (preferably using a high-resolution, weak cation-exchange column, such as a PROPAC WCX-IOTM cation exchange column). Aside from the amino-terminal leader extension variant, further amino acid sequence alterations of the main species antibody and/or variant are contemplated, including but not limited to an antibody comprising a C-terminal lysine residue on one or both heavy chains thereof, a deamidated antibody variant, etc.
Moreover, the main species antibody or variant may further comprise glycosylation variations, non-limiting examples of which include HER2 antibody comprising a G1 or G2 oligosaccharide structure attached to the Fc region thereof, HER2 antibody comprising a carbohydrate moiety attached to a light chain thereof (e.g.
one or two carbohydrate moieties attached to one or two light chains of the antibody), HER2 antibody comprising a non-glycosylated heavy chain.
III. Preparation of the Formulation The present invention provides, in a first aspect, a stable pharmaceutical formulation comprising a monoclonal antibody, preferably a full length human or humanized IgG1 antibody, in histidine-acetate buffer, pH 5.5 to 6.5, preferably pH 5.8 to 6.2. However, the antibody in the formulation may be an antibody fragment comprising an antigen-binding region, such as a Fab or F(ab')2 fragment.
In another embodiment, the invention concerns a pharmaceutical formulation comprising, or consisting essentially of, a full length IgG1 antibody susceptible to deamidation or aggregation in an amount from about 10mg/mL to about 250mg/mL; histidine-acetate buffer, pH 5.5 to 6.5; saccharide selected from the group consisting of trehalose and sucrose, in an amount from about 60rnM to about 250mM; and polysorbate 20 in an amount from about 0.01% to about 0.1%.
In yet a further embodiment, the invention provides a pharmaceutical formulation comprising an antibody that binds to domain II of HER2 in a histidine buffer at a pH from about 5.5 to about 6.5, a saccharide and a surfactant. For example, the formulation may comprise Pertuzumab in an amount from about 20mg/mL to about 40mg/mL, histidine-acetate buffer, sucrose, and polysorbate 20, wherein the pH of the formulation is from about 5.5 to about 6.5 In another aspect, the invention provides a pharmaceutical formulation comprising a DR5 antibody in a histidine buffer at a pH from about 5.5 to about 6.5, a saccharide, and a surfactant. Such a formulation may, for example, comprise, Apomab in an amount from about 10mg/rnU to about 30mg/mL, histidine.-acetate buffer, trehalose, and polysorbate 20, wherein the pH of the formulation is from about 5.5 to about 6.5.
The formulation is especially useful for antibodies that are susceptible to deamidation and/or aggregation and/or fragmentation, in that the buffer retards dearnidation and/or aggregation and/or fragmentation of the antibody formulated therein. In addition, unlike other histidine buffers prepared using HCl, the histidine-acetate buffer lacks the chloride ion which was found to be beneficial herein in that this buffer when combined with saccharide had the same protective effect on antibody as polysorbate 20, and was stable and compatible with storage in stainless steel tanks. Thus, in addition to the formulation per se comprising the antibody susceptible to deamidation, aggregation and/or fragmentation, the invention provides a method for reducing deamidation, aggregation and/or fragmentation of a therapeutic ronoclonal antibody (for example, relative to a composition at a different pH or in a different buffer), comprising formulating the antibody in a histidine-acetate buffer, pH 5.5 to 6.5. In this embodiment, one may determine or measure deamidation, aggregation and/or fragmentation before and after the antibody is formulated, with the formulated antibody demonstrating acceptable deamidation, aggregation and/or fragmentation in the formulation and upon storage thereof.
The antibody in the formulation may bind an antigen including but not limited to: HER2, CD20,1gE, DRS, BR3 and VEGF.
Where the formulated antibody binds HER2, it preferably is one which binds to Domain II of HER2, inhibits HER dimerization more effectively than Trastuzumab, and/or binds to a heterodimeric binding site of HER2. The preferred embodiment herein of a formulated HER2 antibody is one comprising the variable light and variable heavy amino acid sequences in SEQ ID Nos. 3 and 4, and most preferably comprising the light chain and heavy chain amino acid sequences in SEQ ID Nos. 15 and 16 (Pertuzumab).
Examples of CD20 antibodies which can be formulated herein include: "C2B8"
which is now called "Rituximab" ("RITUXAN ") commercially available from Genentech (see also US
Patent No. 5,736,137);
the yttrium-[90] -labeled 2B8 murine antibody designated "Y2B8"
or "Ibritumomab Tiuxetan" ZEVALIN commercially available from Biogen-Idec (see also US Patent No.
5,736,137)') . marine IgG2a "B 1," also called "Tositumomab,"
optionally labeled with 1311 to generate the "1311-B I" antibody (iodine 1131 tositumomab, BEXXARTM) (US
Patent No. 5,595,721); marine monoclonal antibody "1F5" (Press et al. Blood 69(2):584-591 (1987) and variants thereof including "framework patched" or humanized 1F5 (WO03/002607, Leung, S.); ATCC deposit HB-96450); murine 2H7 and chimeric 2117 antibody (Clark et al.
PNAS 82: 1766-1770 (1985); US Patent No. 5,500,362.); humanized 2H7; huMax-CD20 (WO 04/035607, Genmab, Denmark); AME-133 (Applied Molecular Evolution); A20 antibody or variants thereof such as chimeric or humanized A20 antibody (cA20, hA20, respectively) (US
2003/0219433, Immunomedics); and monoclonal antibodies L27, G28-2, 93-1B3, B-Cl or NU-B2 available from the International Leukocyte Typing Workshop (Valentine et al., In:
Leukocyte Typing III (McMichael, Ed., p. 440, Oxford University Press (1987)).
In the preferred embodiment of a formulated CD20 antibody, the CD20 antibody is a humanized 2H7 antibody. Prefered humanized 2H7 antibodies herein are 2H7v16 and 2H7v511. The humanized 2H7v16 may be an intact antibody or antibody fragment comprising the variable light and variable heavy sequences in Figs.
18A-B (SEQ ID Nos. 26 and 29). Where the humanized 2H7vl6 antibody is a full length antibody, preferably it comprises the light and heavy chain amino acid sequences with SEQ ID Nos. 63 and 65.
Where the antibody binds VEGF, it preferably comprises the variable domain sequences as depicted in Fig. 19. The most preferred anti-VEGF antibody is full length humanized IgGlantibody, Bevacizurriab (AVASTINTM), commercially available from Genentech.
Where the formulated antibody binds IgE, it is preferably selected from the group consistirag of. E25, Omalizumab (XOLAIRO) commercially available from Genentech (see also Figs. 17A-B), E26 (Figs. 17A-B
herein), HAE1 (Figs. 17A-B herein), IgE antibody with an amino acid substitution at position 265 of an Fc region thereof (US 2004/0191244 Al), Hu-901 (Figs. 17A-B herein), an IgE
antibody as in W02004/07001 1, or an antibody (including antibody fragments and full length antibodies) comprising the variable domains of any of those IgE antibodies.
Where the antibody binds to a receptor in the tumor necrosis factor (TNF) superfamily or to a death receptor, it preferably binds to DR5, and preferably is an agonist antibody.
Publications in this area include Sheridan et al., Science, 277:818-821 (1997), Pan et al., Science, 277:815-818 (1997), W098/51793 published November 19, 1998; W098/41629 published September 24, 1998; Screaton et al., Curr. Biol., 7:693-696 (1997);
Walczak et al., EMBO J., 16:5386-5387 (1997); Wu et al., Nature Genetics, 17:141-143 (1997); WCD98/35986 published August 20, 1998; EP870,827 published October 14, 1998; W098/46643 published October 22, 1998;
W099/02653 published January 21, 1999; W099/09165 published February 25, 1999;
W099/11791 published March 11, 1999; US 2002/0072091 published August 13, 2002; US 2002/0098550 published Decennber 7, 2001;
US 6,313,269 issued December 6, 2001; US 2001/0010924 published August 2, 2001; US 2003/01255540 published July 3, 2003; US 2002/0160446 published October 31, 2002, US
2002/0048785 published April 25, 2002; US 6,342,369 issued February, 2002; US 6,569,642 issued May 27, 2003, US
6,072,047 issued June 6, 2000, US 6,642,358 issued November 4, 2003; US 6,743,625 issued June 1, 2004.
The most preferred DR5 antibody is Apomab.
Each of the formulations noted above comprises a buffer, preferably a histidine buffer, and most preferably a histidine-acetate buffer with a pH of 5.5 to 6.5, preferably 5.8 to 6.2, for example approximately 6Ø
The concentration of the buffer is dictated, at least in part, by the desired pH. Exemplary concentrations for the buffer are in the range from about 1mM to about 200mM, preferably from about 10mM to about 40rnM, most preferably about 20mM.
The antibody concentration in the formulation is preferably in the range from about 10mg/rnL to about 250mg/mL. The antibody concentration may be determined based on the intended use and mode of administration of the formulation. For example, where the formulation is for IV administration (e.g_ a HER2 antibody), the antibody concentration in the formulation is preferably from about 20mg/mL to about 40mg/mL.
In the exemplified Pertuzumab formulation intended for intravenous (IV) administration, the antibody concentration was from about 20mg/mL to about 40mg/mL, most preferably about 30mg/mL.
Where the antibody is for SQ or IM administration (e.g. for an anti-IgE
antibody) higher concentrations of the antibody may be desired. Such substantially high antibody concentrations may be from about 50mg/mL to about 250mg/mL, or from about 80mg/mL to about 250mg/mL, or from about 100mg/mL to about 200mg/mL.
Where the formulation comprises a DR5 antibody, such as Apomab, exemplary antibody concentrations are from about 10mg/mL to about 30mg/mL, for example about 20mg/mL DR5 antibody; such formulation being useful for intravenous administration.
The formulation for administration is preferably an aqueous formulation (not lyophilized) and has not been subjected to prior lyophilization. While the formulation may be lyophilized, preferably it is not. However, freezing of the aqueous formulation, without simultaneous drying that occurs during freeze-drying, is specifically contemplated herein, facilitating longer term storage thereof, for instance in a stainless steel tank.
The formulation preferably further comprises a saccharide, most preferably a disaccharide, such as trehalose or sucrose. The saccharide is generally included in an amount which reduces soluble aggregate formation, such as that which occurs upon freeze/thaw. Exemplary saccharide concentrations are in the range from about 10mM to about 1M, for example from about 60mM to about 250mM, and most preferably about 120mM for a HER2 antibody formulation, and about 240mM for a DR5 antibody formulation.
While it was found herein that a formulation comprising histidine-acetate buffer and saccharide was stable, the formulation optionally further comprises surfactant, such as polysorbate, most preferably polysorbate 20. The surfactant is generally included in an amount which reduces insoluble aggregate formation (such as that which occurs upon shaking or shipping). The surfactant concentration is preferably from about 0.0001% to about 1.0%, most preferably from about 0.01% to about 0.1%, for example about 0.02%.
Optionally, the formulation does not contain a tonicifying amount of a salt such as sodium chloride.
The formulation is generally sterile, and this can be achieved according to the procedures known to the skilled person for generating sterile pharmaceutical formulations suitable for administration to human subjects, including filtration through sterile filtration membranes, prior to, or following, preparation of the formulation.
Moreover, the formulation is desirably one which has been demonstrated to be stable upon storage.
Various stability assays are available to the skilled practitioner for confirming the stability of the formulation.
For example, the formulation may be one which is found to be stable upon storage: at about 40 C for at least 4 weeks; at about 5 C or about 15 C for at least 3 months or at least 1 year;
and/or about -20 C for at least 3 months. Stability can be tested by evaluating physical stability, chemical stability, and/or biological activity of the antibody in the formulation around the time of formulation as well as following storage at the noted temperatures. Physical and/or stability can be evaluated qualitatively and/or quantitatively in a variety of different ways, including evaluation of aggregate formation (for example using size exclusion chromatography, by measuring turbidity, and/or by visual inspection); by assessing charge heterogeneity using cation exchange chromatography or capillary zone electrophoresis; amino-terminal or carboxy-terminal sequence analysis; mass spectrometric analysis; SDS-PAGE analysis to compare reduced and intact antibody; peptide map (for example tryptic or LYS-C) analysis; evaluting biological activity or antigen binding function of the antibody; etc.
Instability may result in aggregation, deamidation (e.g. Asn deamidation), oxidation (e.g. Met oxidation), isomerization (e.g. Asp isomeriation), clipping/hydrolysis/fragmentation (e.g.
hinge region fragmentation), succinimide formation, unpaired cysteine(s), N-terminal extension, C-terminal processing, glycosylation differences, etc. Biological activity or antigen binding function can be evaluated using various techniques available to the skilled practitioner.
As noted above, freezing of the formulation is specifically contemplated herein. Hence, the formulation can be tested for stability upon freezing and thawing.
According, the invention also provides a method of making a pharmaceutical formulation comprising preparing the formulation as described herein, and evaluating physical stability, chemical stability, or biological activity of the monoclonal antibody in the formulation.
In the preferred embodiment, the formulation is provided inside a vial with a stopper pierceable by a syringe, preferably in aqueous form. The vial is desirably stored at about 2-8-C until it is administered to a subject in need thereof. The vial may for example be a 20cc vial (for example for a 420mg dose) or 50cc vial (for example for a 1050mg dose). For a DR5 antibody, such as Apomab, the formulation may be provided in a 5cc glass vial (e.g. 5.5m1 fill).
In another embodiment, the formulation is provided inside a stainless steel tank. The formulation in the stainless steel tank is optionally frozen and not freeze-dried.
One or more other pharmaceutically acceptable carriers, excipients or stabilizers such as those described in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed.
(1980) may be included in the formulation provided that they do not adversely affect the desired characteristics of the formulation. Acceptable carriers, excipients or stabilizers are nontoxic to recipients at the dosages and concentrations employed and include; additional buffering agents; co-solvents; antioxidants including ascorbic acid and methionine; chelating agents such as EDTA; metal complexes (e.g. Zn-protein complexes);
biodegradable polymers such as polyesters;
preservatives; and/or salt-forming counterions such as sodium.
IV. Treatment with the Antibody Formulation In one embodiment, the invention provides a method of treating a disease or disorder in a subject comprising administering the formulation described herein to a subject in an amount effective to treat the disease or disorder.
Where the antibody in the formulation binds to HER2, it is preferably used to treat cancer. The cancer will generally comprise HER2-expressing cells, such that the HER2 antibody herein is able to bind to the cancer cells. Thus, the invention in this embodiment concerns a method for treating I3ER2-expressing cancer in a subject, comprising administering the HER2 antibody pharmaceutical formulation to the subject in an amount effective to treat the cancer. Various cancers that can be treated with the composition are listed in the definitions section above.
It is also contemplated that the HER2 antibody formulation may be used to treat various non-malignant diseases or disorders, such a include autoimmune disease (e.g. psoriasis);
endometriosis; scleroderma; restenosis;
polyps such as colon polyps, nasal polyps or gastrointestinal polyps;
fibroadenoma; respiratory disease (see definition above); cholecystitis; neurofibromatosis; polycystic kidney disease; inflammatory diseases; skin disorders including psoriasis and dermatitis; vascular disease (see definition above); conditions involving abnormal proliferation of vascular epithelial cells; gastrointestinal ulcers;
Menetrier's disease, secreting adenomas or protein loss syndrome; renal disorders; angiogenic disorders;
ocular disease such as age related macular degeneration, presumed ocular histoplasmosis syndrome, retinal neovascularization from proliferative diabetic retinopathy, retinal vascularization, diabetic retinopathy, or age related macular degeneration; bone associated pathologies such as osteoarthritis, rickets and osteoporosis;
damage following a cerebral ischemic event; fibrotic or edemia diseases such as hepatic cirrhosis, lung fibrosis, carcoidosis, throiditis, hyperviscosity syndrome systemic, Osler Weber-Rendu disease, chronic occlusive pulmonary disease, or edema following burns, trauma, radiation, stroke, hypoxia or ischemia; hypersensitivity reaction of the skin; diabetic retinopathy and diabetic nephropathy; Guillain-Barre syndrome; graft versus host disease or transplant rejectiori; Paget's disease; bone or joint inflammation; photoaging (e.g. caused by UV radiation of human skin); benign prostatic hypertrophy; certain microbial infections including microbial pathogens selected from adenovirus, 1hantaviruses, Borrelia burgdorferi, Yersinia spp. and Bordetella pertussis; thrombus caused by platelet aggregation;
reproductive conditions such as endometriosis, ovarian hyperstimulation syndrome, preeclampsia, dysfunctional uterine bleeding, or menometrorrhagia; synovitis; atheroma; acute and chronic nephropathies (including proliferative glomerulonephritis and diabetes-induced renal disease); eczema;
hypertrophic scar formation;
endotoxic shock and fungal infection; familial adenomatosis polyposis;
neurodedenerative diseases (e.g.
Alzheimer's disease, AIDS-related dementia, Parkinson's disease, amyotrophic lateral sclerosis, retinitis pigmentosa, spinal muscular atrophy and cerebellar degeneration);
myelodysplastic syndromes; aplastic anemia;
ischemic injury; fibrosis of the lung, kidney or liver; T-cell mediated hypersensitivity disease; infantile hypertrophic pyloric stenosis; urinary obstructive syndrome; psoriatic arthritis; and Hasimoto's thyroiditis.
Preferred non-malignant indications for therapy herein include psoriasis, endometriosis, sclerodernza, vascular disease (e.g. restenosis, artherosclerosis, coronary artery disease, or hypertension), colon polyps, fibroadenoma or respiratory disease (e.g. asthma, chronic bronchitis, bronchieactasis or cystic fibrosis).
Where the antibody in the formulation binds to a B-cell surface marker such as CD20 or B R3, the formulation may be used to treat a B-cell malignancy, such as NHL or CLL, an autoimmune disease, graft rejection, or to block an immune response to a foreign antigen, such as an antibody, a toxin, a gene -therapy viral vector, a graft, an infectious agent, or an alloantigen (see WO 01/03734, Grillo-Lopez et al.).
Where the antibody in the formulation is an IgE antibody, it may be used to treat an IgE-mediated disorder (USSN 2004/0197324 Al, Liu and Shire), such as allergic asthma, allergic rhinitis, atopic dermatitis, allergic gastroenteropathy, hypersensitivity, eczema, urticaria, allergic bronchopulmonary aspergillosis, parasitic disease, hyper-IgE syndrome, ataxia-telangiectasia, Wiskott-Aldrich syndrome, thymic alymphoplasia, IgE
myeloma, and graft-versus-host reaction.
Antibodies that bind to a receptor in the TNF superfamily (for instance which bind to DRS), or which bind to VEGF (or a receptor thereof), may be used to treat cancer, various forms of which are described in the definitions section above. Preferably, the cancer treated with a DR5 antibody formulation is a solid tumor or NHL.
Where the indication is cancer, the patient may be treated with a combination of the antibody formulation, and a chemotherapeutic agent. The combined administration includes coadministration or concurrent administration, using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order, wherein preferably there is a time period while both (or all) active agents simultaneously exert their biological activities. Thus, the chemotherapeutic agent may be administered prior to, or following, administration of the composition. In this embodiment, the timing between at least one administration of the chemotherapeutic agent and at least one administration of the composition is preferably approximately 1 month or less, and most preferably approximately 2 weeks or less. Alternatively, the chemotherapeutic agent and the composition are administered concurrently to the patient, in a single formulation or separate formulations.
Treatment -with the formulation will result in an improvement in the signs or symptoms of cancer or disease. For instance, where the disease being treated is cancer, such therapy may result in an improvement ir.
survival (overall survival and/or progression free survival) and/or may result in an objective clinical response (partial or complete). Moreover, treatment with the combination of the chemotherapeutic agent and the antibody formulation may result in a synergistic, or greater than additive, therapeutic benefit to the patient.
Preferably, the antibody in the formulation administered is a naked antibody.
However, the antibody administered may be conjugated with a cytotoxic agent. Preferably, the immunoconjugate and/or antigen to which it is bound is/are internalized by the cell, resulting in increased therapeutic efficacy of the immunoconjugate in killing the cancer cell to which it binds. In a preferred embodiment, the cytotoxic agent targets or interferes -with nucleic acid in the cancer cell. Examples of such cytotoxic agents include maytansinoids, calicheamicins, ribonucleases and DNA endonucleases.
The formulation is administered to a human patient in accord with known methods, such as intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes.
Intravenous, intramuscular or subcutaneous administration of antibody composition is preferred, with intravenous administration being most preferred.
For subcutaneous delivery, the formulation may be administered via syringe;
injection device (e.g. the INJECT-EASETM and GENJECTTM device); injector pen (such as the GENPENTM);
needleless device (e.g.
MEDIJECTORTM and BIOJECTORTM); or subcutaneous patch delivery system.
For the prevention or treatment of disease, the appropriate dosage of the antibody will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician. The antibody is suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of the disease, about 1 tg/kg to 50 mg/kg (e.g. 0.1-20mg/kg) of HER2 or DR5 antibody is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. The dosage of the antibody will generally be in the range from about 0.05mg/kg to about 10mg/kg. If a chemotherapeutic agent is administered, it is usually administered at dosages known therefor, or optionally lowered due to combined action of the drugs or negative side effects attributable to administration of the chemotherapeutic agent. Preparation and dosing schedules for such chemotherapeutic agents may be used according to manufacturers' instructions or as determined empirically by the skilled practitioner. Preparation and dosing schedules for such chemotherapy are also described in Chemotherapy Service Ed., M.C. Perry, Williams & Wilkins, Baltimore, MD (1992).
Other therapeutic regimens may be combined with the antibody including, but not limited to: a second (third, fourth, etc) chemotherapeutic agent(s) (i.e. "cocktails" of different chemotherapeutic agents); another monoclonal antibody;a growth inhibitory agent; a cytotoxic agent; a chemotherapeutic agent; EGFR-targeted drug; tyrosine kinase inhibitor; anti-angiogenic agent; and/or cytokine; etc.
In addition to the above therapeutic regin-ies, the patient may be subjected to surgical removal of cancer cells and/or radiation therapy.
V. Articles of Manufacture In another embodiment of the invention, an article of manufacture is provided which contains the pharmaceutical formulation of the present invention and provides instructions for its use. The article of manufacture comprises a container. Suitable containers include, for example, bottles, vials (e.g. dual chamber vials), syringes (such as dual chamber syringes) and test tubes. The container may be formed from a variety of materials such as glass or plastic. The container holds the formulation and the label on, or associated with, the container may indicate directions for use. The container holding the formulation may be a multi-use vial, which allows for repeat administrations (e.g. from 2-6 ad ministrations) of the reconstituted formulation. The article of manufacture may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for usc, as noted in the previous section.
The invention will be more fully understood by reference to the following examples. They should not, however, be construed as limiting the scope of the invention.
EXAMPLES
Stable Pertuzumab Liquid Formulations These examples describe the development and stability testing of stable liquid formulations comprising Pertuzumab at protein concentrations in the range from about 10 mg/mL - 180 mg/mL. The selected formulations had low turbidity, and were physically and chemically stable. A
chloride ion was removed from the formulation to reduce the risk of corrosion. The formulation was isotonic, and suitable for subcutaneous or intramuscular delivery. Insoluble aggregate formation upon agitation stress was prevented using histidine-acetate and sucrose formulation, without the need to include polysorbate 20.
Analytical Methods Color, Appearance and Clarity (CAC) The color, appearance, and clarity of the samples were determined by visual inspection of vials against a white and black background under white fluorescence light at room temperature.
UV Concentration Measurements The liquid product aliquot was first diluted with formulation buffer so that the A,, near 278 nm is within 0.5-1.0 absorbance unit. The UV absorbance of the diluted samples was measured in a quartz cuvette with 1 cm path length on an HP 8453 spectrophotometer. Absorbance was measured at 278 urn and 320 nm. The absorbance from 320 nm is used to correct background light scattering due to larger aggregates, bubbles and particles. The measurements were blanked against the formulation buffer. The protein concentration was determined using the absorptivity of 1.50 (mg/mL)-'cm'.
pH measurements The pH was measured at room temperature using a RADIOMETER COPENHAGEN PHM82TM
pB
meter. The probe used was a combined glass/reference electrode with radiometer connector (Sigma, Cat# E-5759). Standard solutions of pH 4.01 and pH 7.00 (EM Science) were used for calibration of the pH meter.
Ion-Exchange Chromatography (IEX) Cation exchange chromatography was employed to measure changes in charge variants. This assay utilizes a DIONEX PROPAC WCX-10TM column on an HP 1100TM HPLC system. Samples were diluted to 1 mg/mL with the mobile phase A containing 20 mM NMS at pH 6_0. 50 mL of diluted samples were then loaded on the column that was kept at ambient temperature. The peaks were eluted with a shallow NaCl gradient using mobile B containing 20 mM MES, 250 mM NaCl, pH 6Ø The eluent was monitored at 280 nm. The data were analyzed using HP CHEMSTATIONTM software (Rev A08.03).
Capillary Zone Electrophophoresis (CZE) The purity of Fab and F(ab')2 fragments was determined by CZE. This assay was run on a BIORAD
BIOFOCUSTM 3000TM capillary electrophoresis system with a BIOCAP XLTM
capillary, 50 gm I.D., 44.6 cm total length and 40 cm to the detector.
Size Exclusion Chromatography (SEC) Size exclusion chromatography was used to quantitate aggregates and fragments.
This assay utilizes a TSK G3000 SWXLTM, 7.8 x 300 mm column and runs on an HP 1100TH HPLC system.
Samples were diluted to mg/mL with the mobile phase and injection volume was 20 L.. The mobile phase was 100 mM K2HPO4. at pH 6.8 and the protein was eluted with an isocratic gradient at 0.5 mL/min for 45 minutes. The eluent absorbance was monitored at 280 nm. Integration was done using HP
CHEMSTATIONTM software (Rev A08.03).
Biological Activity The biological activity of Pertuzumab was determined by measuring its ability to inhibit proliferation of the human breast cancer cell line MDA-MB-175-VII.
Pertuzumab Fab and F(ab')2 antibody fragments were formulated at protein concentration of 1.0 nag/ml, in the following buffer conditions:
10 mM citrate, 140 mM NaCl, pH 4.0;
10 mM succinate, 140 mM NaCl, pH 5.0;
10 mM succinate, 140 mM NaCl,, pH 6.0;
10 mM histidine, 140 mM NaCl, pH 7.0; and mM glycylglycine, 140 mM NaCl, pH 8Ø
Each formulation was filtered then aliquoted into 3 cc WHEATONTM USP Type I
glass vials sealed with TEFLONTM coated gray butyl stoppers. Samples were stored at 40 2 C.
The stability analyses of drug product showed that the Fab and F(ab')2 were most stable between pH 5.0 and 6Ø
Table 2. Effect of pH on degradation of Fab or F(ab')2 stored at 40 C
Formulation pH Fab F(ab')2 CZE SEC CZE SEC
% Main Peak % Main Peak % Main Peak % Main Peak 4.0 74.1 96.7 43.6 89.4 5.0 83.2 96.4 65.4 94.0 6.0 82.9 96.2 69.0 92.3 7.0 83.9 96.4 62.3 91.3 8.0 72.7 96.4 49.2 89.8 Pertuzumab was formulated into 20 mM histidine-acetate buffer with 120 mM
sucrose and 0.02 %
polysorbate 20. The pHs of formulations were adjusted with acetic acid to final pH between 5.0 and 7Ø The protein concentration was 30 mg/mL. Each formulation was filled into 3 cc USP
Type I glass vials and stored at 40 C for stability analysis. The results showed that Pertuzumab was most stable around pH 6Ø
Table 3. Effect of pH on degradation of Pertuzumab stored at 40 C
Formulation pH Temperature Storage Time SEC IEX
( C) (wks) % Monomer % Main Peak 5.0 40 2 99.4 57.4 5.5 40 2 99.4 59.2 6.0 40 2 99.4 60.6 6.5 40 2 99.3 60.5 7.0 40 2 99.1 54.0 5.0 40 4 97.3 48.1 5.5 40 4 99.1 50.5 6.0 40 4 99.1 53.3 6.5 40 4 99.0 52.3 7.0 40 4 98.6 42.3 Pertuzumab formulations at protein concentration of 100 mg/mL were prepared in the following excipients:
(1) 10 mM histidine-HCI, 240 mM sucrose, 0.02% polysorbate 20, pH 6.0;
anti-EGFR antibodies, including chimerized or humanized 225 antibody as in WO
96/40210 published December 19, 1996;
anti-CD3 antibodies, such as OKT3 (US Patent No. 4,515,893 issued May 7, 1985);
anti-CD25 or anti-tac antibodies such as CHI-621 (SIMULECT ) and (ZENAPAX ) (See US Patent No.
5,693,762 issued December 2, 1997);
anti-CD4 antibodies such as the cM-7412 antibody (Choy et al. Arthritis Rheum 39(1):52-56 (1996));
anti-CD52 antibodies such as CAMPATH-1H (Riechmann et al. Nature 332:323-337 (1988);
anti-Fc receptor antibodies such as the M22 antibody directed against FcyRI as in Graziano et al. J. hnmunol.
155(10):4996-5002 (1995);
anti-carcinoembryonic antigen (CEA) antibodies such as hMN-14 (Sharkey et al.
Cancer Res. 55(23Suppl):
5935s-5945s (1995);
antibodies directed against breast epithelial cells including huBrE-3, hu-Mc 3 and CHL6 (Ceriani et al. Cancer Res. 55(23): 5852s-5856s (1995); and Richman et al. Cancer Res. 55(23 Supp):
5916s-5920s (1995));
antibodies that bind to colon carcinoma cells such as C242 (Litton et al. Eur J. Immunol. 26(1):1-9 (1996));
anti-CD38 antibodies, e.g. AT 13/5 (Ellis et al. J. Jinmunol. 155(2):925-937 (1995));
anti-CD33 antibodies such as Hu M195 (Jurcic et al. Cancer Res 55(23 Suppl):5908s-5910s (1995) and CMA-676 or CDP771;
anti-CD22 antibodies such as LL2 or LymphoCide (Juweid et al. Cancer Res 55(23 Suppl):5899s-5907s (1995);
anti-EpCAM antibodies such as 17-IA (PANOREX );
anti-GpIIb/Illa antibodies such as abciximab or c7E3 Fab (REOPRO );
anti-RSV antibodies such as MEDI-493 (SYNAGIS );
anti-CMV antibodies such as PROTOVIR ;
anti-HIV antibodies such as PR0542;
anti-hepatitis antibodies such as the anti-Hep B antibody OSTAVIR ;
anti-CA 125 antibody OvaRex;
anti-idiotypic GD3 epitope antibody BEC2;
anti-av(33 antibody VITAXIN ;
anti-human renal cell carcinoma antibody such as ch-G250; ING-1;
anti-human 17-1A antibody (3622W94);
anti-human colorectal tumor antibody (A33);
anti-human melanoma antibody R24 directed against GD3 ganglioside;
anti-human squamous-cell carcinoma (SF-25); and anti-human leukocyte antigen (HLA) antibodies such as Smart ID10 and the anti-HLA DR antibody Oncolym (Lym-1).
(xi) Antibody variant compositions The present invention, in at least one aspect, concerns formulations comprising a composition which comprises a mixture of a main species antibody and one or more variants thereof. Where the main species antibody binds HER2, preferably the HER2 antibody (either or both of the main species HER2 antibody and antibody variant thereof) is one which binds to Domain II of HER2, inhibits HER dimerization more effectively than Trastuzumab, and/or binds to a heterodimeric binding site of HER2. The preferred embodiment herein of the main species antibody is one comprising the variable light and variable heavy amino acid sequences in SEQ
ID Nos. 3 and 4, and most preferably comprising a light chain amino acid sequence selected from SEQ ID No.
15 and 23, and a heavy chain amino acid sequence selected from SEQ ID No. 16 and 24.
In one embodiment, the formulated HER2 antibody composition comprises a mixture of the main species HER2 antibody and an amino acid sequence variant thereof comprising an amino-terminal leader extension. Preferably, the amino-terminal leader extension is on a light chain of the antibody variant (e.g. on one or two light chains of the antibody variant). The main species HER2 antibody or the antibody variant may be an full length antibody or antibody fragment (e.g. Fab of F(ab')2 fragments), but preferably both are full length antibodies. The antibody variant herein may comprise an amino-terminal leader extension on any one or more of the heavy or light chains thereof. Preferably, the amino-terminal leader extension is on one or two light chains of the antibody. The amino-terminal leader extension preferably comprises or consists of VHS-. Presence of the amino-terminal leader extension in the composition can be detected by various analytical techniques including, but not limited to, N-terminal sequence analysis, assay for charge heterogeneity (for instance, cation exchange chromatography or capillary zone electrophoresis), mass spectrometry, etc. The amount of the antibody variant in the composition generally ranges from an amount that constitutes the detection limit of any assay (preferably N-terminal sequence analysis) used to detect the variant to an amount less than the amount of the main species antibody. Generally, about 20% or less (e.g. from about 1% to about 15%, for instance from 5% to about 15%) of the antibody molecules in the composition comprise an amino-terminal leader extension.
Such percentage amounts are preferably determined using quantitative N-terminal sequence analysis or cation exchange analysis (preferably using a high-resolution, weak cation-exchange column, such as a PROPAC WCX-IOTM cation exchange column). Aside from the amino-terminal leader extension variant, further amino acid sequence alterations of the main species antibody and/or variant are contemplated, including but not limited to an antibody comprising a C-terminal lysine residue on one or both heavy chains thereof, a deamidated antibody variant, etc.
Moreover, the main species antibody or variant may further comprise glycosylation variations, non-limiting examples of which include HER2 antibody comprising a G1 or G2 oligosaccharide structure attached to the Fc region thereof, HER2 antibody comprising a carbohydrate moiety attached to a light chain thereof (e.g.
one or two carbohydrate moieties attached to one or two light chains of the antibody), HER2 antibody comprising a non-glycosylated heavy chain.
III. Preparation of the Formulation The present invention provides, in a first aspect, a stable pharmaceutical formulation comprising a monoclonal antibody, preferably a full length human or humanized IgG1 antibody, in histidine-acetate buffer, pH 5.5 to 6.5, preferably pH 5.8 to 6.2. However, the antibody in the formulation may be an antibody fragment comprising an antigen-binding region, such as a Fab or F(ab')2 fragment.
In another embodiment, the invention concerns a pharmaceutical formulation comprising, or consisting essentially of, a full length IgG1 antibody susceptible to deamidation or aggregation in an amount from about 10mg/mL to about 250mg/mL; histidine-acetate buffer, pH 5.5 to 6.5; saccharide selected from the group consisting of trehalose and sucrose, in an amount from about 60rnM to about 250mM; and polysorbate 20 in an amount from about 0.01% to about 0.1%.
In yet a further embodiment, the invention provides a pharmaceutical formulation comprising an antibody that binds to domain II of HER2 in a histidine buffer at a pH from about 5.5 to about 6.5, a saccharide and a surfactant. For example, the formulation may comprise Pertuzumab in an amount from about 20mg/mL to about 40mg/mL, histidine-acetate buffer, sucrose, and polysorbate 20, wherein the pH of the formulation is from about 5.5 to about 6.5 In another aspect, the invention provides a pharmaceutical formulation comprising a DR5 antibody in a histidine buffer at a pH from about 5.5 to about 6.5, a saccharide, and a surfactant. Such a formulation may, for example, comprise, Apomab in an amount from about 10mg/rnU to about 30mg/mL, histidine.-acetate buffer, trehalose, and polysorbate 20, wherein the pH of the formulation is from about 5.5 to about 6.5.
The formulation is especially useful for antibodies that are susceptible to deamidation and/or aggregation and/or fragmentation, in that the buffer retards dearnidation and/or aggregation and/or fragmentation of the antibody formulated therein. In addition, unlike other histidine buffers prepared using HCl, the histidine-acetate buffer lacks the chloride ion which was found to be beneficial herein in that this buffer when combined with saccharide had the same protective effect on antibody as polysorbate 20, and was stable and compatible with storage in stainless steel tanks. Thus, in addition to the formulation per se comprising the antibody susceptible to deamidation, aggregation and/or fragmentation, the invention provides a method for reducing deamidation, aggregation and/or fragmentation of a therapeutic ronoclonal antibody (for example, relative to a composition at a different pH or in a different buffer), comprising formulating the antibody in a histidine-acetate buffer, pH 5.5 to 6.5. In this embodiment, one may determine or measure deamidation, aggregation and/or fragmentation before and after the antibody is formulated, with the formulated antibody demonstrating acceptable deamidation, aggregation and/or fragmentation in the formulation and upon storage thereof.
The antibody in the formulation may bind an antigen including but not limited to: HER2, CD20,1gE, DRS, BR3 and VEGF.
Where the formulated antibody binds HER2, it preferably is one which binds to Domain II of HER2, inhibits HER dimerization more effectively than Trastuzumab, and/or binds to a heterodimeric binding site of HER2. The preferred embodiment herein of a formulated HER2 antibody is one comprising the variable light and variable heavy amino acid sequences in SEQ ID Nos. 3 and 4, and most preferably comprising the light chain and heavy chain amino acid sequences in SEQ ID Nos. 15 and 16 (Pertuzumab).
Examples of CD20 antibodies which can be formulated herein include: "C2B8"
which is now called "Rituximab" ("RITUXAN ") commercially available from Genentech (see also US
Patent No. 5,736,137);
the yttrium-[90] -labeled 2B8 murine antibody designated "Y2B8"
or "Ibritumomab Tiuxetan" ZEVALIN commercially available from Biogen-Idec (see also US Patent No.
5,736,137)') . marine IgG2a "B 1," also called "Tositumomab,"
optionally labeled with 1311 to generate the "1311-B I" antibody (iodine 1131 tositumomab, BEXXARTM) (US
Patent No. 5,595,721); marine monoclonal antibody "1F5" (Press et al. Blood 69(2):584-591 (1987) and variants thereof including "framework patched" or humanized 1F5 (WO03/002607, Leung, S.); ATCC deposit HB-96450); murine 2H7 and chimeric 2117 antibody (Clark et al.
PNAS 82: 1766-1770 (1985); US Patent No. 5,500,362.); humanized 2H7; huMax-CD20 (WO 04/035607, Genmab, Denmark); AME-133 (Applied Molecular Evolution); A20 antibody or variants thereof such as chimeric or humanized A20 antibody (cA20, hA20, respectively) (US
2003/0219433, Immunomedics); and monoclonal antibodies L27, G28-2, 93-1B3, B-Cl or NU-B2 available from the International Leukocyte Typing Workshop (Valentine et al., In:
Leukocyte Typing III (McMichael, Ed., p. 440, Oxford University Press (1987)).
In the preferred embodiment of a formulated CD20 antibody, the CD20 antibody is a humanized 2H7 antibody. Prefered humanized 2H7 antibodies herein are 2H7v16 and 2H7v511. The humanized 2H7v16 may be an intact antibody or antibody fragment comprising the variable light and variable heavy sequences in Figs.
18A-B (SEQ ID Nos. 26 and 29). Where the humanized 2H7vl6 antibody is a full length antibody, preferably it comprises the light and heavy chain amino acid sequences with SEQ ID Nos. 63 and 65.
Where the antibody binds VEGF, it preferably comprises the variable domain sequences as depicted in Fig. 19. The most preferred anti-VEGF antibody is full length humanized IgGlantibody, Bevacizurriab (AVASTINTM), commercially available from Genentech.
Where the formulated antibody binds IgE, it is preferably selected from the group consistirag of. E25, Omalizumab (XOLAIRO) commercially available from Genentech (see also Figs. 17A-B), E26 (Figs. 17A-B
herein), HAE1 (Figs. 17A-B herein), IgE antibody with an amino acid substitution at position 265 of an Fc region thereof (US 2004/0191244 Al), Hu-901 (Figs. 17A-B herein), an IgE
antibody as in W02004/07001 1, or an antibody (including antibody fragments and full length antibodies) comprising the variable domains of any of those IgE antibodies.
Where the antibody binds to a receptor in the tumor necrosis factor (TNF) superfamily or to a death receptor, it preferably binds to DR5, and preferably is an agonist antibody.
Publications in this area include Sheridan et al., Science, 277:818-821 (1997), Pan et al., Science, 277:815-818 (1997), W098/51793 published November 19, 1998; W098/41629 published September 24, 1998; Screaton et al., Curr. Biol., 7:693-696 (1997);
Walczak et al., EMBO J., 16:5386-5387 (1997); Wu et al., Nature Genetics, 17:141-143 (1997); WCD98/35986 published August 20, 1998; EP870,827 published October 14, 1998; W098/46643 published October 22, 1998;
W099/02653 published January 21, 1999; W099/09165 published February 25, 1999;
W099/11791 published March 11, 1999; US 2002/0072091 published August 13, 2002; US 2002/0098550 published Decennber 7, 2001;
US 6,313,269 issued December 6, 2001; US 2001/0010924 published August 2, 2001; US 2003/01255540 published July 3, 2003; US 2002/0160446 published October 31, 2002, US
2002/0048785 published April 25, 2002; US 6,342,369 issued February, 2002; US 6,569,642 issued May 27, 2003, US
6,072,047 issued June 6, 2000, US 6,642,358 issued November 4, 2003; US 6,743,625 issued June 1, 2004.
The most preferred DR5 antibody is Apomab.
Each of the formulations noted above comprises a buffer, preferably a histidine buffer, and most preferably a histidine-acetate buffer with a pH of 5.5 to 6.5, preferably 5.8 to 6.2, for example approximately 6Ø
The concentration of the buffer is dictated, at least in part, by the desired pH. Exemplary concentrations for the buffer are in the range from about 1mM to about 200mM, preferably from about 10mM to about 40rnM, most preferably about 20mM.
The antibody concentration in the formulation is preferably in the range from about 10mg/rnL to about 250mg/mL. The antibody concentration may be determined based on the intended use and mode of administration of the formulation. For example, where the formulation is for IV administration (e.g_ a HER2 antibody), the antibody concentration in the formulation is preferably from about 20mg/mL to about 40mg/mL.
In the exemplified Pertuzumab formulation intended for intravenous (IV) administration, the antibody concentration was from about 20mg/mL to about 40mg/mL, most preferably about 30mg/mL.
Where the antibody is for SQ or IM administration (e.g. for an anti-IgE
antibody) higher concentrations of the antibody may be desired. Such substantially high antibody concentrations may be from about 50mg/mL to about 250mg/mL, or from about 80mg/mL to about 250mg/mL, or from about 100mg/mL to about 200mg/mL.
Where the formulation comprises a DR5 antibody, such as Apomab, exemplary antibody concentrations are from about 10mg/mL to about 30mg/mL, for example about 20mg/mL DR5 antibody; such formulation being useful for intravenous administration.
The formulation for administration is preferably an aqueous formulation (not lyophilized) and has not been subjected to prior lyophilization. While the formulation may be lyophilized, preferably it is not. However, freezing of the aqueous formulation, without simultaneous drying that occurs during freeze-drying, is specifically contemplated herein, facilitating longer term storage thereof, for instance in a stainless steel tank.
The formulation preferably further comprises a saccharide, most preferably a disaccharide, such as trehalose or sucrose. The saccharide is generally included in an amount which reduces soluble aggregate formation, such as that which occurs upon freeze/thaw. Exemplary saccharide concentrations are in the range from about 10mM to about 1M, for example from about 60mM to about 250mM, and most preferably about 120mM for a HER2 antibody formulation, and about 240mM for a DR5 antibody formulation.
While it was found herein that a formulation comprising histidine-acetate buffer and saccharide was stable, the formulation optionally further comprises surfactant, such as polysorbate, most preferably polysorbate 20. The surfactant is generally included in an amount which reduces insoluble aggregate formation (such as that which occurs upon shaking or shipping). The surfactant concentration is preferably from about 0.0001% to about 1.0%, most preferably from about 0.01% to about 0.1%, for example about 0.02%.
Optionally, the formulation does not contain a tonicifying amount of a salt such as sodium chloride.
The formulation is generally sterile, and this can be achieved according to the procedures known to the skilled person for generating sterile pharmaceutical formulations suitable for administration to human subjects, including filtration through sterile filtration membranes, prior to, or following, preparation of the formulation.
Moreover, the formulation is desirably one which has been demonstrated to be stable upon storage.
Various stability assays are available to the skilled practitioner for confirming the stability of the formulation.
For example, the formulation may be one which is found to be stable upon storage: at about 40 C for at least 4 weeks; at about 5 C or about 15 C for at least 3 months or at least 1 year;
and/or about -20 C for at least 3 months. Stability can be tested by evaluating physical stability, chemical stability, and/or biological activity of the antibody in the formulation around the time of formulation as well as following storage at the noted temperatures. Physical and/or stability can be evaluated qualitatively and/or quantitatively in a variety of different ways, including evaluation of aggregate formation (for example using size exclusion chromatography, by measuring turbidity, and/or by visual inspection); by assessing charge heterogeneity using cation exchange chromatography or capillary zone electrophoresis; amino-terminal or carboxy-terminal sequence analysis; mass spectrometric analysis; SDS-PAGE analysis to compare reduced and intact antibody; peptide map (for example tryptic or LYS-C) analysis; evaluting biological activity or antigen binding function of the antibody; etc.
Instability may result in aggregation, deamidation (e.g. Asn deamidation), oxidation (e.g. Met oxidation), isomerization (e.g. Asp isomeriation), clipping/hydrolysis/fragmentation (e.g.
hinge region fragmentation), succinimide formation, unpaired cysteine(s), N-terminal extension, C-terminal processing, glycosylation differences, etc. Biological activity or antigen binding function can be evaluated using various techniques available to the skilled practitioner.
As noted above, freezing of the formulation is specifically contemplated herein. Hence, the formulation can be tested for stability upon freezing and thawing.
According, the invention also provides a method of making a pharmaceutical formulation comprising preparing the formulation as described herein, and evaluating physical stability, chemical stability, or biological activity of the monoclonal antibody in the formulation.
In the preferred embodiment, the formulation is provided inside a vial with a stopper pierceable by a syringe, preferably in aqueous form. The vial is desirably stored at about 2-8-C until it is administered to a subject in need thereof. The vial may for example be a 20cc vial (for example for a 420mg dose) or 50cc vial (for example for a 1050mg dose). For a DR5 antibody, such as Apomab, the formulation may be provided in a 5cc glass vial (e.g. 5.5m1 fill).
In another embodiment, the formulation is provided inside a stainless steel tank. The formulation in the stainless steel tank is optionally frozen and not freeze-dried.
One or more other pharmaceutically acceptable carriers, excipients or stabilizers such as those described in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed.
(1980) may be included in the formulation provided that they do not adversely affect the desired characteristics of the formulation. Acceptable carriers, excipients or stabilizers are nontoxic to recipients at the dosages and concentrations employed and include; additional buffering agents; co-solvents; antioxidants including ascorbic acid and methionine; chelating agents such as EDTA; metal complexes (e.g. Zn-protein complexes);
biodegradable polymers such as polyesters;
preservatives; and/or salt-forming counterions such as sodium.
IV. Treatment with the Antibody Formulation In one embodiment, the invention provides a method of treating a disease or disorder in a subject comprising administering the formulation described herein to a subject in an amount effective to treat the disease or disorder.
Where the antibody in the formulation binds to HER2, it is preferably used to treat cancer. The cancer will generally comprise HER2-expressing cells, such that the HER2 antibody herein is able to bind to the cancer cells. Thus, the invention in this embodiment concerns a method for treating I3ER2-expressing cancer in a subject, comprising administering the HER2 antibody pharmaceutical formulation to the subject in an amount effective to treat the cancer. Various cancers that can be treated with the composition are listed in the definitions section above.
It is also contemplated that the HER2 antibody formulation may be used to treat various non-malignant diseases or disorders, such a include autoimmune disease (e.g. psoriasis);
endometriosis; scleroderma; restenosis;
polyps such as colon polyps, nasal polyps or gastrointestinal polyps;
fibroadenoma; respiratory disease (see definition above); cholecystitis; neurofibromatosis; polycystic kidney disease; inflammatory diseases; skin disorders including psoriasis and dermatitis; vascular disease (see definition above); conditions involving abnormal proliferation of vascular epithelial cells; gastrointestinal ulcers;
Menetrier's disease, secreting adenomas or protein loss syndrome; renal disorders; angiogenic disorders;
ocular disease such as age related macular degeneration, presumed ocular histoplasmosis syndrome, retinal neovascularization from proliferative diabetic retinopathy, retinal vascularization, diabetic retinopathy, or age related macular degeneration; bone associated pathologies such as osteoarthritis, rickets and osteoporosis;
damage following a cerebral ischemic event; fibrotic or edemia diseases such as hepatic cirrhosis, lung fibrosis, carcoidosis, throiditis, hyperviscosity syndrome systemic, Osler Weber-Rendu disease, chronic occlusive pulmonary disease, or edema following burns, trauma, radiation, stroke, hypoxia or ischemia; hypersensitivity reaction of the skin; diabetic retinopathy and diabetic nephropathy; Guillain-Barre syndrome; graft versus host disease or transplant rejectiori; Paget's disease; bone or joint inflammation; photoaging (e.g. caused by UV radiation of human skin); benign prostatic hypertrophy; certain microbial infections including microbial pathogens selected from adenovirus, 1hantaviruses, Borrelia burgdorferi, Yersinia spp. and Bordetella pertussis; thrombus caused by platelet aggregation;
reproductive conditions such as endometriosis, ovarian hyperstimulation syndrome, preeclampsia, dysfunctional uterine bleeding, or menometrorrhagia; synovitis; atheroma; acute and chronic nephropathies (including proliferative glomerulonephritis and diabetes-induced renal disease); eczema;
hypertrophic scar formation;
endotoxic shock and fungal infection; familial adenomatosis polyposis;
neurodedenerative diseases (e.g.
Alzheimer's disease, AIDS-related dementia, Parkinson's disease, amyotrophic lateral sclerosis, retinitis pigmentosa, spinal muscular atrophy and cerebellar degeneration);
myelodysplastic syndromes; aplastic anemia;
ischemic injury; fibrosis of the lung, kidney or liver; T-cell mediated hypersensitivity disease; infantile hypertrophic pyloric stenosis; urinary obstructive syndrome; psoriatic arthritis; and Hasimoto's thyroiditis.
Preferred non-malignant indications for therapy herein include psoriasis, endometriosis, sclerodernza, vascular disease (e.g. restenosis, artherosclerosis, coronary artery disease, or hypertension), colon polyps, fibroadenoma or respiratory disease (e.g. asthma, chronic bronchitis, bronchieactasis or cystic fibrosis).
Where the antibody in the formulation binds to a B-cell surface marker such as CD20 or B R3, the formulation may be used to treat a B-cell malignancy, such as NHL or CLL, an autoimmune disease, graft rejection, or to block an immune response to a foreign antigen, such as an antibody, a toxin, a gene -therapy viral vector, a graft, an infectious agent, or an alloantigen (see WO 01/03734, Grillo-Lopez et al.).
Where the antibody in the formulation is an IgE antibody, it may be used to treat an IgE-mediated disorder (USSN 2004/0197324 Al, Liu and Shire), such as allergic asthma, allergic rhinitis, atopic dermatitis, allergic gastroenteropathy, hypersensitivity, eczema, urticaria, allergic bronchopulmonary aspergillosis, parasitic disease, hyper-IgE syndrome, ataxia-telangiectasia, Wiskott-Aldrich syndrome, thymic alymphoplasia, IgE
myeloma, and graft-versus-host reaction.
Antibodies that bind to a receptor in the TNF superfamily (for instance which bind to DRS), or which bind to VEGF (or a receptor thereof), may be used to treat cancer, various forms of which are described in the definitions section above. Preferably, the cancer treated with a DR5 antibody formulation is a solid tumor or NHL.
Where the indication is cancer, the patient may be treated with a combination of the antibody formulation, and a chemotherapeutic agent. The combined administration includes coadministration or concurrent administration, using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order, wherein preferably there is a time period while both (or all) active agents simultaneously exert their biological activities. Thus, the chemotherapeutic agent may be administered prior to, or following, administration of the composition. In this embodiment, the timing between at least one administration of the chemotherapeutic agent and at least one administration of the composition is preferably approximately 1 month or less, and most preferably approximately 2 weeks or less. Alternatively, the chemotherapeutic agent and the composition are administered concurrently to the patient, in a single formulation or separate formulations.
Treatment -with the formulation will result in an improvement in the signs or symptoms of cancer or disease. For instance, where the disease being treated is cancer, such therapy may result in an improvement ir.
survival (overall survival and/or progression free survival) and/or may result in an objective clinical response (partial or complete). Moreover, treatment with the combination of the chemotherapeutic agent and the antibody formulation may result in a synergistic, or greater than additive, therapeutic benefit to the patient.
Preferably, the antibody in the formulation administered is a naked antibody.
However, the antibody administered may be conjugated with a cytotoxic agent. Preferably, the immunoconjugate and/or antigen to which it is bound is/are internalized by the cell, resulting in increased therapeutic efficacy of the immunoconjugate in killing the cancer cell to which it binds. In a preferred embodiment, the cytotoxic agent targets or interferes -with nucleic acid in the cancer cell. Examples of such cytotoxic agents include maytansinoids, calicheamicins, ribonucleases and DNA endonucleases.
The formulation is administered to a human patient in accord with known methods, such as intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes.
Intravenous, intramuscular or subcutaneous administration of antibody composition is preferred, with intravenous administration being most preferred.
For subcutaneous delivery, the formulation may be administered via syringe;
injection device (e.g. the INJECT-EASETM and GENJECTTM device); injector pen (such as the GENPENTM);
needleless device (e.g.
MEDIJECTORTM and BIOJECTORTM); or subcutaneous patch delivery system.
For the prevention or treatment of disease, the appropriate dosage of the antibody will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician. The antibody is suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of the disease, about 1 tg/kg to 50 mg/kg (e.g. 0.1-20mg/kg) of HER2 or DR5 antibody is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. The dosage of the antibody will generally be in the range from about 0.05mg/kg to about 10mg/kg. If a chemotherapeutic agent is administered, it is usually administered at dosages known therefor, or optionally lowered due to combined action of the drugs or negative side effects attributable to administration of the chemotherapeutic agent. Preparation and dosing schedules for such chemotherapeutic agents may be used according to manufacturers' instructions or as determined empirically by the skilled practitioner. Preparation and dosing schedules for such chemotherapy are also described in Chemotherapy Service Ed., M.C. Perry, Williams & Wilkins, Baltimore, MD (1992).
Other therapeutic regimens may be combined with the antibody including, but not limited to: a second (third, fourth, etc) chemotherapeutic agent(s) (i.e. "cocktails" of different chemotherapeutic agents); another monoclonal antibody;a growth inhibitory agent; a cytotoxic agent; a chemotherapeutic agent; EGFR-targeted drug; tyrosine kinase inhibitor; anti-angiogenic agent; and/or cytokine; etc.
In addition to the above therapeutic regin-ies, the patient may be subjected to surgical removal of cancer cells and/or radiation therapy.
V. Articles of Manufacture In another embodiment of the invention, an article of manufacture is provided which contains the pharmaceutical formulation of the present invention and provides instructions for its use. The article of manufacture comprises a container. Suitable containers include, for example, bottles, vials (e.g. dual chamber vials), syringes (such as dual chamber syringes) and test tubes. The container may be formed from a variety of materials such as glass or plastic. The container holds the formulation and the label on, or associated with, the container may indicate directions for use. The container holding the formulation may be a multi-use vial, which allows for repeat administrations (e.g. from 2-6 ad ministrations) of the reconstituted formulation. The article of manufacture may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for usc, as noted in the previous section.
The invention will be more fully understood by reference to the following examples. They should not, however, be construed as limiting the scope of the invention.
EXAMPLES
Stable Pertuzumab Liquid Formulations These examples describe the development and stability testing of stable liquid formulations comprising Pertuzumab at protein concentrations in the range from about 10 mg/mL - 180 mg/mL. The selected formulations had low turbidity, and were physically and chemically stable. A
chloride ion was removed from the formulation to reduce the risk of corrosion. The formulation was isotonic, and suitable for subcutaneous or intramuscular delivery. Insoluble aggregate formation upon agitation stress was prevented using histidine-acetate and sucrose formulation, without the need to include polysorbate 20.
Analytical Methods Color, Appearance and Clarity (CAC) The color, appearance, and clarity of the samples were determined by visual inspection of vials against a white and black background under white fluorescence light at room temperature.
UV Concentration Measurements The liquid product aliquot was first diluted with formulation buffer so that the A,, near 278 nm is within 0.5-1.0 absorbance unit. The UV absorbance of the diluted samples was measured in a quartz cuvette with 1 cm path length on an HP 8453 spectrophotometer. Absorbance was measured at 278 urn and 320 nm. The absorbance from 320 nm is used to correct background light scattering due to larger aggregates, bubbles and particles. The measurements were blanked against the formulation buffer. The protein concentration was determined using the absorptivity of 1.50 (mg/mL)-'cm'.
pH measurements The pH was measured at room temperature using a RADIOMETER COPENHAGEN PHM82TM
pB
meter. The probe used was a combined glass/reference electrode with radiometer connector (Sigma, Cat# E-5759). Standard solutions of pH 4.01 and pH 7.00 (EM Science) were used for calibration of the pH meter.
Ion-Exchange Chromatography (IEX) Cation exchange chromatography was employed to measure changes in charge variants. This assay utilizes a DIONEX PROPAC WCX-10TM column on an HP 1100TM HPLC system. Samples were diluted to 1 mg/mL with the mobile phase A containing 20 mM NMS at pH 6_0. 50 mL of diluted samples were then loaded on the column that was kept at ambient temperature. The peaks were eluted with a shallow NaCl gradient using mobile B containing 20 mM MES, 250 mM NaCl, pH 6Ø The eluent was monitored at 280 nm. The data were analyzed using HP CHEMSTATIONTM software (Rev A08.03).
Capillary Zone Electrophophoresis (CZE) The purity of Fab and F(ab')2 fragments was determined by CZE. This assay was run on a BIORAD
BIOFOCUSTM 3000TM capillary electrophoresis system with a BIOCAP XLTM
capillary, 50 gm I.D., 44.6 cm total length and 40 cm to the detector.
Size Exclusion Chromatography (SEC) Size exclusion chromatography was used to quantitate aggregates and fragments.
This assay utilizes a TSK G3000 SWXLTM, 7.8 x 300 mm column and runs on an HP 1100TH HPLC system.
Samples were diluted to mg/mL with the mobile phase and injection volume was 20 L.. The mobile phase was 100 mM K2HPO4. at pH 6.8 and the protein was eluted with an isocratic gradient at 0.5 mL/min for 45 minutes. The eluent absorbance was monitored at 280 nm. Integration was done using HP
CHEMSTATIONTM software (Rev A08.03).
Biological Activity The biological activity of Pertuzumab was determined by measuring its ability to inhibit proliferation of the human breast cancer cell line MDA-MB-175-VII.
Pertuzumab Fab and F(ab')2 antibody fragments were formulated at protein concentration of 1.0 nag/ml, in the following buffer conditions:
10 mM citrate, 140 mM NaCl, pH 4.0;
10 mM succinate, 140 mM NaCl, pH 5.0;
10 mM succinate, 140 mM NaCl,, pH 6.0;
10 mM histidine, 140 mM NaCl, pH 7.0; and mM glycylglycine, 140 mM NaCl, pH 8Ø
Each formulation was filtered then aliquoted into 3 cc WHEATONTM USP Type I
glass vials sealed with TEFLONTM coated gray butyl stoppers. Samples were stored at 40 2 C.
The stability analyses of drug product showed that the Fab and F(ab')2 were most stable between pH 5.0 and 6Ø
Table 2. Effect of pH on degradation of Fab or F(ab')2 stored at 40 C
Formulation pH Fab F(ab')2 CZE SEC CZE SEC
% Main Peak % Main Peak % Main Peak % Main Peak 4.0 74.1 96.7 43.6 89.4 5.0 83.2 96.4 65.4 94.0 6.0 82.9 96.2 69.0 92.3 7.0 83.9 96.4 62.3 91.3 8.0 72.7 96.4 49.2 89.8 Pertuzumab was formulated into 20 mM histidine-acetate buffer with 120 mM
sucrose and 0.02 %
polysorbate 20. The pHs of formulations were adjusted with acetic acid to final pH between 5.0 and 7Ø The protein concentration was 30 mg/mL. Each formulation was filled into 3 cc USP
Type I glass vials and stored at 40 C for stability analysis. The results showed that Pertuzumab was most stable around pH 6Ø
Table 3. Effect of pH on degradation of Pertuzumab stored at 40 C
Formulation pH Temperature Storage Time SEC IEX
( C) (wks) % Monomer % Main Peak 5.0 40 2 99.4 57.4 5.5 40 2 99.4 59.2 6.0 40 2 99.4 60.6 6.5 40 2 99.3 60.5 7.0 40 2 99.1 54.0 5.0 40 4 97.3 48.1 5.5 40 4 99.1 50.5 6.0 40 4 99.1 53.3 6.5 40 4 99.0 52.3 7.0 40 4 98.6 42.3 Pertuzumab formulations at protein concentration of 100 mg/mL were prepared in the following excipients:
(1) 10 mM histidine-HCI, 240 mM sucrose, 0.02% polysorbate 20, pH 6.0;
(2) 10 mM histidine-acetate, 240 mM sucrose, 0.02% polysorbate 20, pH 6.0;
(3) 10 mM histidine-phosphate, 240mM sucrose, 0.02% polysorbate 20, pH 6.0;
(4) 10 mM histidine-sulfate, 240 mM sucrose, 0.02% polysorbate 20 at pH 6Ø
Each formulation was filled into 3 cc FORMA VITRUMTM USP Type I glass vial sealed with FLUROTECTM faced butyl rubber stoppers. Samples were stored at 30 C and 40 C
and stability was evaluated for quality (CAC) and purity (SEC, IEC). The stability results showed that Pertuzumab in histidine-phosphate buffer degraded much faster than in other histidine buffers upon storage at 40 C (Fig. 8 and Fig. 9).
Pertuzumab was concentrated by ultrafiltration/diafiltration to various concentrations in the following buffers:
(1) 20 mM histidine-acetate, pH 6.0;
(2) 10 mM histidine-HCI, pH 6.0, and (3) 10 mM histidine-sulfate, pH 6Ø
The turbidity of each formulation was measured before the filtration. The results, as shown in Fig. 10, demonstrated that Pertuzumab samples formulated in histidine-acetate and histidine-HC1 had less amounts of insoluble aggregates than those in histidine-sulfate buffer.
Pertuzumab was formulated at 30 mg/mL in 20 mM histidine-acetate, 120 mM
sucrose, 0.02 %
polysorbate 20, pH 6Ø Pertuzmab was filled in 316L and HASTELLOYTM stainless steel miniature tanks. All samples were stored at -20 C and 5 C and evaluated for quality (CAC), purity (SEC, IEC) and strength (UV-Vis). The stability analyses showed that Pertuzumab was stable in this formulation upon storage at -20 C and C for at least 3 months. The chloride free formulation is compatible with 316L
and HASTELLOYTM stainless steel tank.
Table 4. Stability of Pertuzumab in Stainless Steel Tanks Tanks Temp Time CAC UV Spec. SEC IEC
( C) (Months) (mg/mL) (% monomer) (% main peak) 0 Passa 29.0 99.8 67.9 - 20 3 Pass 28.9 99.7 66.8 5 3 Pass 28.7 99.7 66.8 HASTELLOYTM
- 20 3 Pass 29.1 99.7 66.8 3 Pass 28.8 99.7 67.7 a' Pass for Color, Appearance and Clarity: Clear to slightly opalescent, colorless to pale yellow solution.
Pertuzumab was formulated using tangential flow filtration (TFF). The final formulation contains 20 mM histidine-acetate, 120 mM sucrose, 0.02 % polysorbate 20, pH 6.0 at protein concentratiori of 30 mg/mL.
Samples were filled into a 20 Ml FORMA VITRUMTM USP Type I glass vial, capped with the 20 mm FLUROTECTM faced butyl rubber stoppers, and sealed with aluminium flip-top caps. All samples were stored at -70 C, 5 C, 15 C, and stability was evaluated for quality (CAC), purity (SEC, IEC), strength (UV-Vis), and potency (Bioassay). The results showed that Pertuzumab is stable in this formulation upon storage at 5 C and C for at least 3 months.
Table 5. Stability of Pertuzumab in glass vials CAC
Temp Time UV Spec. IEC Bi assay (oC) (Months) (mg/mL) SEC (% main (% specific (% monomer) peak) activity) Pass 0 29.2 99.8 64.1 83 -70 1 Pass 29.7 99.8 65.2 92 3 Pass 30.7 99.8 67.0 93 5 3 Pass 30.4 99.7 67.2 90 15 1 Pass 29.7 99.7 64.4 78 3 Pass 30.4 99.7 65.5 93 Pertuzumab was formulated at 100 mg/mL in the following buffer conditions:
(1) 10 mM histidine-HC1, pH 6.0;
(2) 10 mM histidine-HC1, 240 mM sucrose, pH 6.0;
(3) 20 mM succinate at pH 6.0; and (4) 20 mM succinate, 240 mM sucrose at pH 6Ø
Each formulation was added with different concentration of polysorbate 20. All samples were filled into 3 cc USP Type I glass vials and were agitated horizontally at 70 rpm at room temperature for up to 7 days. The stability of each sample was evaluated at 7 day time point for turbidity. The results demonstrated that the use of-polysorbate 20 in the final formulation effectively prevented formation of insoluble aggregates. See Fig. 11.
Pertuzumab was prepared in the following formulations:
( 1) 25 mg/mL Pertuzumab, 10 mM histidine-HCI, 240 mM sucrose, pH 6.0;
(2) 50 mg/mL Pertuzumab, 10 mM histidine-HCI, 240 mM sucrose, pH 6.0;
(3) 60 mg/mL Pertuzumab, 20 mM histidine-acetate, 120 mM sucrose, pH 6Ø
Various amounts of polysorbate 20 were added to each formulation. All samples were filled into 3 cc USP Type I glass vials, and agitated horizontally at 70 rpm at room temperature for up to 7 days. The physical stability of each sample was evaluated at 7 day time point for turbidity. The results demonstrated that the use of-polysorbate 20 in histidine-HCI and sucrose formulation effectively prevented formation of insoluble particulates.
The formulation containing histidine-acetate and sucrose appeared to have the same protective effect on protein as polysorbate 20. See Fig. 12.
Pertuzumab was formulated as follows:
(1) 100 mg/mL protein, 10 mM histidine-HCI, pH 6.0;
(2) 100 mg/mL protein, 20 mM succinate, pH 6.0;
(3) 60 mg/mL protein, 20 mM histidine-acetate, pH 6Ø
Each formulation was mixed with different amounts of sucrose. All samples were sterilely filled into 3 cc USP Type I glass vials. They were then frozen at -70 C and thawed at 5 C
three times. The physical stability of each sample was determined after the three cycles of freezing and thawing.
The results demonstrated that sucrose prevents soluble aggregate formation during the freeze-thawing process. See Fig. 13.
(3) 10 mM histidine-phosphate, 240mM sucrose, 0.02% polysorbate 20, pH 6.0;
(4) 10 mM histidine-sulfate, 240 mM sucrose, 0.02% polysorbate 20 at pH 6Ø
Each formulation was filled into 3 cc FORMA VITRUMTM USP Type I glass vial sealed with FLUROTECTM faced butyl rubber stoppers. Samples were stored at 30 C and 40 C
and stability was evaluated for quality (CAC) and purity (SEC, IEC). The stability results showed that Pertuzumab in histidine-phosphate buffer degraded much faster than in other histidine buffers upon storage at 40 C (Fig. 8 and Fig. 9).
Pertuzumab was concentrated by ultrafiltration/diafiltration to various concentrations in the following buffers:
(1) 20 mM histidine-acetate, pH 6.0;
(2) 10 mM histidine-HCI, pH 6.0, and (3) 10 mM histidine-sulfate, pH 6Ø
The turbidity of each formulation was measured before the filtration. The results, as shown in Fig. 10, demonstrated that Pertuzumab samples formulated in histidine-acetate and histidine-HC1 had less amounts of insoluble aggregates than those in histidine-sulfate buffer.
Pertuzumab was formulated at 30 mg/mL in 20 mM histidine-acetate, 120 mM
sucrose, 0.02 %
polysorbate 20, pH 6Ø Pertuzmab was filled in 316L and HASTELLOYTM stainless steel miniature tanks. All samples were stored at -20 C and 5 C and evaluated for quality (CAC), purity (SEC, IEC) and strength (UV-Vis). The stability analyses showed that Pertuzumab was stable in this formulation upon storage at -20 C and C for at least 3 months. The chloride free formulation is compatible with 316L
and HASTELLOYTM stainless steel tank.
Table 4. Stability of Pertuzumab in Stainless Steel Tanks Tanks Temp Time CAC UV Spec. SEC IEC
( C) (Months) (mg/mL) (% monomer) (% main peak) 0 Passa 29.0 99.8 67.9 - 20 3 Pass 28.9 99.7 66.8 5 3 Pass 28.7 99.7 66.8 HASTELLOYTM
- 20 3 Pass 29.1 99.7 66.8 3 Pass 28.8 99.7 67.7 a' Pass for Color, Appearance and Clarity: Clear to slightly opalescent, colorless to pale yellow solution.
Pertuzumab was formulated using tangential flow filtration (TFF). The final formulation contains 20 mM histidine-acetate, 120 mM sucrose, 0.02 % polysorbate 20, pH 6.0 at protein concentratiori of 30 mg/mL.
Samples were filled into a 20 Ml FORMA VITRUMTM USP Type I glass vial, capped with the 20 mm FLUROTECTM faced butyl rubber stoppers, and sealed with aluminium flip-top caps. All samples were stored at -70 C, 5 C, 15 C, and stability was evaluated for quality (CAC), purity (SEC, IEC), strength (UV-Vis), and potency (Bioassay). The results showed that Pertuzumab is stable in this formulation upon storage at 5 C and C for at least 3 months.
Table 5. Stability of Pertuzumab in glass vials CAC
Temp Time UV Spec. IEC Bi assay (oC) (Months) (mg/mL) SEC (% main (% specific (% monomer) peak) activity) Pass 0 29.2 99.8 64.1 83 -70 1 Pass 29.7 99.8 65.2 92 3 Pass 30.7 99.8 67.0 93 5 3 Pass 30.4 99.7 67.2 90 15 1 Pass 29.7 99.7 64.4 78 3 Pass 30.4 99.7 65.5 93 Pertuzumab was formulated at 100 mg/mL in the following buffer conditions:
(1) 10 mM histidine-HC1, pH 6.0;
(2) 10 mM histidine-HC1, 240 mM sucrose, pH 6.0;
(3) 20 mM succinate at pH 6.0; and (4) 20 mM succinate, 240 mM sucrose at pH 6Ø
Each formulation was added with different concentration of polysorbate 20. All samples were filled into 3 cc USP Type I glass vials and were agitated horizontally at 70 rpm at room temperature for up to 7 days. The stability of each sample was evaluated at 7 day time point for turbidity. The results demonstrated that the use of-polysorbate 20 in the final formulation effectively prevented formation of insoluble aggregates. See Fig. 11.
Pertuzumab was prepared in the following formulations:
( 1) 25 mg/mL Pertuzumab, 10 mM histidine-HCI, 240 mM sucrose, pH 6.0;
(2) 50 mg/mL Pertuzumab, 10 mM histidine-HCI, 240 mM sucrose, pH 6.0;
(3) 60 mg/mL Pertuzumab, 20 mM histidine-acetate, 120 mM sucrose, pH 6Ø
Various amounts of polysorbate 20 were added to each formulation. All samples were filled into 3 cc USP Type I glass vials, and agitated horizontally at 70 rpm at room temperature for up to 7 days. The physical stability of each sample was evaluated at 7 day time point for turbidity. The results demonstrated that the use of-polysorbate 20 in histidine-HCI and sucrose formulation effectively prevented formation of insoluble particulates.
The formulation containing histidine-acetate and sucrose appeared to have the same protective effect on protein as polysorbate 20. See Fig. 12.
Pertuzumab was formulated as follows:
(1) 100 mg/mL protein, 10 mM histidine-HCI, pH 6.0;
(2) 100 mg/mL protein, 20 mM succinate, pH 6.0;
(3) 60 mg/mL protein, 20 mM histidine-acetate, pH 6Ø
Each formulation was mixed with different amounts of sucrose. All samples were sterilely filled into 3 cc USP Type I glass vials. They were then frozen at -70 C and thawed at 5 C
three times. The physical stability of each sample was determined after the three cycles of freezing and thawing.
The results demonstrated that sucrose prevents soluble aggregate formation during the freeze-thawing process. See Fig. 13.
The preferred Pertuzumab formulation for therapeutic use consists essentially of 30mg/mL Pertuzumab in 20mM histidine acetate, 120mM sucrose, 0.02% polysorbate 20, at pH 6Ø
Compound Concentration Amount/L
Pertuzumab 30 mg/mL 30 g L-Histidine MW=155.16g/mol 20 mM 3.10 g Glacial Acetic Acid MW=60.05g/mol 11.6 mM 0.66 mL
Density=1.05g/cm3 Sucrose MW=342.3g/mol 120 mM 41.1 g Polysorbate 20 0.02% (w/v) 0.2 mL
Density=1.012g/cm3 MW: Molecular weight 420mg dose vial configuration:
Vial: 20 cc Formal Vitrum Type I glass Stopper: 20mm DAIKYO GREYTM, fluoro-resin laminated Cap: 20mm flip top aluminum Fill volume: 14.50 mL
Delivery: 14.0 mL Pertuzumab in normal saline IV bag.
1050mg dose vial configuration:
Vial: 50 cc Formal Vitrum Type I glass Stopper: 20mm DAIKYO GREYTM, fluoro-resin laminated Cap: 20mm flip top aluminum Fill volume: 36.0 mL
Delivery: 35.0 mL Pertuzumab in normal saline IV bag.
Compound Concentration Amount/L
Pertuzumab 30 mg/mL 30 g L-Histidine MW=155.16g/mol 20 mM 3.10 g Glacial Acetic Acid MW=60.05g/mol 11.6 mM 0.66 mL
Density=1.05g/cm3 Sucrose MW=342.3g/mol 120 mM 41.1 g Polysorbate 20 0.02% (w/v) 0.2 mL
Density=1.012g/cm3 MW: Molecular weight 420mg dose vial configuration:
Vial: 20 cc Formal Vitrum Type I glass Stopper: 20mm DAIKYO GREYTM, fluoro-resin laminated Cap: 20mm flip top aluminum Fill volume: 14.50 mL
Delivery: 14.0 mL Pertuzumab in normal saline IV bag.
1050mg dose vial configuration:
Vial: 50 cc Formal Vitrum Type I glass Stopper: 20mm DAIKYO GREYTM, fluoro-resin laminated Cap: 20mm flip top aluminum Fill volume: 36.0 mL
Delivery: 35.0 mL Pertuzumab in normal saline IV bag.
This example concerns another Pertuzumab formulation which has been used in Phase I and Phase II
clinical trials. The composition consists of 25 mg/ml Pertuzumab, 10 mM
Histidine-HCI buffer, 240 mM
sucrose, 0.02% Polysorbate 20, pH 6Ø
Ingredient Concentration Pertuzumab 25 mg/ml L-His HCI.H2O (MW 209.6) 1.12 mg/ml (0.0125 M) L-His(MW 155.2) 0.72 mgml (0.0099 M) Sucrose (MW342.3) 82.15 mg/ml (0.240 M) Polysorbate 20 0.2 mg/ml (0.02 %) Cellular apoptosis is mediated by intrinsic and extrinsic pathways.
Chemotherapy can cause cell damage and may trigger apoptosis by the intrinsic pathway in response to cellular damage. However, cancer cells often develop resistance to chemotherapy through mutations in the p53 tumor suppressor gene (Ashkenazi A. Targeting Death and Decoy Receptors of the Tumour-Necrosis Factor Superfamily. Nature Reviews 2:420-430 (2002)). Death receptors, such as DR4 and DRS, located on the surface of cells trigger apoptosis via the extrinsic pathway that does not involve p53. Agonistic molecules, such as Apo2L, bind to DR4 and DR5 receptors and activate caspases 8 and 10 through Fas-associated death domain.
Caspase 8 and 10 then activate caspases 3, 6, and 7 to induce apoptosis. Molecular signaling of death receptors on tumor cells has therapeutic potential for the elimination of cancer cells that are resistant to conventional therapies and molecules, like Apo2L, are currently undergoing clinical evaluation.
"Apomab" is a full-length CHO derived humanized IgG1 constructed with a lannda light chain. It is an agonist antibody against DR5 that has been shown to induce apoptosis of various cancer cell lines. Preclinical studies using a murine tumor implant model have shown that Apomab has similar or improved tumor reduction compared to Apo2L. Apomab is being evaluated as an anti-cancer agent in the indications of advanced solid tumors and Non-Hodgkin's Lymphoma (NHL). The heavy and light chain amino acid sequences of Apomab used in these experiments are shown in Figs. 27 and 28.
Preparation of Antibody Formulations Recombinantly produced Apomab had very dilute protein concentration and high pH. The material was concentrated to approximately 20 mg/mL and exchanged into 20 mM sodium acetate, pH 5.0 buffer using a Millipore Labscale tangential flow filtration (TFF) system with MILLIPORE
PELLICONTTM XL, PLCGCIO, 50 cm membrane. Apomab samples were formulated into various buffer systems covering p11 range from 4.0 to 7.0 using sodium acetate, histidine acetate, and sodium phosphate without trehalose and TWBEN 20 using dialysis with a 10,000 Da molecular weight cut off membrane (Pierce, Inc). Trehalose at 240 mM was added in the last dialysis. After dialysis, 0.02% TWEEN 20TM was added to the formulation and the samples were filtered with 0.22 m filters (Millipore, Inc.). A 0.5 mL volume of Apomab was filled into sterile 3 cc glass vials (Forma Vitrum, Inc.) and sealed with 13 mm stoppers (Daikyo, Inc). Protein stability was evaluated at -70 C, 5 C, 30 C, and 40 C with storage for up to 3 months.
clinical trials. The composition consists of 25 mg/ml Pertuzumab, 10 mM
Histidine-HCI buffer, 240 mM
sucrose, 0.02% Polysorbate 20, pH 6Ø
Ingredient Concentration Pertuzumab 25 mg/ml L-His HCI.H2O (MW 209.6) 1.12 mg/ml (0.0125 M) L-His(MW 155.2) 0.72 mgml (0.0099 M) Sucrose (MW342.3) 82.15 mg/ml (0.240 M) Polysorbate 20 0.2 mg/ml (0.02 %) Cellular apoptosis is mediated by intrinsic and extrinsic pathways.
Chemotherapy can cause cell damage and may trigger apoptosis by the intrinsic pathway in response to cellular damage. However, cancer cells often develop resistance to chemotherapy through mutations in the p53 tumor suppressor gene (Ashkenazi A. Targeting Death and Decoy Receptors of the Tumour-Necrosis Factor Superfamily. Nature Reviews 2:420-430 (2002)). Death receptors, such as DR4 and DRS, located on the surface of cells trigger apoptosis via the extrinsic pathway that does not involve p53. Agonistic molecules, such as Apo2L, bind to DR4 and DR5 receptors and activate caspases 8 and 10 through Fas-associated death domain.
Caspase 8 and 10 then activate caspases 3, 6, and 7 to induce apoptosis. Molecular signaling of death receptors on tumor cells has therapeutic potential for the elimination of cancer cells that are resistant to conventional therapies and molecules, like Apo2L, are currently undergoing clinical evaluation.
"Apomab" is a full-length CHO derived humanized IgG1 constructed with a lannda light chain. It is an agonist antibody against DR5 that has been shown to induce apoptosis of various cancer cell lines. Preclinical studies using a murine tumor implant model have shown that Apomab has similar or improved tumor reduction compared to Apo2L. Apomab is being evaluated as an anti-cancer agent in the indications of advanced solid tumors and Non-Hodgkin's Lymphoma (NHL). The heavy and light chain amino acid sequences of Apomab used in these experiments are shown in Figs. 27 and 28.
Preparation of Antibody Formulations Recombinantly produced Apomab had very dilute protein concentration and high pH. The material was concentrated to approximately 20 mg/mL and exchanged into 20 mM sodium acetate, pH 5.0 buffer using a Millipore Labscale tangential flow filtration (TFF) system with MILLIPORE
PELLICONTTM XL, PLCGCIO, 50 cm membrane. Apomab samples were formulated into various buffer systems covering p11 range from 4.0 to 7.0 using sodium acetate, histidine acetate, and sodium phosphate without trehalose and TWBEN 20 using dialysis with a 10,000 Da molecular weight cut off membrane (Pierce, Inc). Trehalose at 240 mM was added in the last dialysis. After dialysis, 0.02% TWEEN 20TM was added to the formulation and the samples were filtered with 0.22 m filters (Millipore, Inc.). A 0.5 mL volume of Apomab was filled into sterile 3 cc glass vials (Forma Vitrum, Inc.) and sealed with 13 mm stoppers (Daikyo, Inc). Protein stability was evaluated at -70 C, 5 C, 30 C, and 40 C with storage for up to 3 months.
Stability of Apomab Formulation For drug product stability testing, Apomab formulated bulk filled into 5 cc FORMA VITRUM glass vials were formulated. Vials were filled with 5.5 mL of formulated antibody, fitted with 20 min DAIKYO
stoppers, and stored at -70 C, 5 C, 30 C, and 40 C in the upright position.
For drug substance stability testing, Apomab formulated bulk was sterile filtered through a 0.22 m filter and 10 mL was filled into autoclaved 20cc 316L stainless steel mini-tanks. The tanks were placed upright at -20 C and 5 C. A 1 mL aliquot was aseptically removed from the mini-tanks at specified time intervals to assess protein quality. The control vials were 1 mL aliquots in 3 cc glass vials stored at -20 C.
Color, Appearance, and Clarity The clarity, appearance, and color of the samples were visually assessed under white fluorescent light using a light inspection station with black and white background. For analysis of the drug substance, mini-tank samples were transferred to a 3 cc glass vial for inspection.
pH
pH was measured at room temperature with THERMO ORION SURE-FLOW ROSSTM semi-micro pH
electrode for measuring buffers or THERMO ORION GLSTM combination micro pH
electrode for measuring protein pH screening samples, a Beckman microelectrode probe for Toxicology stability samples. The METERLABTM pHM240 pH/Ion meter (Radiometer Analytical) was calibrated every day with buffer standards (EM Science) at pH 7 and pH 4.
Concentration Protein concentration was determined by ultraviolet absorption spectroscopy using an AGILENT
8453TM spectrophotometer. The samples were diluted with appropriate formulation buffer blanks to give an absorbance from 0.5 to 1Ø The instrument was blanked with the diluent solution and the spectrum was scanned from 240 to 500 nm. The absorbance value at 320 nm was subtracted from the absorbance at 279 nm to correct for offset and light scattering. The protein concentrations were calculated by the following equation:
Conc. (mg/mL) _ (A279 _ A320) X dilution factor absorptivity coefficient in cm 1(mg/mL)-1 The absorptivity coefficient based on sequence was initially determined to be 1.32 cm 1(mg/mL)-1 and this value was used for the pH screening studies. A later value of 1.7 cm 1(mg/mL)-1 was determined by amino acid analysis and proteolysis methods and this value was used for the stability analysis of Aporn.ab used in Toxicology studies.
Ion-Exchange Chromatography Ion exchange chromatography was carried out on an 1100 series HPLC (Agilent Technologies, Inc.) equipped with a diode array detector. Chromatography was carried out on a PROPAC WCX-IOTM (Dionex) column (4 x 250 mm) at a flow rate of 0.5 mL/min and with column temperature at 40 C. Mobile phase A was 25 mM sodium phosphate, pH 6.5. Mobile phase B was 100 mM sodium chloride in the same buffer as mobile phase A. The column was equilibrated with 100% mobile phase A. For pH
screening samples an amount of 20 mg of Apomab was loaded onto the column and the absorbance was monitored at 214 nm. Protein was eluted from the column with the following gradient:
Time min % A %B
For stability analysis of material used in the Toxicology studies an amount of 30 mg of Apomab was loaded onto the column and the absorbance was monitored at 280 nm. Protein was eluted from the column with the following gradient:
Gradient: Time min % A %B
40.0 40 60 41.0 0 100 45.0 0 100 45.1 100 0 60.0 100 0 Size-Exclusion Chromatography Size exclusion chromatography was carried out on an 1100 series HPLC (Agilent Technologies, Inc.) equipped with a diode array detector. An amount of 50 tg Apomab was loaded onto a TSK Gel 3000SWXLTM
(7.8 x 300 mm) column and run at a flow rate of 0.9 mL/min for 20 minutes for pH screening samples and 0.5 mL/min for 30 minutes for Toxicology stability samples with 0.20 M potassium phosphate, 0.25 M potassium chloride, pH 6.2 as a mobile phase. Absorbance was monitored at 280 nm.
Potency The purpose of the potency bioassay was to measure the ability of Apomab to kill Colo205 cells using ALAMARBLUETM. Colo205 is a colon carcinoma cell line, which expresses both DR5 and DR4 death receptors. This assay incorporates a fluorometric/colorimetric growth indicator based on detection of metabolic activity. ALAMARBLUETM is a redox: dye that is blue and non-fluorescent in oxidized state. The intracellular metabolic reduction converts it into a red color that is also fluorescent. The changes in color and fluorescence are proportional to the metabolic activity and number of living cells. The signal decreased when cells die.
Apomab was diluted in medium with anti-Fe and then Colo 205 cells were added to Apomab samples and incubate at 37 C for 48 hours. ALAMARBLUETM is added for the last 2-3 hours.
The plate was read at 530 nm excitation and 590 nm emission to get relative fluorescence units (RFU). The data were analyzed by KALEIDAGRAPHTM. A dilution curve of killing was generated.
stoppers, and stored at -70 C, 5 C, 30 C, and 40 C in the upright position.
For drug substance stability testing, Apomab formulated bulk was sterile filtered through a 0.22 m filter and 10 mL was filled into autoclaved 20cc 316L stainless steel mini-tanks. The tanks were placed upright at -20 C and 5 C. A 1 mL aliquot was aseptically removed from the mini-tanks at specified time intervals to assess protein quality. The control vials were 1 mL aliquots in 3 cc glass vials stored at -20 C.
Color, Appearance, and Clarity The clarity, appearance, and color of the samples were visually assessed under white fluorescent light using a light inspection station with black and white background. For analysis of the drug substance, mini-tank samples were transferred to a 3 cc glass vial for inspection.
pH
pH was measured at room temperature with THERMO ORION SURE-FLOW ROSSTM semi-micro pH
electrode for measuring buffers or THERMO ORION GLSTM combination micro pH
electrode for measuring protein pH screening samples, a Beckman microelectrode probe for Toxicology stability samples. The METERLABTM pHM240 pH/Ion meter (Radiometer Analytical) was calibrated every day with buffer standards (EM Science) at pH 7 and pH 4.
Concentration Protein concentration was determined by ultraviolet absorption spectroscopy using an AGILENT
8453TM spectrophotometer. The samples were diluted with appropriate formulation buffer blanks to give an absorbance from 0.5 to 1Ø The instrument was blanked with the diluent solution and the spectrum was scanned from 240 to 500 nm. The absorbance value at 320 nm was subtracted from the absorbance at 279 nm to correct for offset and light scattering. The protein concentrations were calculated by the following equation:
Conc. (mg/mL) _ (A279 _ A320) X dilution factor absorptivity coefficient in cm 1(mg/mL)-1 The absorptivity coefficient based on sequence was initially determined to be 1.32 cm 1(mg/mL)-1 and this value was used for the pH screening studies. A later value of 1.7 cm 1(mg/mL)-1 was determined by amino acid analysis and proteolysis methods and this value was used for the stability analysis of Aporn.ab used in Toxicology studies.
Ion-Exchange Chromatography Ion exchange chromatography was carried out on an 1100 series HPLC (Agilent Technologies, Inc.) equipped with a diode array detector. Chromatography was carried out on a PROPAC WCX-IOTM (Dionex) column (4 x 250 mm) at a flow rate of 0.5 mL/min and with column temperature at 40 C. Mobile phase A was 25 mM sodium phosphate, pH 6.5. Mobile phase B was 100 mM sodium chloride in the same buffer as mobile phase A. The column was equilibrated with 100% mobile phase A. For pH
screening samples an amount of 20 mg of Apomab was loaded onto the column and the absorbance was monitored at 214 nm. Protein was eluted from the column with the following gradient:
Time min % A %B
For stability analysis of material used in the Toxicology studies an amount of 30 mg of Apomab was loaded onto the column and the absorbance was monitored at 280 nm. Protein was eluted from the column with the following gradient:
Gradient: Time min % A %B
40.0 40 60 41.0 0 100 45.0 0 100 45.1 100 0 60.0 100 0 Size-Exclusion Chromatography Size exclusion chromatography was carried out on an 1100 series HPLC (Agilent Technologies, Inc.) equipped with a diode array detector. An amount of 50 tg Apomab was loaded onto a TSK Gel 3000SWXLTM
(7.8 x 300 mm) column and run at a flow rate of 0.9 mL/min for 20 minutes for pH screening samples and 0.5 mL/min for 30 minutes for Toxicology stability samples with 0.20 M potassium phosphate, 0.25 M potassium chloride, pH 6.2 as a mobile phase. Absorbance was monitored at 280 nm.
Potency The purpose of the potency bioassay was to measure the ability of Apomab to kill Colo205 cells using ALAMARBLUETM. Colo205 is a colon carcinoma cell line, which expresses both DR5 and DR4 death receptors. This assay incorporates a fluorometric/colorimetric growth indicator based on detection of metabolic activity. ALAMARBLUETM is a redox: dye that is blue and non-fluorescent in oxidized state. The intracellular metabolic reduction converts it into a red color that is also fluorescent. The changes in color and fluorescence are proportional to the metabolic activity and number of living cells. The signal decreased when cells die.
Apomab was diluted in medium with anti-Fe and then Colo 205 cells were added to Apomab samples and incubate at 37 C for 48 hours. ALAMARBLUETM is added for the last 2-3 hours.
The plate was read at 530 nm excitation and 590 nm emission to get relative fluorescence units (RFU). The data were analyzed by KALEIDAGRAPHTM. A dilution curve of killing was generated.
RESULTS
Formulation pH Screen Study The effect of pH on antibody stability was studied using Apomab produced from an unarnplified stable cell line. For this analysis, Apomab was formulated at 20 rng/mL antibody in 20 mM sodium acetate buffer at pH 4.0, 4.5, 5.0, 5.5; 20 mM histidine acetate buffer at pH 6.0 and 6.5; and 20 mM sodium phosphate buffer at pH 7Ø All of the formulations contained 240 mM trehalose and 0.02% TWEEN 20 . The formulations were stored for up to 3 months at temperatures of-70 C, 5 C, 30 C, and 40 C and protein stability was determined by various analytical assays, including CAC, pH, concentration, SEC and IEC. No significant changes in CAC, pH
or protein concentration were observed during storage of the samples.
Analysis of the samples by SEC showed that no significant changes occurred during storage at 5 C and -70 C. However, degradation observed as the formation of antibody fragments and soluble aggregates occurred during storage at 30 C and 40 C (Fig. 20). To compare the formulations, antibody monomer kinetics during storage was monitored and the first-order rate constants were calculated. The obtained pH rate profile for the loss in antibody monomer is shown in Fig. 21. The optimal condition for the stability of antibody monomer was obtained by formulating in histidine acetate buffer at pH 6-0.
Apomab charge heterogeneity was monitored by IEC. No significant changes in the IEC profile occurred during storage at 5 C and -70 C. However, degradation observed as the formation of acidic or basic variants occurred depending on the formulation (Fig. 22). In general, increased basic variants were formed at lower formulation pH and more acidic variants were formed at higher formulation pH. T'o compare the formulations, IEC main peak kinetics was monitored during storage and the first-order rate constants were calculated. The obtained pH rate profile for the loss in IEC main peak is shown in Fig. 23. The rate constants observed by IEC were approximately 10 fold higher than those from SEC (Fig.
21). Therefore, the loss in IEC
main peak was the primary degradation of the antibody that will ultimately limit the product shelf life.
Furthermore, as observed by SEC, optimal antibody stability to stabilize IEC
main peak was obtained by formulating in histidine acetate buffer at pH 6Ø
Following the analysis of pH screening data described above, an Apomab formulation was selected that comprised 20 mg/mL antibody in 20 mM histidine acetate, 240 mM trehalose, 0.02% polysorbate 20, pH 6Ø
For the drug product, the vial configuration consisted of 5-5 mL fill in a 5 cc FORMA VITRUMrM vial with a 20 mM DAIKYOTM West stopper. Apomab was stored in stainless steel tanks.
Formulation pH Screen Study The effect of pH on antibody stability was studied using Apomab produced from an unarnplified stable cell line. For this analysis, Apomab was formulated at 20 rng/mL antibody in 20 mM sodium acetate buffer at pH 4.0, 4.5, 5.0, 5.5; 20 mM histidine acetate buffer at pH 6.0 and 6.5; and 20 mM sodium phosphate buffer at pH 7Ø All of the formulations contained 240 mM trehalose and 0.02% TWEEN 20 . The formulations were stored for up to 3 months at temperatures of-70 C, 5 C, 30 C, and 40 C and protein stability was determined by various analytical assays, including CAC, pH, concentration, SEC and IEC. No significant changes in CAC, pH
or protein concentration were observed during storage of the samples.
Analysis of the samples by SEC showed that no significant changes occurred during storage at 5 C and -70 C. However, degradation observed as the formation of antibody fragments and soluble aggregates occurred during storage at 30 C and 40 C (Fig. 20). To compare the formulations, antibody monomer kinetics during storage was monitored and the first-order rate constants were calculated. The obtained pH rate profile for the loss in antibody monomer is shown in Fig. 21. The optimal condition for the stability of antibody monomer was obtained by formulating in histidine acetate buffer at pH 6-0.
Apomab charge heterogeneity was monitored by IEC. No significant changes in the IEC profile occurred during storage at 5 C and -70 C. However, degradation observed as the formation of acidic or basic variants occurred depending on the formulation (Fig. 22). In general, increased basic variants were formed at lower formulation pH and more acidic variants were formed at higher formulation pH. T'o compare the formulations, IEC main peak kinetics was monitored during storage and the first-order rate constants were calculated. The obtained pH rate profile for the loss in IEC main peak is shown in Fig. 23. The rate constants observed by IEC were approximately 10 fold higher than those from SEC (Fig.
21). Therefore, the loss in IEC
main peak was the primary degradation of the antibody that will ultimately limit the product shelf life.
Furthermore, as observed by SEC, optimal antibody stability to stabilize IEC
main peak was obtained by formulating in histidine acetate buffer at pH 6Ø
Following the analysis of pH screening data described above, an Apomab formulation was selected that comprised 20 mg/mL antibody in 20 mM histidine acetate, 240 mM trehalose, 0.02% polysorbate 20, pH 6Ø
For the drug product, the vial configuration consisted of 5-5 mL fill in a 5 cc FORMA VITRUMrM vial with a 20 mM DAIKYOTM West stopper. Apomab was stored in stainless steel tanks.
The stability of Apomab Drug Product was evaluated in the 5cc glass vial configuration described above. Vials were stored at -70 C (controls), 5 C, 30 C, and 40 C. Samples were pulled at specific time intervals and analyzed by the following assays: color, appearance, clarity (CAC), pH, protein concentration, SEC, IEC, and potency. The results from these assays are shown in Table 6 for samples stored at -70 C and 5 C and Table 7 for samples stored at 30 C and 40 C.
Table 6. Stability Data for Apomab Stored at -70 C and 5 C
SEC IEC Potency Temp Time Concentration (% (% main (% Specific ( C) Point Clarity Color pH (mg/mL) monomer) peak) Activity) Acceptance Criteria: Report Report 6Ø 0.3 20 2 > 95% Report 60 - 140 %
NA T=O Clear Colorless 5.9 20.2 99.8 63 94 -70 1 month Clear Colorless 6.0 20.5 99.8 63 86 -70 2 month Clear Colorless 6.0 20.4 99.7 64 91 -70 3 month Clear Colorless 6.0 20.5 99.7 63 83 -70 6 month Clear Colorless 6.0 20.4 99.7 64 85 -70 9 month Clear Colorless 6.0 20.4 99.8 65 89 -70 12 Clear Colorless 6.0 20.8 99.7 63 107 month 1 month Clear Colorless 6.0 20.5 99.7 63 89 5 2 month Clear Colorless 6.0 20.4 99.7 64 99 5 3 month Clear Colorless 6.0 20.6 99.7 63 84 5 6 month Clear Colorless 6.0 20.5 99.7 64 93 5 9 month Clear Colorless 6.0 20.6 99.7 64 88 5 12 Clear Colorless 6.0 20.7 99.6 64 106 month Table 7. Stability Data for Apomab Stored at 30 C and 40 C
SEC IEC Potency Concentration (% (% main (% Specific Temp ( C) Time Point Clarity Color pH (mg/mL) monomer) peak) Activity) Acceptance Criteria: Report Report 6.0 0.3 20 2 > 95% Report 60 - 140%
30 1 month Clear Colorless 6.0 20.6 98.2 59 91 30 2 month Clear Colorless 6.0 20.3 97.4 54 80 30 3 month Clear Colorless 6.0 20.6 97.2 49 74 30 6 month Clear Colorless 6.0 20.2 94.1 37 51 30 9 month Clear Slightly 6.0 20.4 93.2 31 55 yellow 30 12 month Clear Slightly 6.0 20.6 91.6 25 59 yellow 40 1 month Clear Colorless 6.0 20.4 96.6 44 79 40 2 month Clear Colorless 6.0 20.0 93.7 31 64 40 3 month Clear Slightly 5.9 20.3 91.5 22 53 yellow 40 6 month Clear Slightly 6.0 20.2 83.9 NT 26 yellow 40 9 month Clear Yellow 5.9 20.3 78.8 NT 25 40 12 month Clear Yellow 5.9 20.5 71.4 NT 31 NT = not quantitated No change in protein quality was observed after twelve months storage at -70 C
and 5 C. For instance, the pH remained at 6.0 0.3, Apomab appeared as a clear and colorless liquid, the protein concentration remained at 20.0 2.0 mg/mL, and % monomer was unchanged. Furthermore, there was no significant change in % IEC main peak and % specific activity determined by the cell-killing potency assay was within the assay precision of 60 % to 140 % specific activity. The results showed that Apomab stored in 5 cc glass vials was stable for at least 12 months at 5 C.
Table 7 shows that changes in protein quality occurred at 30 C and 40 C. SEC
showed a decrease in %
monomer with a rise primarily in fragment species. Aggregates increase as well at higher temperature, but the rate was much slower. However, the aggregates increase significantly after 6 months at 40 C. IEC % main peak decreased with a corresponding increase in acidic variants. Basic peaks decreased slightly after 2 months at 40 C and 9 months at 30 C. After six months of storage at 40 C, degradation occurred to an extent that 1EC
main peak could no longer be integrated. The cell killing bioassay showed loss of % specific activity at higher temperature with longer storage time. Protein concentration and pH were unchanged. The solution becomes slightly yellow after 3 months at 40 C and 9 months at 30 C and becomes yellow after 9 months at 40 C.
Drug Substance Stability Freeze-thaw stability data for drug substance are shown in Table 8.
Table 6. Stability Data for Apomab Stored at -70 C and 5 C
SEC IEC Potency Temp Time Concentration (% (% main (% Specific ( C) Point Clarity Color pH (mg/mL) monomer) peak) Activity) Acceptance Criteria: Report Report 6Ø 0.3 20 2 > 95% Report 60 - 140 %
NA T=O Clear Colorless 5.9 20.2 99.8 63 94 -70 1 month Clear Colorless 6.0 20.5 99.8 63 86 -70 2 month Clear Colorless 6.0 20.4 99.7 64 91 -70 3 month Clear Colorless 6.0 20.5 99.7 63 83 -70 6 month Clear Colorless 6.0 20.4 99.7 64 85 -70 9 month Clear Colorless 6.0 20.4 99.8 65 89 -70 12 Clear Colorless 6.0 20.8 99.7 63 107 month 1 month Clear Colorless 6.0 20.5 99.7 63 89 5 2 month Clear Colorless 6.0 20.4 99.7 64 99 5 3 month Clear Colorless 6.0 20.6 99.7 63 84 5 6 month Clear Colorless 6.0 20.5 99.7 64 93 5 9 month Clear Colorless 6.0 20.6 99.7 64 88 5 12 Clear Colorless 6.0 20.7 99.6 64 106 month Table 7. Stability Data for Apomab Stored at 30 C and 40 C
SEC IEC Potency Concentration (% (% main (% Specific Temp ( C) Time Point Clarity Color pH (mg/mL) monomer) peak) Activity) Acceptance Criteria: Report Report 6.0 0.3 20 2 > 95% Report 60 - 140%
30 1 month Clear Colorless 6.0 20.6 98.2 59 91 30 2 month Clear Colorless 6.0 20.3 97.4 54 80 30 3 month Clear Colorless 6.0 20.6 97.2 49 74 30 6 month Clear Colorless 6.0 20.2 94.1 37 51 30 9 month Clear Slightly 6.0 20.4 93.2 31 55 yellow 30 12 month Clear Slightly 6.0 20.6 91.6 25 59 yellow 40 1 month Clear Colorless 6.0 20.4 96.6 44 79 40 2 month Clear Colorless 6.0 20.0 93.7 31 64 40 3 month Clear Slightly 5.9 20.3 91.5 22 53 yellow 40 6 month Clear Slightly 6.0 20.2 83.9 NT 26 yellow 40 9 month Clear Yellow 5.9 20.3 78.8 NT 25 40 12 month Clear Yellow 5.9 20.5 71.4 NT 31 NT = not quantitated No change in protein quality was observed after twelve months storage at -70 C
and 5 C. For instance, the pH remained at 6.0 0.3, Apomab appeared as a clear and colorless liquid, the protein concentration remained at 20.0 2.0 mg/mL, and % monomer was unchanged. Furthermore, there was no significant change in % IEC main peak and % specific activity determined by the cell-killing potency assay was within the assay precision of 60 % to 140 % specific activity. The results showed that Apomab stored in 5 cc glass vials was stable for at least 12 months at 5 C.
Table 7 shows that changes in protein quality occurred at 30 C and 40 C. SEC
showed a decrease in %
monomer with a rise primarily in fragment species. Aggregates increase as well at higher temperature, but the rate was much slower. However, the aggregates increase significantly after 6 months at 40 C. IEC % main peak decreased with a corresponding increase in acidic variants. Basic peaks decreased slightly after 2 months at 40 C and 9 months at 30 C. After six months of storage at 40 C, degradation occurred to an extent that 1EC
main peak could no longer be integrated. The cell killing bioassay showed loss of % specific activity at higher temperature with longer storage time. Protein concentration and pH were unchanged. The solution becomes slightly yellow after 3 months at 40 C and 9 months at 30 C and becomes yellow after 9 months at 40 C.
Drug Substance Stability Freeze-thaw stability data for drug substance are shown in Table 8.
Table 8. Freeze-Thaw Stability Data for Apomab Filled in Miniature Stainless Steel Tanks Temp ( C) Freeze-Thaw Concentration SEC
(Frozen/thaw) Cycle No. Clarity Color pH (mg/m L) (% Monomer) Acceptance Criteria: Report Report 6Ø 0.3 20.0 2.0 >95%
Control 0 Clear Colorless 6.0 20.9 99.6 (unfrozen) -20/25 1 Clear Colorless 6.0 20.8 99.6 -20/25 2 Clear Colorless 6.0 20.8 99.6 -20/25 3 Clear Colorless 6.0 20.9 99.6 Table 9. Stability Data for Apomab Filled in Miniature Stainless Steel Tanks SEC IEC Potency Temp Time Concentration (% (% main (% Specific ( C) Point Clarity Color pH (mg/mL) monomer) peak) Activity) Acceptance Criteria: Report Report 6.0 0.3 20 2 > 95% Report 60 - 140%
NA T=0 Clear Colorless 5.9 20.0 99.7 63 88 -20 1 month Clear Colorless 6.0 20.6 99.7 63 107 -20 3 month Clear Colorless 6.0 20.6 99.7 63 82 -20 6 month Clear Colorless 6.0 20.3 99.7 64 92 -20 9 month Clear Colorless 6.0 20.6 99.7 64 92 -20 12 Clear Colorless 6.0 21.2 99.7 65 94 month 1 month Clear Colorless 6.0 20.5 99.7 62 95 5 3 month Clear Colorless 6.0 20.7 99.6 62 71 5 6 month Clear Colorless 6.0 20.4 99.5 62 84 5 9 month Clear Colorless 6.0 20.8 99.4 61 84 5 12 Clear Colorless 6.0 21.3 99.2 59 82 month No significant changes in the chemical characteristics of the protein were observed after being frozen at -20 C for at least 15 hours and thawed at ambient temperature three times. For example, Apomab appeared as a clear and colorless liquid, the pH remained at 6.0 0.3, and the SEC monomer peak percentage was unchanged.
Apomab stability in stainless steel containers was evaluated at -20 C and 5 C
(Table 9).
Samples were aseptically pulled from the mini-tanks at specific intervals and analyzed.
Apomab showed no change in protein quality at 5 C by pH, CAC, protein concentration and % main peak by IEC but lost 0.1% monomer by SEC every 3 months. Decreased potency was observed during storage at 5 C for 3 months. However, the potency of the sample increased again at the 6 and 9 month timepoints. Therefore, the observed potency difference at the 3 month timepoint was attributed to assay variation. Apomab showed ro change in protein quality at -20 C by pH, CAC, protein concentration, %
monomer by SEC, % main peak by IEC, and no significant change in potency. The stability data show that Apomab is stable for at least 1 year at -20 C and three months at 5 C.
CONCLUSION
Formulation screening studies were performed to select a formulation for Apomab. A pH screen covering the pH range 4.0 to 7.0 using sodium acetate, histidine acetate, and sodium phosphate as buffers with 240 mM trehalose dihydrate and 0.02% polysorbate 20 showed that Apomab is most stable in solution at pH 6. C.
Therefore, a formulation consisting of 20 mM histidine acetate, 240 mM
trehalose, 0.02% polysorbate 2, pH 6.0 was developed and demonstrated experimentally to be stable. Using this formulation, Apomab was shown to be stable for at least 12 months at 5 C. Furthermore, Apomab was shown to be stable for at least 12 months at -20 C and three months at 5 C when stored in 316L stainless steel containers.
Apomab was also shown to be stable when subjected to up to 3 freeze/thaw cycles.
(Frozen/thaw) Cycle No. Clarity Color pH (mg/m L) (% Monomer) Acceptance Criteria: Report Report 6Ø 0.3 20.0 2.0 >95%
Control 0 Clear Colorless 6.0 20.9 99.6 (unfrozen) -20/25 1 Clear Colorless 6.0 20.8 99.6 -20/25 2 Clear Colorless 6.0 20.8 99.6 -20/25 3 Clear Colorless 6.0 20.9 99.6 Table 9. Stability Data for Apomab Filled in Miniature Stainless Steel Tanks SEC IEC Potency Temp Time Concentration (% (% main (% Specific ( C) Point Clarity Color pH (mg/mL) monomer) peak) Activity) Acceptance Criteria: Report Report 6.0 0.3 20 2 > 95% Report 60 - 140%
NA T=0 Clear Colorless 5.9 20.0 99.7 63 88 -20 1 month Clear Colorless 6.0 20.6 99.7 63 107 -20 3 month Clear Colorless 6.0 20.6 99.7 63 82 -20 6 month Clear Colorless 6.0 20.3 99.7 64 92 -20 9 month Clear Colorless 6.0 20.6 99.7 64 92 -20 12 Clear Colorless 6.0 21.2 99.7 65 94 month 1 month Clear Colorless 6.0 20.5 99.7 62 95 5 3 month Clear Colorless 6.0 20.7 99.6 62 71 5 6 month Clear Colorless 6.0 20.4 99.5 62 84 5 9 month Clear Colorless 6.0 20.8 99.4 61 84 5 12 Clear Colorless 6.0 21.3 99.2 59 82 month No significant changes in the chemical characteristics of the protein were observed after being frozen at -20 C for at least 15 hours and thawed at ambient temperature three times. For example, Apomab appeared as a clear and colorless liquid, the pH remained at 6.0 0.3, and the SEC monomer peak percentage was unchanged.
Apomab stability in stainless steel containers was evaluated at -20 C and 5 C
(Table 9).
Samples were aseptically pulled from the mini-tanks at specific intervals and analyzed.
Apomab showed no change in protein quality at 5 C by pH, CAC, protein concentration and % main peak by IEC but lost 0.1% monomer by SEC every 3 months. Decreased potency was observed during storage at 5 C for 3 months. However, the potency of the sample increased again at the 6 and 9 month timepoints. Therefore, the observed potency difference at the 3 month timepoint was attributed to assay variation. Apomab showed ro change in protein quality at -20 C by pH, CAC, protein concentration, %
monomer by SEC, % main peak by IEC, and no significant change in potency. The stability data show that Apomab is stable for at least 1 year at -20 C and three months at 5 C.
CONCLUSION
Formulation screening studies were performed to select a formulation for Apomab. A pH screen covering the pH range 4.0 to 7.0 using sodium acetate, histidine acetate, and sodium phosphate as buffers with 240 mM trehalose dihydrate and 0.02% polysorbate 20 showed that Apomab is most stable in solution at pH 6. C.
Therefore, a formulation consisting of 20 mM histidine acetate, 240 mM
trehalose, 0.02% polysorbate 2, pH 6.0 was developed and demonstrated experimentally to be stable. Using this formulation, Apomab was shown to be stable for at least 12 months at 5 C. Furthermore, Apomab was shown to be stable for at least 12 months at -20 C and three months at 5 C when stored in 316L stainless steel containers.
Apomab was also shown to be stable when subjected to up to 3 freeze/thaw cycles.
Sequence Listing <110> GENENTECH, INC.
<120> ANTIBODY FORMULATION IN HISTIDINE-ACETATE BUFFER
<130> 81014-208 <140> PCT/US2005/037471 <141> 2005-10-19 <150> US 60/620,413 <151> 2004-10-20 <160> 74 <210> 1 <211> 107 <212> PRT
<213> Mus musculus <400> 1 Asp Thr Val Met Thr Gin Ser His Lys Ile Met Ser Thr Ser Val Gly Asp Arg Val Ser Ile Thr Cys Lys Ala Ser Gin Asp Val Ser Ile Gly Val Ala Trp Tyr Gin Gin Arg Pro Gly Gin Ser Pro Lys Leu Leu Ile Tyr Ser Ala Ser Tyr Arg Tyr Thr Gly Val Pro Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr Ile Ser Ser Val Gin Ala Glu Asp Leu Ala Val Tyr Tyr Cys Gin Gin Tyr Tyr Ile Tyr Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys <210> 2 <211> 119 <212> PRT
<213> Mus musculus <400> 2 Glu Val Gln Leu Gin Gin Ser Gly Pro Glu Leu Val Lys Pro Gly Thr Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Phe Thr Phe Thr Asp Tyr Thr Met Asp Trp Val Lys Gin Ser His Gly Lys Ser Leu -76a-Glu Trp Ile Gly Asp Val Asn Pro Asn Ser Gly Gly Ser Ile Tyr Asn Gln Arg Phe Lys Gly Lys Ala Ser Leu Thr Val Asp Arg Ser Ser Arg Ile Val Tyr Met Glu Leu Arg Ser Leu Thr Phe Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asn Leu Gly Pro Ser Phe Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu Thr Val Ser Ser <210> 3 <211> 107 <212> PRT
<213> Artificial Sequence <220>
<223> sequence is synthesized <400> 3 Asp Ile Gin Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Val Ser Ile Gly Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ser Ala Ser Tyr Arg Tyr Thr Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Tyr Ile Tyr Pro Tyr Thr Phe Gly Gln Gly Thr Lys Val Giu Ile Lys <210> 4 <211> 119 <212> PRT
<213> Artificial Sequence <220>
<223> sequence is synthesized <400> 4 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly -76b-Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr Thr Met Asp Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Asp Val Asn Pro Asn Ser Gly Gly Ser Ile Tyr Asn Gln Arg Phe Lys Gly Arg Phe Thr Leu Ser Val Asp Arg Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asn Leu Gly Pro Ser Phe Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 5 <211> 107 <212> PRT
<213> Artificial Sequence <220>
<223> sequence is synthesized <400> 5 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Asn Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Asn Ser Leu Pro Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys <210> 6 <211> 119 <212> PRT
<213> Artificial Sequence -76c-<220>
<223> sequence is synthesized <400> 6 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Val Ile Ser Gly Asp Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Arg Val Gly Tyr Ser Leu Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 7 <211> 10 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<220>
<221> Xaa <222> 10 <223> Xaa is preferrably D or S
<400> 7 Gly Phe Thr Phe Thr Asp Tyr Thr Met Xaa <210> 8 <211> 17 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 8 Asp Val Asn Pro Asn Ser Gly Gly Ser Ile Tyr Asn Gln Arg Phe Lys Gly - 76d -<210> 9 <211> 10 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 9 Asn Leu Gly Pro Ser Phe Tyr Phe Asp Tyr <210> 10 <211> 11 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 10 Lys Ala Ser Gln Asp Val Ser Ile Gly Val Ala <210> 11 <211> 7 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<220>
<221> Xaa <222> 5 <223> Xaa is preferably R or L.
<220>
<221> Xaa <222> 6 <223> Xaa is preferably Y or E.
<220>
<221> Xaa <222> 7 <223> Xaa is preferably T or S.
<400> 11 Ser Ala Ser Tyr Xaa Xaa Xaa <210> 12 <211> 9 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 12 - 76e -Gln Gln Tyr Tyr Ile Tyr Pro Tyr Thr <210> 13 <211> 214 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 13 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Val Asn Thr Ala Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ser Ala Ser Phe Leu Tyr Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Arg Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln His Tyr Thr Thr Pro Pro Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 14 <211> 449 <212> PRT
- 76f -<213> Artificial sequence <220>
<223> sequence is synthesized <400> 14 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser - 76g -His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gin Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly <210> 15 <211> 214 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 15 Asp Ile Gln Met Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Val Ser Ile Gly Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ser Ala Ser Tyr Arg Tyr Thr Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile - 76h -Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Tyr Ile Tyr Pro Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 16 <211> 448 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 16 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr Thr Met Asp Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Asp Val Asn Pro Asn Ser Gly Gly Ser Ile Tyr Asn Gln Arg Phe Lys Gly Arg Phe Thr Leu Ser Val Asp Arg Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asn Leu Gly Pro Ser Phe Tyr - 76i -Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser - 76j -Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly <210> 17 <211> 233 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 17 Met Gly Trp Ser Cys Ile Ile Leu Phe Leu Val Ala Thr Ala Thr Gly Val His Ser Asp Ile Gln Met Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Val Ser Ile Gly Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ser Ala Ser Tyr Arg Tyr Thr Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Tyr Ile Tyr Pro Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gin Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val -76k-Tyr Ala Cys Glu Val Thr His Gin Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 18 <211> 467 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 18 Met Gly Trp Ser Cys Ile Ile Leu Phe Leu Val Ala Thr Ala Thr Gly Val His Ser Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr Thr Met Asp Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Asp Val Asn Pro Asn Ser Gly Gly Ser Ile Tyr Asn Gin Arg Phe Lys Gly Arg Phe Thr Leu Ser Val Asp Arg Ser Lys Asn Thr Leu Tyr Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asn Leu Gly Pro Ser Phe Tyr Phe Asp Tyr Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gin Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gin Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gin Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly <210> 19 <211> 195 <212> PRT
<213> Homo sapiens <400> 19 Thr Gln Val Cys Thr Gly Thr Asp Met Lys Leu Arg Leu Pro Ala - 76m -Ser Pro Glu Thr His Leu Asp Met Leu Arg His Leu Tyr Gln Gly Cys Gln Val Val Gln Gly Asn Leu Glu Leu Thr Tyr Leu Pro Thr Asn Ala Ser Leu Ser Phe Leu Gln Asp Ile Gln Glu Val Gln Gly Tyr Val Leu Ile Ala His Asn Gln Val Arg Gln Val Pro Leu Gln Arg Leu Arg Ile Val Arg Gly Thr Gln Leu Phe Glu Asp Asn Tyr Ala Leu Ala Val Leu Asp Asn Gly Asp Pro Leu Asn Asn Thr Thr Pro Val Thr Gly Ala Ser Pro Gly Gly Leu Arg Glu Leu Gln Leu Arg Ser Leu Thr Glu Ile Leu Lys Gly Gly Val Leu Ile Gln Arg Asn Pro Gln Leu Cys Tyr Gln Asp Thr Ile Leu Trp Lys Asp Ile Phe His Lys Asn Asn Gln Leu Ala Leu Thr Leu Ile Asp Thr Asn Arg Ser Arg Ala Cys His Pro Cys Ser Pro Met Cys Lys Gly Ser Arg Cys Trp Gly Glu Ser Ser Glu Asp Cys Gln Ser Leu Thr Arg <210> 20 <211> 124 <212> PRT
<213> Homo sapiens <400> 20 Thr Val Cys Ala Gly Gly Cys Ala Arg Cys Lys Gly Pro Leu Pro Thr Asp Cys Cys His Glu Gln Cys Ala Ala Gly Cys Thr Gly Pro Lys His Ser Asp Cys Leu Ala Cys Leu His Phe Asn His Ser Gly Ile Cys Glu Leu His Cys Pro Ala Leu Val Thr Tyr Asn Thr Asp Thr Phe Glu Ser Met Pro Asn Pro Glu Gly Arg Tyr Thr Phe Gly Ala Ser Cys Val Thr Ala Cys Pro Tyr Asn Tyr Leu Ser Thr Asp - 76n -Val Gly Ser Cys Thr Leu Val Cys Pro Leu His Asn Gln Glu Val Thr Ala Glu Asp Gly Thr Gln Arg Cys Glu Lys Cys Ser Lys Pro Cys Ala Arg Val <210> 21 <211> 169 <212> PRT
<213> Homo sapiens <400> 21 Cys Tyr Gly Leu Gly Met Glu His Leu Arg Glu Val Arg Ala Val Thr Ser Ala Asn Ile Gln Glu Phe Ala Gly Cys Lys Lys Ile Phe Gly Ser Leu Ala Phe Leu Pro Glu Ser Phe Asp Gly Asp Pro Ala Ser Asn Thr Ala Pro Leu Gln Pro Glu Gln Leu Gln Val Phe Glu Thr Leu Glu Glu Ile Thr Gly Tyr Leu Tyr Ile Ser Ala Trp Pro Asp Ser Leu Pro Asp Leu Ser Val Phe Gln Asn Leu Gln Val Ile Arg Gly Arg Ile Leu His Asn Gly Ala Tyr Ser Leu Thr Leu Gln Gly Leu Gly Ile Ser Trp Leu Gly Leu Arg Ser Leu Arg Glu Leu Gly Ser Gly Leu Ala Leu Ile His His Asn Thr His Leu Cys Phe Val His Thr Val Pro Trp Asp Gln Leu Phe Arg Asn Pro His Gln Ala Leu Leu His Thr Ala Asn Arg Pro Glu Asp Glu Cys Val Gly Glu Gly Leu Ala <210> 22 <211> 142 <212> PRT
<213> Homo sapiens <400> 22 Cys His Gln Leu Cys Ala Arg Gly His Cys Trp Gly Pro Gly Pro - 76o -Thr Gln Cys Val Asn Cys Ser Gln Phe Leu Arg Gly Gin Glu Cys Val Glu Glu Cys Arg Val Leu Gln Gly Leu Pro Arg Glu Tyr Val Asn Ala Arg His Cys Leu Pro Cys His Pro Glu Cys Gln Pro Gin Asn Gly Ser Val Thr Cys Phe Gly Pro Glu Ala Asp Gin Cys Val Ala Cys Ala His Tyr Lys Asp Pro Pro Phe Cys Val Ala Arg Cys Pro Ser Gly Val Lys Pro Asp Leu Ser Tyr Met Pro Ile Trp Lys Phe Pro Asp Glu Giu Gly Ala Cys Gln Pro Cys Pro Ile Asn Cys Thr His Ser Cys Val Asp Leu Asp Asp Lys Gly Cys Pro Ala Glu Gin Arg Ala Ser Pro Leu Thr <210> 23 <211> 217 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 23 Val His Ser Asp Ile Gln Met Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gin Asp Val Ser Ile Gly Val Ala Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ser Ala Ser Tyr Arg Tyr Thr Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gin Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Tyr Ile Tyr Pro Tyr Thr Phe Gly Gin Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile -76p-Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 24 <211> 449 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 24 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr Thr Met Asp Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Asp Val Asn Pro Asn Ser Gly Gly Ser Ile Tyr Asn Gln Arg Phe Lys Gly Arg Phe Thr Leu Ser Val Asp Arg Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asn Leu Gly Pro Ser Phe Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp - 76q -Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gin Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gin Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gin Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gin Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gin Pro Arg Glu Pro Gin Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gin Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gin Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gin Gin Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gin Lys Ser Leu Ser Leu Ser Pro Gly Lys - 76r -<210> 25 <211> 107 <212> PRT
<213> Mus musculus <400> 25 Gin Ile Val Leu Ser Gin Ser Pro Ala Ile Leu Ser Ala Ser Pro Gly Glu Lys Val Thr Met Thr Cys Arg Ala Ser Ser Ser Val Ser Tyr Met His Trp Tyr Gin Gin Lys Pro Gly Ser Ser Pro Lys Pro Trp Ile Tyr Ala Pro Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Arg Val Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Gin Trp Ser Phe Asn Pro Pro Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys Arg <210> 26 <211> 107 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 26 Asp Ile Gin Met Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Ser Ser Val Ser Tyr Met His Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys Pro Leu Ile Tyr Ala Pro Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gin Pro Giu Asp Phe Ala Thr Tyr Tyr Cys Gin Gin Trp Ser Phe Asn Pro Pro Thr Phe Gly Gin Gly Thr Lys Val Glu Ile - 76s -Lys Arg <210> 27 <211> 108 <212> PRT
<213> Artificial Sequence <220>
<223> sequence is synthesized <400> 27 Asp Ile Gin Met Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gin Ser Ile Ser Asn Tyr Leu Ala Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gin Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gin Gin Tyr Asn Ser Leu Pro Trp Thr Phe Gly Gin Gly Thr Lys Val Glu Ile Lys Arg <210> 28 <211> 122 <212> PRT
<213> Mus musculus <400> 28 Gin Ala Tyr Leu Gin Gin Ser Gly Ala Glu Leu Val Arg Pro Gly Ala Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Asn Met His Trp Val Lys Gin Thr Pro Arg Gin Gly Leu Glu Trp Ile Gly Ala Ile Tyr Pro Gly Asn Gly Asp Thr Ser Tyr Asn Gin Lys Phe Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr Met Gin Leu Ser Ser Leu Thr Ser Glu Asp - 76t -Ser Ala Val Tyr Phe Cys Ala Arg Val Val Tyr Tyr Ser Asn Ser Tyr Trp Tyr Phe Asp Val Trp Gly Thr Gly Thr Thr Val Thr Val Ser Ser <210> 29 <211> 122 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 29 Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Asn Met His Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Ala Ile Tyr Pro Gly Asn Gly Asp Thr Ser Tyr Asn Gin Lys Phe Lys Gly Arg Phe Thr Ile Ser Val Asp Lys Ser Lys Asn Thr Leu Tyr Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Val Tyr Tyr Ser Asn Ser Tyr Trp Tyr Phe Asp Val Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser <210> 30 <211> 119 <212> PRT
<213> Artificial Sequence <220>
<223> sequence is synthesized <400> 30 Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser - 76u -Ser Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Val Ile Ser Gly Asp Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Arg Val Gly Tyr Ser Leu Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 31 <211> 107 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 31 Asp Ile Gln Met Thr Gln Thr Thr Ser Ser Leu Ser Ala Ser Leu Gly Asp Arg Val Ile Ile Ser Cys Ser Ala Ser Gln Asp Ile Ser Asn Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Val Leu Ile Tyr Phe Thr Ser Ser Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Asn Leu Glu Pro Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Tyr Ser Thr Val Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys <210> 32 <211> 123 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 32 - 76v -Glu Ile Gin Leu Val Gin Ser Gly Pro Glu Leu Lys Gin Pro Gly Glu Thr Val Arg Ile Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr Gly Met Asn Trp Val Lys Gin Ala Pro Gly Lys Gly Leu Lys Trp Met Gly Trp Ile Asn Thr Tyr Thr Gly Glu Pro Thr Tyr Ala Ala Asp Phe Lys Arg Arg Phe Thr Phe Ser Leu Glu Thr Ser Ala Ser Thr Ala Tyr Leu Gin Ile Ser Asn Leu Lys Asn Asp Asp Thr Ala Thr Tyr Phe Cys Ala Lys Tyr Pro His Tyr Tyr Gly Ser Ser His Trp Tyr Phe Asp Val Trp Gly Ala Gly Thr Thr Val Thr Val Ser Ser <210> 33 <211> 107 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 33 Asp Ile Gin Met Thr Gin Her Pro Her Ser Leu Her Ala Her Val Gly Asp Arg Val Thr Ile Thr Cys Her Ala Her Gin Asp Ile Her Asn Tyr Leu Asn Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys Val Leu Ile Tyr Phe Thr Her Her Leu His Her Gly Val Pro Her Arg Phe Her Gly Her Gly Her Gly Thr Asp Phe Thr Leu Thr Ile Her Her Leu Gin Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gin Gin Tyr Her Thr Val Pro Trp Thr Phe Gly Gin Gly Thr Lys Val Glu Ile Lys - 76w -<210> 34 <211> 123 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 34 Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly Her Leu Arg Leu Ser Cys Ala Ala Her Gly Tyr Thr Phe Thr Asn Tyr Gly Met Asn Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Trp Ile Asn Thr Tyr Thr Gly Glu Pro Thr Tyr Ala Ala Asp Phe Lys Arg Arg Phe Thr Phe Ser Leu Asp Thr Her 65 '70 75 Lys Ser Thr Ala Tyr Leu Gin Met Asn Her Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Tyr Pro His Tyr Tyr Gly Her Her His Trp Tyr Phe Asp Val Trp Gly Gin Gly Thr Leu Val Thr Val Ser Her <210> 35 <211> 107 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 35 Asp Ile Gin Leu Thr Gin Her Pro Her Her Leu Her Ala Her Val Gly Asp Arg Val Thr Ile Thr Cys Her Ala Her Gin Asp Ile Her Asn Tyr Leu Asn Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys Val Leu Ile Tyr Phe Thr Her Her Leu His Her Gly Val Pro Her Arg Phe Her Gly Her Gly Her Gly Thr Asp Phe Thr Leu Thr Ile - 76x -Ser Ser Leu Gin Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gin Gin Tyr Ser Thr Val Pro Trp Thr Phe Gly Gin Gly Thr Lys Val Glu Ile Lys <210> 36 <211> 123 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 36 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Asp Phe Thr His Tyr Gly Met Asn Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Trp Ile Asn Thr Tyr Thr Gly Glu Pro Thr Tyr Ala Ala Asp Phe Lys Arg Arg Phe Thr Phe Ser Leu Asp Thr Ser Lys Ser Thr Ala Tyr Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Tyr Pro Tyr Tyr Tyr Gly Thr Ser His Trp Tyr Phe Asp Val Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser <210> 37 <211> 218 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 37 Asp Ile Gin Leu Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gin Ser Val Asp - 76y -Tyr Asp Gly Asp Ser Tyr Met Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Tyr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser His Glu Asp Pro Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 38 <211> 218 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 38 Asp Ile Gln Leu Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Lys Pro Val Asp Gly Glu Gly Asp Ser Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Tyr Leu Glu Ser - 76z -Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser His Glu Asp Pro Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp <210> 39 <211> 218 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 39 Asp Ile Gln Leu Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Lys Pro Val Asp Gly Glu Gly Asp Ser Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Tyr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr - 76aa -Tyr Cys Gin Gin Ser His Glu Asp Pro Tyr Thr Phe Gly Gin Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gin Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gin Trp Lys Val Asp Asn Ala Leu Gin Ser Gly Asn Ser Gin Glu Ser Val Thr Glu Gin Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gin Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 40 <211> 214 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 40 Asp Ile Leu Leu Thr Gin Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gin Ser Ile Gly Thr Asn Ile His Trp Tyr Gin Gin Lys Pro Gly Gin Ala Pro Arg Leu Leu Ile Lys Tyr Ala Ser Glu Ser Ile Ser Gly Ile Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Met Tyr Tyr Cys Gin Gin Ser Asp Ser Trp Pro Thr Thr Phe Gly Gin Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro - 76bb -Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 41 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 41 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Gly Tyr Ser Trp Asn Trp Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Ser Ile Thr Tyr Asp Gly Ser Thr Asn Tyr Asn Pro Ser Val Lys Gly Arg Ile Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr Phe Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Ser His Tyr Phe Gly His Trp His Phe Ala Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val - 76cc -Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly - 76dd -Lys <210> 42 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 42 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Gly Tyr Ser Trp Asn Trp Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Ser Ile Thr Tyr Asp Gly Ser Thr Asn Tyr Asn Pro Ser Val Lys Gly Arg Ile Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr Phe Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Ser His Tyr Phe Gly His Trp His Phe Ala Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly - 76ee -Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 43 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 43 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Val Ser Gly Tyr Ser Ile Thr - 76ff -Ser Gly Tyr Ser Trp Asn Trp Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Ser Ile Lys Tyr Ser Gly Glu Thr Lys Tyr Asn Pro Ser Val Lys Gly Arg Ile Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr Phe Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Ser His Tyr Phe Gly His Trp His Phe Ala Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys - 76gg -Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gin Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gin Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gin Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 44 <211> 453 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 44 Gin Val Gin Leu Val Gin Ser Gly Ala Glu Val Lys Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Ser Met Tyr Trp Leu Glu Trp Val Arg Gin Ala Pro Gly His Gly Leu Glu Trp Val Gly Glu Ile Ser Pro Gly Thr Phe Thr Thr Asn Tyr Asn Glu Lys Phe Lys Ala Arg Ala Thr Phe Thr Ala Asp Thr Ser Thr Asn Thr Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Phe Ser His Phe Ser Gly Ser Asn Tyr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr - 76hh -Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys - 76ii -Ser Arg Trp Gin Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 45 <211> 1042 <212> DNA
<213> Homo sapiens <220>
<221> Unsure <222> 447 <223> N is T or G
<400> 45 tttcctcact gactataaaa gaatagagaa ggaagggctt cagtgaccgg 50 ctgcctggct gacttacagc agtcagactc tgacaggatc atggctatga 100 tggaggtcca ggggggaccc agcctgggac agacctgcgt gctgatcgtg 150 atcttcacag tgctcctgca gtctctctgt gtggctgtaa cttacgtgta 200 ctttaccaac gagctgaagc agatgcagga caagtactcc aaaagtggca 250 ttgcttgttt cttaaaagaa gatgacagtt attgggaccc caatgacgaa 300 gagagtatga acagcccctg ctggcaagtc aagtggcaac tccgtcagct 350 cgttagaaag atgattttga gaacctctga ggaaaccatt tctacagttc 400 aagaaaagca acaaaatatt tctcccctag tgagagaaag aggtccncag 450 agagtagcag ctcacataac tgggaccaga ggaagaagca acacattgtc 500 ttctccaaac tccaagaatg aaaaggctct gggccgcaaa ataaactcct 550 gggaatcatc aaggagtggg cattcattcc tgagcaactt gcacttgagg 600 aatggtgaac tggtcatcca tgaaaaaggg ttttactaca tctattccca 650 aacatacttt cgatttcagg aggaaataaa agaaaacaca aagaacgaca 700 aacaaatggt ccaatatatt tacaaataca caagttatcc tgaccctata 750 ttgttgatga aaagtgctag aaatagttgt tggtctaaag atgcagaata 800 tggactctat tccatctatc aagggggaat atttgagctt aaggaaaatg 850 acagaatttt tgtttctgta acaaatgagc acttgataga catggaccat 900 gaagccagtt ttttcggggc ctttttagtt ggctaactga cctggaaaga 950 aaaagcaata acctcaaagt gactattcag ttttcaggat gatacactat 1000 -76jj-gaagatgttt caaaaaatct gaccaaaaca aacaaacaga as 1042 <210> 46 <211> 281 <212> PRT
<213> Homo sapiens <400> 46 Met Ala Met Met Glu Val Gln Gly Gly Pro Ser Leu Gly Gln Thr Cys Val Leu Ile Val Ile Phe Thr Val Leu Leu Gln Ser Leu Cys Val Ala Val Thr Tyr Val Tyr Phe Thr Asn Glu Leu Lys Gln Met Gln Asp Lys Tyr Ser Lys Ser Gly Ile Ala Cys Phe Leu Lys Glu Asp Asp Ser Tyr Trp Asp Pro Asn Asp Glu Glu Ser Met Asn Ser Pro Cys Trp Gln Val Lys Trp Gln Leu Arg Gln Leu Val Arg Lys Met Ile Leu Arg Thr Ser Glu Glu Thr Ile Ser Thr Val Gln Glu Lys Gln Gin Asn Ile Ser Pro Leu Val Arg Glu Arg Gly Pro Gln Arg Val Ala Ala His Ile Thr Gly Thr Arg Gly Arg Ser Asn Thr Leu Ser Ser Pro Asn Ser Lys Asn Glu Lys Ala Leu Gly Arg Lys Ile Asn Ser Trp Glu Ser Ser Arg Ser Gly His Ser Phe Leu Ser Asn Leu His Leu Arg Asn Gly Glu Leu Val Ile His Glu Lys Gly Phe Tyr Tyr Ile Tyr Ser Gln Thr Tyr Phe Arg Phe Gln Glu Glu Ile Lys Glu Asn Thr Lys Asn Asp Lys Gln Met Val Gln Tyr Ile Tyr Lys Tyr Thr Ser Tyr Pro Asp Pro Ile Leu Leu Met Lys Ser Ala Arg Asn Ser Cys Trp Ser Lys Asp Ala Glu Tyr Gly Leu Tyr Ser Ile Tyr Gln Gly Gly Ile Phe Glu Leu Lys Glu Asn Asp Arg - 76kk -Ile Phe Val Ser Val Thr Asn Glu His Leu Ile Asp Met Asp His Glu Ala Ser Phe Phe Gly Ala Phe Leu Val Gly <210> 47 <211> 411 <212> PRT
<213> Homo sapiens <220>
<221> Xaa <222> 410 <223> Xaa is L or M.
<400> 47 Met Glu Gln Arg Gly Gln Asn Ala Pro Ala Ala Ser Gly Ala Arg Lys Arg His Gly Pro Gly Pro Arg Glu Ala Arg Gly Ala Arg Pro Gly Leu Arg Val Pro Lys Thr Leu Val Leu Val Val Ala Ala Val Leu Leu Leu Val Ser Ala Glu Ser Ala Leu Ile Thr Gln Gln Asp Leu Ala Pro Gln Gln Arg Ala Ala Pro Gln Gln Lys Arg Ser Ser Pro Ser Glu Gly Leu Cys Pro Pro Gly His His Ile Ser Glu Asp Gly Arg Asp Cys Ile Ser Cys Lys Tyr Gly Gln Asp Tyr Ser Thr His Trp Asn Asp Leu Leu Phe Cys Leu Arg Cys Thr Arg Cys Asp Ser Gly Glu Val Glu Leu Ser Pro Cys Thr Thr Thr Arg Asn Thr Val Cys Gln Cys Glu Glu Gly Thr Phe Arg Glu Glu Asp Ser Pro Glu Met Cys Arg Lys Cys Arg Thr Gly Cys Pro Arg Gly Met Val Lys Val Gly Asp Cys Thr Pro Trp Ser Asp Ile Glu Cys Val His Lys Glu Ser Gly Ile Ile Ile Gly Val Thr Val Ala Ala Val Val Leu Ile Val Ala Val Phe Val Cys Lys Ser Leu Leu Trp Lys Lys Val Leu Pro Tyr Leu Lys Giy Ile Cys Ser Gly Gly Gly Gly Asp Pro Glu Arg Val Asp Arg Ser Ser Gln Arg Pro Gly Ala Glu Asp Asn Val Leu Asn Glu Ile Val Ser Ile Leu Gln Pro Thr Gln Val Pro Glu Gln Glu Met Glu Val Gln Glu Pro Ala Glu Pro Thr Gly Val Asn Met Leu Ser Pro Gly Glu Ser Glu His Leu Leu Glu Pro Ala Glu Ala Glu Arg Ser Gln Arg Arg Arg Leu Leu Val Pro Ala Asn Glu Gly Asp Pro Thr Glu Thr Leu Arg Gln Cys Phe Asp Asp Phe Ala Asp Leu Val Pro Phe Asp Ser Trp Glu Pro Leu Met Arg Lys Leu Gly Leu Met Asp Asn Glu Ile Lys Val Ala Lys Ala Glu Ala Ala Gly His Arg Asp Thr Leu Tyr Thr Met Leu Ile Lys Trp Val Asn Lys Thr Gly Arg Asp Ala Ser Val His Thr Leu Leu Asp Ala Leu Glu Thr Leu Gly Glu Arg Leu Ala Lys Gln Lys Ile Glu Asp His Leu Leu Ser Ser Gly Lys Phe Met Tyr Leu Glu Gly Asn Ala Asp Ser Ala Xaa Ser <210> 48 <211> 1799 <212> DNA
<213> Homo sapiens <400> 48 cccacgcgtc cgcataaatc agcacgcggc cggagaaccc cgcaatctct 50 gcgcccacaa aatacaccga cgatgcccga tctactttaa gggctgaaac 100 ccacgggcct gagagactat aagagcgttc cctaccgcca tggaacaacg 150 gggacagaac gccccggccg cttcgggggc ccggaaaagg cacggcccag 200 gacccaggga ggcgcgggga gccaggcctg ggctccgggt ccccaagacc 250 cttgtgctcg ttgtcgccgc ggtcctgctg ttggtctcag ctgagtctgc 300 - 76mm -tctgatcacc caacaagacc tagctcccca gcagagagcg gccccacaac 350 aaaagaggtc cagcccctca gagggattgt gtccacctgg acaccatatc 400 tcagaagacg gtagagattg catctcctgc aaatatggac aggactatag 450 cactcactgg aatgacctcc ttttctgctt gcgctgcacc aggtgtgatt 500 caggtgaagt ggagctaagt ccctgcacca cgaccagaaa cacagtgtgt 550 cagtgcgaag aaggcacctt ccgggaagaa gattctcctg agatgtgccg 600 gaagtgccgc acagggtgtc ccagagggat ggtcaaggtc ggtgattgta 650 caccctggag tgacatcgaa tgtgtccaca aagaatcagg catcatcata 700 ggagtcacag ttgcagccgt agtcttgatt gtggctgtgt ttgtttgcaa 750 gtctttactg tggaagaaag tccttcctta cctgaaaggc atctgctcag 800 gtggtggtgg ggaccctgag cgtgtggaca gaagctcaca acgacctggg 850 gctgaggaca atgtcctcaa tgagatcgtg agtatcttgc agcccaccca 900 ggtccctgag caggaaatgg aagtccagga gccagcagag ccaacaggtg 950 tcaacatgtt gtcccccggg gagtcagagc atctgctgga accggcagaa 1000 gctgaaaggt ctcagaggag gaggctgctg gttccagcaa atgaaggtga 1050 tcccactgag actctgagac agtgcttcga tgactttgca gacttggtgc 1100 cctttgactc ctgggagccg ctcatgagga agttgggcct catggacaat 1150 gagataaagg tggctaaagc tgaggcagcg ggccacaggg acaccttgta 1200 cacgatgctg ataaagtggg tcaacaaaac cgggcgagat gcctctgtcc 1250 acaccctgct ggatgccttg gagacgctgg gagagagact tgccaagcag 1300 aagattgagg accacttgtt gagctctgga aagttcatgt atctagaagg 1350 taatgcagac tctgccwtgt cctaagtgtg attctcttca ggaagtgaga 1400 ccttccctgg tttacctttt ttctggaaaa agcccaactg gactccagtc 1450 agtaggaaag tgccacaatt gtcacatgac cggtactgga agaaactctc 1500 ccatccaaca tcacccagtg gatggaacat cctgtaactt ttcactgcac 1550 ttggcattat ttttataagc tgaatgtgat aataaggaca ctatggaaat 1600 gtctggatca ttccgtttgt gcgtactttg agatttggtt tgggatgtca 1650 ttgttttcac agcacttttt tatcctaatg taaatgcttt atttatttat 1700 ttgggctaca ttgtaagatc catctacaaa aaaaaaaaaa aaaaaaaaag 1750 ggcggccgcg actctagagt cgacctgcag aagcttggcc gccatggcc 1799 - 76nn -<210> 49 <211> 440 <212> PRT
<213> Homo sapiens <400> 49 Met Glu Gln Arg Gly Gln Asn Ala Pro Ala Ala Ser Gly Ala Arg Lys Arg His Gly Pro Gly Pro Arg Glu Ala Arg Gly Ala Arg Pro Gly Pro Arg Val Pro Lys Thr Leu Val Leu Val Val Ala Ala Val Leu Leu Leu Val Ser Ala Glu Ser Ala Leu Ile Thr Gln Gln Asp Leu Ala Pro Gin Gln Arg Ala Ala Pro Gln Gln Lys Arg Ser Ser Pro Ser Glu Gly Leu Cys Pro Pro Gly His His Ile Ser Glu Asp Gly Arg Asp Cys Ile Ser Cys Lys Tyr Gly Gln Asp Tyr Ser Thr His Trp Asn Asp Leu Leu Phe Cys Leu Arg Cys Thr Arg Cys Asp Ser Gly Glu Val Glu Leu Ser Pro Cys Thr Thr Thr Arg Asn Thr Val Cys Gln Cys Glu Glu Gly Thr Phe Arg Glu Glu Asp Ser Pro Glu Met Cys Arg Lys Cys Arg Thr Gly Cys Pro Arg Gly Met Val Lys Val Gly Asp Cys Thr Pro Trp Ser Asp Ile Glu Cys Val His Lys Glu Ser Gly Thr Lys His Ser Gly Glu Ala Pro Ala Val Glu Glu Thr Val Thr Ser Ser Pro Gly Thr Pro Ala Ser Pro Cys Ser Leu Ser Gly Ile Ile Ile Gly Val Thr Val Ala Ala Val Val Leu Ile Val Ala Val Phe Val Cys Lys Ser Leu Leu Trp Lys Lys Val Leu Pro Tyr Leu Lys Gly Ile Cys Ser Gly Gly Gly Gly Asp Pro Glu Arg Val Asp Arg Ser Ser Gln Arg Pro Gly Ala Glu Asp Asn - 76oo -Val Leu Asn Glu Ile Val Ser Ile Leu Gln Pro Thr Gln Val Pro Glu Gln Glu Met Glu Val Gln Glu Pro Ala Glu Pro Thr Gly Val Asn Met Leu Ser Pro Gly Glu Ser Glu His Leu Leu Glu Pro Ala Glu Ala Glu Arg Ser Gln Arg Arg Arg Leu Leu Val Pro Ala Asn Glu Gly Asp Pro Thr Glu Thr Leu Arg Gln Cys Phe Asp Asp Phe Ala Asp Leu Val Pro Phe Asp Ser Trp Glu Pro Leu Met Arg Lys Leu Gly Leu Met Asp Asn Glu Ile Lys Val Ala Lys Ala Glu Ala Ala Gly His Arg Asp Thr Leu Tyr Thr Met Leu Ile Lys Trp Val Asn Lys Thr Gly Arg Asp Ala Ser Val His Thr Leu Leu Asp Ala Leu Glu Thr Leu Gly Glu Arg Leu Ala Lys Gln Lys Ile Glu Asp His Leu Leu Ser Ser Gly Lys Phe Met Tyr Leu Glu Gly Asn Ala Asp Ser Ala Met Ser <210> 50 <211> 1323 <212> DNA
<213> Homo sapiens <400> 50 atggaacaac ggggacagaa cgccccggcc gcttcggggg cccggaaaag 50 gcacggccca ggacccaggg aggcgcgggg agccaggcct gggcccaggg 100 tccccaagac ccttgtgctc gttgtcgccg cggtcctgct gttggtctca 150 gctgagtctg ctctgatcac ccaagaagac ctagctcccc agcagagagc 200 ggccccacaa caaaagaggt ccagcccctc agagggattg tgtccacctg 250 gacaccatat ctcagaagac ggtagagatt gcatctcctg caaatatgga 300 caggactata gcactcactg gaatgacctc cttttctgct tgcgctgcac 350 caggtgtgat tcaggtgaag tggagctaag tccgtgcacc acgaccagaa 400 acacagtgtg tcagtgcgaa gaaggcacct tccgggaaga agattctcct 450 - 76pp -gagatgtgcc ggaagtgccg cacagggtgt cccagaggga tggtcaaggt 500 cggtgattgt acaccctgga gtgacatcga atgtgtccac aaagaatcag 550 gtacaaagca cagtggggaa gccccagctg tggaggagac ggtgacctcc 600 agcccaggga ctcctgcctc tccctgttct ctctcaggca tcatcatagg 650 agtcacagtt gcagccgtag tcttgattgt ggctgtgttt gtttgcaagt 700 ctttactgtg gaagaaagtc cttccttacc tgaaaggcat ctgctcaggt 750 ggtggtgggg accctgagcg tgtggacaga agctcacaac gacctggggc 800 tgaggacaat gtcctcaatg agatcgtgag tatcttgcag cccacccagg 850 tccctgagca ggaaatggaa gtccaggagc cagcagagcc aacaggtgtc 900 aacatgttgt cccccgggga gtcagagcat ctgctggaac cggcagaagc 950 tgaaaggtct cagaggagga ggctgctggt tccagcaaat gaaggtgatc 1000 ccactgagac tctgagacag tgcttcgatg actttgcaga cttggtgccc 1050 tttgactcct gggagccgct catgaggaag ttgggcctca tggacaatga 1100 gataaaggtg gctaaagctg aggcagcggg ccacagggac accttgtaca 1150 cgatgctgat aaagtgggtc aacaaaaccg ggcgagatgc ctctgtccac 1200 accctgctgg atgccttgga gacgctggga gagagacttg ccaagcagaa 1250 gattgaggac cacttgttga gctctggaaa gttcatgtat ctagaaggta 1300 atgcagactc tgccatgtcc taa 1323 <210> 51 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 51 Glu Val Gln Leu Val Gln Ser Gly Gly Gly Val Glu Arg Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Gly Ile Asn Trp Gln Gly Gly Ser Thr Gly Tyr Ala Asp Ser Val Lys Gly Arg Val Thr Ile Ser Arg Asp Asn Ala - 76qq -Lys Asn Ser Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Ile Leu Gly Ala Gly Arg Gly Trp Tyr Phe Asp Tyr Trp Gly Lys Gly Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly - 76rr -Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gin Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gin Gin Gly Asn Val Phe Ser Cys Ser Val Net His Glu Ala Leu His Asn His Tyr Thr Gin Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 52 <211> 213 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 52 Ser Glu Leu Thr Gin Asp Pro Ala Val Ser Val Ala Leu Gly Gin Thr Val Arg Ile Thr Cys Ser Gly Asp Ser Leu Arg Ser Tyr Tyr Ala Ser Trp Tyr Gin Gin Lys Pro Gly Gin Ala Pro Val Leu Val Ile Tyr Gly Ala Asn Asn Arg Pro Ser Gly Ile Pro Asp Arg Phe Ser Gly Ser Ser Ser Gly Asn Thr Ala Ser Leu Thr Ile Thr Gly Ala Gin Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Asn Ser Ala Asp Ser Ser Gly Asn His Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly Gin Pro Lys Ala Ala Pro Ser Val Thr Leu Phe Pro Pro Ser Ser Glu Glu Leu Gin Ala Asn Lys Ala Thr Leu Val Cys Leu Ile Ser Asp Phe Tyr Pro Gly Ala Val Thr Val Ala Trp Lys Ala Asp Ser Ser Pro Val Lys Ala Gly Val Glu Thr Thr Thr Pro - 76ss -Ser Lys Gin Ser Asn Asn Lys Tyr Ala Ala Ser Ser Tyr Leu Ser Leu Thr Pro Glu Gin Trp Lys Ser His Lys Ser Tyr Ser Cys Gin Val Thr His Glu Gly Ser Thr Val Glu Lys Thr Val Ala Pro Thr Glu Cys Ser <210> 53 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 53 Glu Val Gin Leu Val Gin Her Gly Gly Gly Val Glu Arg Pro Gly Gly Her Leu Arg Leu Her Cys Ala Ala Her Gly Phe Thr Phe Asp Asp Tyr Gly Met Her Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Gly Ile Asn Trp Asn Gly Gly Her Thr G1y Tyr Ala Asp Her Val Lys Gly Arg Val Thr Ile Her Arg Asp Asn Ala Lys Asn Her Leu Tyr Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Ile Leu Gly Ala Gly Arg Gly Trp Tyr Phe Asp Leu Trp Gly Lys Gly Thr Thr Val Thr Val Her Her Ala Her Thr Lys Gly Pro Her Val Phe Pro Leu Ala Pro Her Her Lys Her Thr Her Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Her Trp Asn Her Gly Ala Leu Thr Her Gly Val His Thr Phe Pro Ala Val Leu Gin Her Her Gly Leu Tyr Her Leu Her Her Val Val Thr Val Pro Her Ser - 76tt -Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gin Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 54 <211> 213 <212> PRT
<213> Artificial sequence <220>
- 76uu -<223> Sequence is synthesized.
<400> 54 Her Glu Leu Thr Gln Asp Pro Ala Val Her Val Ala Leu Gly Gln Thr Val Arg Ile Thr Cys Gln Gly Asp Her Leu Arg Her Tyr Tyr Ala Her Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Val Leu Val Ile Tyr Gly Lys Asn Asn Arg Pro Her Gly Ile Pro Asp Arg Phe Her Gly Her Her Her Gly Asn Thr Ala Her Leu Thr Ile Thr Gly Ala Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Asn Her Arg Asp Her Her Gly Asn His Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly Gln Pro Lys Ala Ala Pro Her Val Thr Leu Phe Pro Pro Ser Ser Glu Glu Leu Gln Ala Asn Lys Ala Thr Leu Val Cys Leu Ile Her Asp Phe Tyr Pro Gly Ala Val Thr Val Ala Trp Lys Ala Asp Her Her Pro Val Lys Ala Gly Val Glu Thr Thr Thr Pro Her Lys Gln Her Asn Asn Lys Tyr Ala Ala Her Her Tyr Leu Her Leu Thr Pro Glu Gln Trp Lys Her His Lys Her Tyr Her Cys Gln Val Thr His Glu Gly Her Thr Val Glu Lys Thr Val Ala Pro Thr Glu Cys Her <210> 55 <211> 126 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 55 Glu Val Gln Leu Val Gln Her Gly Gly Gly Val Glu Arg Pro Gly - 76w -Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr Ala Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Gly Ile Asn Trp Gln Gly Gly Ser Thr Gly Tyr Ala Asp Ser Val Lys Gly Arg Val Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Ile Leu Gly Ala Gly Arg Gly Trp Tyr Phe Asp Tyr Trp Gly Lys Gly Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro <210> 56 <211> 108 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 56 Ser Glu Leu Thr Gln Asp Pro Ala Val Ser Val Ala Leu Gly Gln Thr Val Arg Ile Thr Cys Ser Gly Asp Ser Leu Arg Ser Tyr Tyr Ala Ser Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Val Leu Val Ile Tyr Gly Ala Asn Asn Arg Pro Ser Gly Ile Pro Asp Arg Phe Ser Gly Ser Ser Ser Gly Asn Thr Ala Ser Leu Thr Ile Thr Gly Ala Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Asn Ser Ala Asp Ser Ser Gly Asn His Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly <210> 57 <211> 10 <212> PRT
- 76ww -<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 57 Arg Ala Ser Ser Ser Val Ser Tyr Met His <210> 58 <211> 7 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 58 Ala Pro Ser Asn Leu Ala Ser <210> 59 <211> 9 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 59 Gin Gin Trp Ser Phe Asn Pro Pro Thr <210> 60 <211> 10 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 60 Gly Tyr Thr Phe Thr Ser Tyr Asn Met His <210> 61 <211> 17 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 61 Ala Ile Tyr Pro Gly Asn Gly Asp Thr Ser Tyr Asn Gln Lys Phe Lys Gly - 76xx -<210> 62 <211> 13 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 62 Val Val Tyr Tyr Ser Asn Her Tyr Trp Tyr Phe Asp Val <210> 63 <211> 213 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 63 Asp Ile Gin Met Thr Gln Her Pro Her Her Leu Her Ala Her Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Her Her Ser Val Her Tyr Met His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Pro Leu Ile Tyr Ala Pro Her Asn Leu Ala Her Gly Val Pro Her Arg Phe Her Gly Her Gly Her Gly Thr Asp Phe Thr Leu Thr Ile Her Her Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Trp Ser Phe Asn Pro Pro Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Her Val Phe Ile Phe Pro Pro Her Asp Glu Gln Leu Lys Ser Gly Thr Ala Her Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Her Gln Glu Her Val Thr Glu Gln Asp Her Lys Asp Her Thr Tyr Ser Leu Ser Her Thr Leu Thr Leu Her Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val - 76yy -Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 64 <211> 213 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 64 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Ser Ser Val Ser Tyr Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Pro Leu Ile Tyr Ala Pro Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Trp Ala Phe Asn Pro Pro Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys - 76zz -<210> 65 <211> 452 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 65 Glu Val Gln Leu Val Glu Her Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Thr Her Tyr Asn Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Ala Ile Tyr Pro Gly Asn Gly Asp Thr Ser Tyr Asn Gln Lys Phe Lys Gly Arg Phe Thr Ile Ser Val Asp Lys Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Val Tyr Tyr Her Asn Her Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Her Thr Lys Gly Pro Her Val Phe Pro Leu Ala Pro Her Her Lys Ser Thr Her Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Her Trp Asn Her Gly Ala Leu Thr Her Gly Val His Thr Phe Pro Ala Val Leu Gln Her Her Gly Leu Tyr Her Leu Her Her Val Val Thr Val Pro Her Her Her Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Her Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Her Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Her Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr - 76aaa -Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 66 <211> 452 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 66 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Asn Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu - 76bbb -Glu Trp Val Gly Ala Ile Tyr Pro Gly Asn Gly Ala Thr Ser Tyr Asn Gln Lys Phe Lys Gly Arg Phe Thr Ile Ser Val Asp Lys Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Val Tyr Tyr Ser Tyr Arg Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ala Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Ala Ala Leu Pro Ala Pro Ile Ala Ala Thr Ile Ser Lys Ala Lys - 76ccc -Gly Gin Pro Arg Glu Pro Gin Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gin Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 67 <211> 10 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<220>
<221> Xaa <222> 9 <223> Xaa is M or L.
<400> 67 Arg Ala Ser Ser Ser Val Ser Tyr Xaa His <210> 68 <211> 9 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<220>
<221> Xaa <222> 4 <223> Xaa is S or A.
<400> 68 Gln Gln Trp Xaa Phe Asn Pro Pro Thr <210> 69 <211> 17 - 76ddd -<212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<220>
<221> Xaa <222> 8 <223> Xaa is D or A.
<400> 69 Ala Ile Tyr Pro Giy Asn Gly Xaa Thr Ser Tyr Asn Gln Lys Phe Lys Gly <210> 70 <211> 13 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<220>
<221> Xaa <222> 6 <223> Xaa is N, A, Y, W or D.
<220>
<221> Xaa <222> 7 <223> Xaa is S or R.
<400> 70 Val Val Tyr Tyr Ser Xaa Xaa Tyr Trp Tyr Phe Asp Val <210> 71 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 71 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Asn Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Ala Ile Tyr Pro Gly Asn Gly Asp Thr Ser Tyr - 76eee -Asn Gln Lys Phe Lys Gly Arg Phe Thr Ile Ser Val Asp Lys Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Val Tyr Tyr Ser Asn Ser Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg - 76fff -Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly <210> 72 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 72 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Asn Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Ala Ile Tyr Pro Gly Asn Gly Ala Thr Ser Tyr Asn Gln Lys Phe Lys Gly Arg Phe Thr Ile Ser Val Asp Lys Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Val Tyr Tyr Ser Tyr Arg Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu - 76ggg -Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ala Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Ala Ala Leu Pro Ala Pro Ile Ala Ala Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn G1y Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro - 76hhh -Gly <210> 73 <211> 107 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 73 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Ser Ser Val Ser Tyr Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Pro Leu Ile Tyr Ala Pro Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Trp Ala Phe Asn Pro Pro Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg <210> 74 <211> 122 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 74 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Asn Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Ala Ile Tyr Pro Gly Asn Gly Ala Thr Ser Tyr Asn Gln Lys Phe Lys Gly Arg Phe Thr Ile Ser Val Asp Lys Ser - 76iii -Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Val Tyr Tyr Ser Tyr Arg Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
<120> ANTIBODY FORMULATION IN HISTIDINE-ACETATE BUFFER
<130> 81014-208 <140> PCT/US2005/037471 <141> 2005-10-19 <150> US 60/620,413 <151> 2004-10-20 <160> 74 <210> 1 <211> 107 <212> PRT
<213> Mus musculus <400> 1 Asp Thr Val Met Thr Gin Ser His Lys Ile Met Ser Thr Ser Val Gly Asp Arg Val Ser Ile Thr Cys Lys Ala Ser Gin Asp Val Ser Ile Gly Val Ala Trp Tyr Gin Gin Arg Pro Gly Gin Ser Pro Lys Leu Leu Ile Tyr Ser Ala Ser Tyr Arg Tyr Thr Gly Val Pro Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr Ile Ser Ser Val Gin Ala Glu Asp Leu Ala Val Tyr Tyr Cys Gin Gin Tyr Tyr Ile Tyr Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys <210> 2 <211> 119 <212> PRT
<213> Mus musculus <400> 2 Glu Val Gln Leu Gin Gin Ser Gly Pro Glu Leu Val Lys Pro Gly Thr Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Phe Thr Phe Thr Asp Tyr Thr Met Asp Trp Val Lys Gin Ser His Gly Lys Ser Leu -76a-Glu Trp Ile Gly Asp Val Asn Pro Asn Ser Gly Gly Ser Ile Tyr Asn Gln Arg Phe Lys Gly Lys Ala Ser Leu Thr Val Asp Arg Ser Ser Arg Ile Val Tyr Met Glu Leu Arg Ser Leu Thr Phe Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asn Leu Gly Pro Ser Phe Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu Thr Val Ser Ser <210> 3 <211> 107 <212> PRT
<213> Artificial Sequence <220>
<223> sequence is synthesized <400> 3 Asp Ile Gin Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Val Ser Ile Gly Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ser Ala Ser Tyr Arg Tyr Thr Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Tyr Ile Tyr Pro Tyr Thr Phe Gly Gln Gly Thr Lys Val Giu Ile Lys <210> 4 <211> 119 <212> PRT
<213> Artificial Sequence <220>
<223> sequence is synthesized <400> 4 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly -76b-Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr Thr Met Asp Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Asp Val Asn Pro Asn Ser Gly Gly Ser Ile Tyr Asn Gln Arg Phe Lys Gly Arg Phe Thr Leu Ser Val Asp Arg Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asn Leu Gly Pro Ser Phe Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 5 <211> 107 <212> PRT
<213> Artificial Sequence <220>
<223> sequence is synthesized <400> 5 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Asn Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Asn Ser Leu Pro Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys <210> 6 <211> 119 <212> PRT
<213> Artificial Sequence -76c-<220>
<223> sequence is synthesized <400> 6 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Val Ile Ser Gly Asp Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Arg Val Gly Tyr Ser Leu Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 7 <211> 10 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<220>
<221> Xaa <222> 10 <223> Xaa is preferrably D or S
<400> 7 Gly Phe Thr Phe Thr Asp Tyr Thr Met Xaa <210> 8 <211> 17 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 8 Asp Val Asn Pro Asn Ser Gly Gly Ser Ile Tyr Asn Gln Arg Phe Lys Gly - 76d -<210> 9 <211> 10 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 9 Asn Leu Gly Pro Ser Phe Tyr Phe Asp Tyr <210> 10 <211> 11 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 10 Lys Ala Ser Gln Asp Val Ser Ile Gly Val Ala <210> 11 <211> 7 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<220>
<221> Xaa <222> 5 <223> Xaa is preferably R or L.
<220>
<221> Xaa <222> 6 <223> Xaa is preferably Y or E.
<220>
<221> Xaa <222> 7 <223> Xaa is preferably T or S.
<400> 11 Ser Ala Ser Tyr Xaa Xaa Xaa <210> 12 <211> 9 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 12 - 76e -Gln Gln Tyr Tyr Ile Tyr Pro Tyr Thr <210> 13 <211> 214 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 13 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Val Asn Thr Ala Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ser Ala Ser Phe Leu Tyr Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Arg Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln His Tyr Thr Thr Pro Pro Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 14 <211> 449 <212> PRT
- 76f -<213> Artificial sequence <220>
<223> sequence is synthesized <400> 14 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser - 76g -His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gin Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly <210> 15 <211> 214 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 15 Asp Ile Gln Met Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Val Ser Ile Gly Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ser Ala Ser Tyr Arg Tyr Thr Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile - 76h -Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Tyr Ile Tyr Pro Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 16 <211> 448 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 16 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr Thr Met Asp Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Asp Val Asn Pro Asn Ser Gly Gly Ser Ile Tyr Asn Gln Arg Phe Lys Gly Arg Phe Thr Leu Ser Val Asp Arg Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asn Leu Gly Pro Ser Phe Tyr - 76i -Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser - 76j -Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly <210> 17 <211> 233 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 17 Met Gly Trp Ser Cys Ile Ile Leu Phe Leu Val Ala Thr Ala Thr Gly Val His Ser Asp Ile Gln Met Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Val Ser Ile Gly Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ser Ala Ser Tyr Arg Tyr Thr Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Tyr Ile Tyr Pro Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gin Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val -76k-Tyr Ala Cys Glu Val Thr His Gin Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 18 <211> 467 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 18 Met Gly Trp Ser Cys Ile Ile Leu Phe Leu Val Ala Thr Ala Thr Gly Val His Ser Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr Thr Met Asp Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Asp Val Asn Pro Asn Ser Gly Gly Ser Ile Tyr Asn Gin Arg Phe Lys Gly Arg Phe Thr Leu Ser Val Asp Arg Ser Lys Asn Thr Leu Tyr Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asn Leu Gly Pro Ser Phe Tyr Phe Asp Tyr Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gin Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gin Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gin Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly <210> 19 <211> 195 <212> PRT
<213> Homo sapiens <400> 19 Thr Gln Val Cys Thr Gly Thr Asp Met Lys Leu Arg Leu Pro Ala - 76m -Ser Pro Glu Thr His Leu Asp Met Leu Arg His Leu Tyr Gln Gly Cys Gln Val Val Gln Gly Asn Leu Glu Leu Thr Tyr Leu Pro Thr Asn Ala Ser Leu Ser Phe Leu Gln Asp Ile Gln Glu Val Gln Gly Tyr Val Leu Ile Ala His Asn Gln Val Arg Gln Val Pro Leu Gln Arg Leu Arg Ile Val Arg Gly Thr Gln Leu Phe Glu Asp Asn Tyr Ala Leu Ala Val Leu Asp Asn Gly Asp Pro Leu Asn Asn Thr Thr Pro Val Thr Gly Ala Ser Pro Gly Gly Leu Arg Glu Leu Gln Leu Arg Ser Leu Thr Glu Ile Leu Lys Gly Gly Val Leu Ile Gln Arg Asn Pro Gln Leu Cys Tyr Gln Asp Thr Ile Leu Trp Lys Asp Ile Phe His Lys Asn Asn Gln Leu Ala Leu Thr Leu Ile Asp Thr Asn Arg Ser Arg Ala Cys His Pro Cys Ser Pro Met Cys Lys Gly Ser Arg Cys Trp Gly Glu Ser Ser Glu Asp Cys Gln Ser Leu Thr Arg <210> 20 <211> 124 <212> PRT
<213> Homo sapiens <400> 20 Thr Val Cys Ala Gly Gly Cys Ala Arg Cys Lys Gly Pro Leu Pro Thr Asp Cys Cys His Glu Gln Cys Ala Ala Gly Cys Thr Gly Pro Lys His Ser Asp Cys Leu Ala Cys Leu His Phe Asn His Ser Gly Ile Cys Glu Leu His Cys Pro Ala Leu Val Thr Tyr Asn Thr Asp Thr Phe Glu Ser Met Pro Asn Pro Glu Gly Arg Tyr Thr Phe Gly Ala Ser Cys Val Thr Ala Cys Pro Tyr Asn Tyr Leu Ser Thr Asp - 76n -Val Gly Ser Cys Thr Leu Val Cys Pro Leu His Asn Gln Glu Val Thr Ala Glu Asp Gly Thr Gln Arg Cys Glu Lys Cys Ser Lys Pro Cys Ala Arg Val <210> 21 <211> 169 <212> PRT
<213> Homo sapiens <400> 21 Cys Tyr Gly Leu Gly Met Glu His Leu Arg Glu Val Arg Ala Val Thr Ser Ala Asn Ile Gln Glu Phe Ala Gly Cys Lys Lys Ile Phe Gly Ser Leu Ala Phe Leu Pro Glu Ser Phe Asp Gly Asp Pro Ala Ser Asn Thr Ala Pro Leu Gln Pro Glu Gln Leu Gln Val Phe Glu Thr Leu Glu Glu Ile Thr Gly Tyr Leu Tyr Ile Ser Ala Trp Pro Asp Ser Leu Pro Asp Leu Ser Val Phe Gln Asn Leu Gln Val Ile Arg Gly Arg Ile Leu His Asn Gly Ala Tyr Ser Leu Thr Leu Gln Gly Leu Gly Ile Ser Trp Leu Gly Leu Arg Ser Leu Arg Glu Leu Gly Ser Gly Leu Ala Leu Ile His His Asn Thr His Leu Cys Phe Val His Thr Val Pro Trp Asp Gln Leu Phe Arg Asn Pro His Gln Ala Leu Leu His Thr Ala Asn Arg Pro Glu Asp Glu Cys Val Gly Glu Gly Leu Ala <210> 22 <211> 142 <212> PRT
<213> Homo sapiens <400> 22 Cys His Gln Leu Cys Ala Arg Gly His Cys Trp Gly Pro Gly Pro - 76o -Thr Gln Cys Val Asn Cys Ser Gln Phe Leu Arg Gly Gin Glu Cys Val Glu Glu Cys Arg Val Leu Gln Gly Leu Pro Arg Glu Tyr Val Asn Ala Arg His Cys Leu Pro Cys His Pro Glu Cys Gln Pro Gin Asn Gly Ser Val Thr Cys Phe Gly Pro Glu Ala Asp Gin Cys Val Ala Cys Ala His Tyr Lys Asp Pro Pro Phe Cys Val Ala Arg Cys Pro Ser Gly Val Lys Pro Asp Leu Ser Tyr Met Pro Ile Trp Lys Phe Pro Asp Glu Giu Gly Ala Cys Gln Pro Cys Pro Ile Asn Cys Thr His Ser Cys Val Asp Leu Asp Asp Lys Gly Cys Pro Ala Glu Gin Arg Ala Ser Pro Leu Thr <210> 23 <211> 217 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 23 Val His Ser Asp Ile Gln Met Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gin Asp Val Ser Ile Gly Val Ala Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ser Ala Ser Tyr Arg Tyr Thr Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gin Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Tyr Ile Tyr Pro Tyr Thr Phe Gly Gin Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile -76p-Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 24 <211> 449 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 24 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr Thr Met Asp Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Asp Val Asn Pro Asn Ser Gly Gly Ser Ile Tyr Asn Gln Arg Phe Lys Gly Arg Phe Thr Leu Ser Val Asp Arg Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Asn Leu Gly Pro Ser Phe Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp - 76q -Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gin Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gin Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gin Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gin Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gin Pro Arg Glu Pro Gin Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gin Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gin Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gin Gin Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gin Lys Ser Leu Ser Leu Ser Pro Gly Lys - 76r -<210> 25 <211> 107 <212> PRT
<213> Mus musculus <400> 25 Gin Ile Val Leu Ser Gin Ser Pro Ala Ile Leu Ser Ala Ser Pro Gly Glu Lys Val Thr Met Thr Cys Arg Ala Ser Ser Ser Val Ser Tyr Met His Trp Tyr Gin Gin Lys Pro Gly Ser Ser Pro Lys Pro Trp Ile Tyr Ala Pro Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Arg Val Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Gin Trp Ser Phe Asn Pro Pro Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys Arg <210> 26 <211> 107 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 26 Asp Ile Gin Met Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Ser Ser Val Ser Tyr Met His Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys Pro Leu Ile Tyr Ala Pro Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gin Pro Giu Asp Phe Ala Thr Tyr Tyr Cys Gin Gin Trp Ser Phe Asn Pro Pro Thr Phe Gly Gin Gly Thr Lys Val Glu Ile - 76s -Lys Arg <210> 27 <211> 108 <212> PRT
<213> Artificial Sequence <220>
<223> sequence is synthesized <400> 27 Asp Ile Gin Met Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gin Ser Ile Ser Asn Tyr Leu Ala Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Ser Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gin Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gin Gin Tyr Asn Ser Leu Pro Trp Thr Phe Gly Gin Gly Thr Lys Val Glu Ile Lys Arg <210> 28 <211> 122 <212> PRT
<213> Mus musculus <400> 28 Gin Ala Tyr Leu Gin Gin Ser Gly Ala Glu Leu Val Arg Pro Gly Ala Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Asn Met His Trp Val Lys Gin Thr Pro Arg Gin Gly Leu Glu Trp Ile Gly Ala Ile Tyr Pro Gly Asn Gly Asp Thr Ser Tyr Asn Gin Lys Phe Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr Met Gin Leu Ser Ser Leu Thr Ser Glu Asp - 76t -Ser Ala Val Tyr Phe Cys Ala Arg Val Val Tyr Tyr Ser Asn Ser Tyr Trp Tyr Phe Asp Val Trp Gly Thr Gly Thr Thr Val Thr Val Ser Ser <210> 29 <211> 122 <212> PRT
<213> Artificial sequence <220>
<223> sequence is synthesized <400> 29 Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Asn Met His Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Ala Ile Tyr Pro Gly Asn Gly Asp Thr Ser Tyr Asn Gin Lys Phe Lys Gly Arg Phe Thr Ile Ser Val Asp Lys Ser Lys Asn Thr Leu Tyr Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Val Tyr Tyr Ser Asn Ser Tyr Trp Tyr Phe Asp Val Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser <210> 30 <211> 119 <212> PRT
<213> Artificial Sequence <220>
<223> sequence is synthesized <400> 30 Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser - 76u -Ser Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Val Ile Ser Gly Asp Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Arg Val Gly Tyr Ser Leu Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser <210> 31 <211> 107 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 31 Asp Ile Gln Met Thr Gln Thr Thr Ser Ser Leu Ser Ala Ser Leu Gly Asp Arg Val Ile Ile Ser Cys Ser Ala Ser Gln Asp Ile Ser Asn Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Val Leu Ile Tyr Phe Thr Ser Ser Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Asn Leu Glu Pro Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Tyr Ser Thr Val Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys <210> 32 <211> 123 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 32 - 76v -Glu Ile Gin Leu Val Gin Ser Gly Pro Glu Leu Lys Gin Pro Gly Glu Thr Val Arg Ile Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asn Tyr Gly Met Asn Trp Val Lys Gin Ala Pro Gly Lys Gly Leu Lys Trp Met Gly Trp Ile Asn Thr Tyr Thr Gly Glu Pro Thr Tyr Ala Ala Asp Phe Lys Arg Arg Phe Thr Phe Ser Leu Glu Thr Ser Ala Ser Thr Ala Tyr Leu Gin Ile Ser Asn Leu Lys Asn Asp Asp Thr Ala Thr Tyr Phe Cys Ala Lys Tyr Pro His Tyr Tyr Gly Ser Ser His Trp Tyr Phe Asp Val Trp Gly Ala Gly Thr Thr Val Thr Val Ser Ser <210> 33 <211> 107 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 33 Asp Ile Gin Met Thr Gin Her Pro Her Ser Leu Her Ala Her Val Gly Asp Arg Val Thr Ile Thr Cys Her Ala Her Gin Asp Ile Her Asn Tyr Leu Asn Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys Val Leu Ile Tyr Phe Thr Her Her Leu His Her Gly Val Pro Her Arg Phe Her Gly Her Gly Her Gly Thr Asp Phe Thr Leu Thr Ile Her Her Leu Gin Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gin Gin Tyr Her Thr Val Pro Trp Thr Phe Gly Gin Gly Thr Lys Val Glu Ile Lys - 76w -<210> 34 <211> 123 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 34 Glu Val Gin Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly Her Leu Arg Leu Ser Cys Ala Ala Her Gly Tyr Thr Phe Thr Asn Tyr Gly Met Asn Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Trp Ile Asn Thr Tyr Thr Gly Glu Pro Thr Tyr Ala Ala Asp Phe Lys Arg Arg Phe Thr Phe Ser Leu Asp Thr Her 65 '70 75 Lys Ser Thr Ala Tyr Leu Gin Met Asn Her Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Tyr Pro His Tyr Tyr Gly Her Her His Trp Tyr Phe Asp Val Trp Gly Gin Gly Thr Leu Val Thr Val Ser Her <210> 35 <211> 107 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 35 Asp Ile Gin Leu Thr Gin Her Pro Her Her Leu Her Ala Her Val Gly Asp Arg Val Thr Ile Thr Cys Her Ala Her Gin Asp Ile Her Asn Tyr Leu Asn Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys Val Leu Ile Tyr Phe Thr Her Her Leu His Her Gly Val Pro Her Arg Phe Her Gly Her Gly Her Gly Thr Asp Phe Thr Leu Thr Ile - 76x -Ser Ser Leu Gin Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gin Gin Tyr Ser Thr Val Pro Trp Thr Phe Gly Gin Gly Thr Lys Val Glu Ile Lys <210> 36 <211> 123 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 36 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gin Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Asp Phe Thr His Tyr Gly Met Asn Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Trp Ile Asn Thr Tyr Thr Gly Glu Pro Thr Tyr Ala Ala Asp Phe Lys Arg Arg Phe Thr Phe Ser Leu Asp Thr Ser Lys Ser Thr Ala Tyr Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Tyr Pro Tyr Tyr Tyr Gly Thr Ser His Trp Tyr Phe Asp Val Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser <210> 37 <211> 218 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 37 Asp Ile Gin Leu Thr Gin Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gin Ser Val Asp - 76y -Tyr Asp Gly Asp Ser Tyr Met Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Tyr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser His Glu Asp Pro Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 38 <211> 218 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 38 Asp Ile Gln Leu Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Lys Pro Val Asp Gly Glu Gly Asp Ser Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Tyr Leu Glu Ser - 76z -Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser His Glu Asp Pro Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp <210> 39 <211> 218 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 39 Asp Ile Gln Leu Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Lys Pro Val Asp Gly Glu Gly Asp Ser Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Tyr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr - 76aa -Tyr Cys Gin Gin Ser His Glu Asp Pro Tyr Thr Phe Gly Gin Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gin Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gin Trp Lys Val Asp Asn Ala Leu Gin Ser Gly Asn Ser Gin Glu Ser Val Thr Glu Gin Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gin Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 40 <211> 214 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 40 Asp Ile Leu Leu Thr Gin Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gin Ser Ile Gly Thr Asn Ile His Trp Tyr Gin Gin Lys Pro Gly Gin Ala Pro Arg Leu Leu Ile Lys Tyr Ala Ser Glu Ser Ile Ser Gly Ile Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Met Tyr Tyr Cys Gin Gin Ser Asp Ser Trp Pro Thr Thr Phe Gly Gin Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro - 76bb -Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 41 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 41 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Gly Tyr Ser Trp Asn Trp Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Ser Ile Thr Tyr Asp Gly Ser Thr Asn Tyr Asn Pro Ser Val Lys Gly Arg Ile Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr Phe Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Ser His Tyr Phe Gly His Trp His Phe Ala Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val - 76cc -Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly - 76dd -Lys <210> 42 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 42 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Gly Tyr Ser Trp Asn Trp Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Ser Ile Thr Tyr Asp Gly Ser Thr Asn Tyr Asn Pro Ser Val Lys Gly Arg Ile Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr Phe Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Ser His Tyr Phe Gly His Trp His Phe Ala Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly - 76ee -Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 43 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 43 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Val Ser Gly Tyr Ser Ile Thr - 76ff -Ser Gly Tyr Ser Trp Asn Trp Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Ser Ile Lys Tyr Ser Gly Glu Thr Lys Tyr Asn Pro Ser Val Lys Gly Arg Ile Thr Ile Ser Arg Asp Asp Ser Lys Asn Thr Phe Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Gly Ser His Tyr Phe Gly His Trp His Phe Ala Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys - 76gg -Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gin Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gin Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gin Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 44 <211> 453 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 44 Gin Val Gin Leu Val Gin Ser Gly Ala Glu Val Lys Lys Pro Gly Ala Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Ser Met Tyr Trp Leu Glu Trp Val Arg Gin Ala Pro Gly His Gly Leu Glu Trp Val Gly Glu Ile Ser Pro Gly Thr Phe Thr Thr Asn Tyr Asn Glu Lys Phe Lys Ala Arg Ala Thr Phe Thr Ala Asp Thr Ser Thr Asn Thr Ala Tyr Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Phe Ser His Phe Ser Gly Ser Asn Tyr Asp Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr - 76hh -Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys - 76ii -Ser Arg Trp Gin Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 45 <211> 1042 <212> DNA
<213> Homo sapiens <220>
<221> Unsure <222> 447 <223> N is T or G
<400> 45 tttcctcact gactataaaa gaatagagaa ggaagggctt cagtgaccgg 50 ctgcctggct gacttacagc agtcagactc tgacaggatc atggctatga 100 tggaggtcca ggggggaccc agcctgggac agacctgcgt gctgatcgtg 150 atcttcacag tgctcctgca gtctctctgt gtggctgtaa cttacgtgta 200 ctttaccaac gagctgaagc agatgcagga caagtactcc aaaagtggca 250 ttgcttgttt cttaaaagaa gatgacagtt attgggaccc caatgacgaa 300 gagagtatga acagcccctg ctggcaagtc aagtggcaac tccgtcagct 350 cgttagaaag atgattttga gaacctctga ggaaaccatt tctacagttc 400 aagaaaagca acaaaatatt tctcccctag tgagagaaag aggtccncag 450 agagtagcag ctcacataac tgggaccaga ggaagaagca acacattgtc 500 ttctccaaac tccaagaatg aaaaggctct gggccgcaaa ataaactcct 550 gggaatcatc aaggagtggg cattcattcc tgagcaactt gcacttgagg 600 aatggtgaac tggtcatcca tgaaaaaggg ttttactaca tctattccca 650 aacatacttt cgatttcagg aggaaataaa agaaaacaca aagaacgaca 700 aacaaatggt ccaatatatt tacaaataca caagttatcc tgaccctata 750 ttgttgatga aaagtgctag aaatagttgt tggtctaaag atgcagaata 800 tggactctat tccatctatc aagggggaat atttgagctt aaggaaaatg 850 acagaatttt tgtttctgta acaaatgagc acttgataga catggaccat 900 gaagccagtt ttttcggggc ctttttagtt ggctaactga cctggaaaga 950 aaaagcaata acctcaaagt gactattcag ttttcaggat gatacactat 1000 -76jj-gaagatgttt caaaaaatct gaccaaaaca aacaaacaga as 1042 <210> 46 <211> 281 <212> PRT
<213> Homo sapiens <400> 46 Met Ala Met Met Glu Val Gln Gly Gly Pro Ser Leu Gly Gln Thr Cys Val Leu Ile Val Ile Phe Thr Val Leu Leu Gln Ser Leu Cys Val Ala Val Thr Tyr Val Tyr Phe Thr Asn Glu Leu Lys Gln Met Gln Asp Lys Tyr Ser Lys Ser Gly Ile Ala Cys Phe Leu Lys Glu Asp Asp Ser Tyr Trp Asp Pro Asn Asp Glu Glu Ser Met Asn Ser Pro Cys Trp Gln Val Lys Trp Gln Leu Arg Gln Leu Val Arg Lys Met Ile Leu Arg Thr Ser Glu Glu Thr Ile Ser Thr Val Gln Glu Lys Gln Gin Asn Ile Ser Pro Leu Val Arg Glu Arg Gly Pro Gln Arg Val Ala Ala His Ile Thr Gly Thr Arg Gly Arg Ser Asn Thr Leu Ser Ser Pro Asn Ser Lys Asn Glu Lys Ala Leu Gly Arg Lys Ile Asn Ser Trp Glu Ser Ser Arg Ser Gly His Ser Phe Leu Ser Asn Leu His Leu Arg Asn Gly Glu Leu Val Ile His Glu Lys Gly Phe Tyr Tyr Ile Tyr Ser Gln Thr Tyr Phe Arg Phe Gln Glu Glu Ile Lys Glu Asn Thr Lys Asn Asp Lys Gln Met Val Gln Tyr Ile Tyr Lys Tyr Thr Ser Tyr Pro Asp Pro Ile Leu Leu Met Lys Ser Ala Arg Asn Ser Cys Trp Ser Lys Asp Ala Glu Tyr Gly Leu Tyr Ser Ile Tyr Gln Gly Gly Ile Phe Glu Leu Lys Glu Asn Asp Arg - 76kk -Ile Phe Val Ser Val Thr Asn Glu His Leu Ile Asp Met Asp His Glu Ala Ser Phe Phe Gly Ala Phe Leu Val Gly <210> 47 <211> 411 <212> PRT
<213> Homo sapiens <220>
<221> Xaa <222> 410 <223> Xaa is L or M.
<400> 47 Met Glu Gln Arg Gly Gln Asn Ala Pro Ala Ala Ser Gly Ala Arg Lys Arg His Gly Pro Gly Pro Arg Glu Ala Arg Gly Ala Arg Pro Gly Leu Arg Val Pro Lys Thr Leu Val Leu Val Val Ala Ala Val Leu Leu Leu Val Ser Ala Glu Ser Ala Leu Ile Thr Gln Gln Asp Leu Ala Pro Gln Gln Arg Ala Ala Pro Gln Gln Lys Arg Ser Ser Pro Ser Glu Gly Leu Cys Pro Pro Gly His His Ile Ser Glu Asp Gly Arg Asp Cys Ile Ser Cys Lys Tyr Gly Gln Asp Tyr Ser Thr His Trp Asn Asp Leu Leu Phe Cys Leu Arg Cys Thr Arg Cys Asp Ser Gly Glu Val Glu Leu Ser Pro Cys Thr Thr Thr Arg Asn Thr Val Cys Gln Cys Glu Glu Gly Thr Phe Arg Glu Glu Asp Ser Pro Glu Met Cys Arg Lys Cys Arg Thr Gly Cys Pro Arg Gly Met Val Lys Val Gly Asp Cys Thr Pro Trp Ser Asp Ile Glu Cys Val His Lys Glu Ser Gly Ile Ile Ile Gly Val Thr Val Ala Ala Val Val Leu Ile Val Ala Val Phe Val Cys Lys Ser Leu Leu Trp Lys Lys Val Leu Pro Tyr Leu Lys Giy Ile Cys Ser Gly Gly Gly Gly Asp Pro Glu Arg Val Asp Arg Ser Ser Gln Arg Pro Gly Ala Glu Asp Asn Val Leu Asn Glu Ile Val Ser Ile Leu Gln Pro Thr Gln Val Pro Glu Gln Glu Met Glu Val Gln Glu Pro Ala Glu Pro Thr Gly Val Asn Met Leu Ser Pro Gly Glu Ser Glu His Leu Leu Glu Pro Ala Glu Ala Glu Arg Ser Gln Arg Arg Arg Leu Leu Val Pro Ala Asn Glu Gly Asp Pro Thr Glu Thr Leu Arg Gln Cys Phe Asp Asp Phe Ala Asp Leu Val Pro Phe Asp Ser Trp Glu Pro Leu Met Arg Lys Leu Gly Leu Met Asp Asn Glu Ile Lys Val Ala Lys Ala Glu Ala Ala Gly His Arg Asp Thr Leu Tyr Thr Met Leu Ile Lys Trp Val Asn Lys Thr Gly Arg Asp Ala Ser Val His Thr Leu Leu Asp Ala Leu Glu Thr Leu Gly Glu Arg Leu Ala Lys Gln Lys Ile Glu Asp His Leu Leu Ser Ser Gly Lys Phe Met Tyr Leu Glu Gly Asn Ala Asp Ser Ala Xaa Ser <210> 48 <211> 1799 <212> DNA
<213> Homo sapiens <400> 48 cccacgcgtc cgcataaatc agcacgcggc cggagaaccc cgcaatctct 50 gcgcccacaa aatacaccga cgatgcccga tctactttaa gggctgaaac 100 ccacgggcct gagagactat aagagcgttc cctaccgcca tggaacaacg 150 gggacagaac gccccggccg cttcgggggc ccggaaaagg cacggcccag 200 gacccaggga ggcgcgggga gccaggcctg ggctccgggt ccccaagacc 250 cttgtgctcg ttgtcgccgc ggtcctgctg ttggtctcag ctgagtctgc 300 - 76mm -tctgatcacc caacaagacc tagctcccca gcagagagcg gccccacaac 350 aaaagaggtc cagcccctca gagggattgt gtccacctgg acaccatatc 400 tcagaagacg gtagagattg catctcctgc aaatatggac aggactatag 450 cactcactgg aatgacctcc ttttctgctt gcgctgcacc aggtgtgatt 500 caggtgaagt ggagctaagt ccctgcacca cgaccagaaa cacagtgtgt 550 cagtgcgaag aaggcacctt ccgggaagaa gattctcctg agatgtgccg 600 gaagtgccgc acagggtgtc ccagagggat ggtcaaggtc ggtgattgta 650 caccctggag tgacatcgaa tgtgtccaca aagaatcagg catcatcata 700 ggagtcacag ttgcagccgt agtcttgatt gtggctgtgt ttgtttgcaa 750 gtctttactg tggaagaaag tccttcctta cctgaaaggc atctgctcag 800 gtggtggtgg ggaccctgag cgtgtggaca gaagctcaca acgacctggg 850 gctgaggaca atgtcctcaa tgagatcgtg agtatcttgc agcccaccca 900 ggtccctgag caggaaatgg aagtccagga gccagcagag ccaacaggtg 950 tcaacatgtt gtcccccggg gagtcagagc atctgctgga accggcagaa 1000 gctgaaaggt ctcagaggag gaggctgctg gttccagcaa atgaaggtga 1050 tcccactgag actctgagac agtgcttcga tgactttgca gacttggtgc 1100 cctttgactc ctgggagccg ctcatgagga agttgggcct catggacaat 1150 gagataaagg tggctaaagc tgaggcagcg ggccacaggg acaccttgta 1200 cacgatgctg ataaagtggg tcaacaaaac cgggcgagat gcctctgtcc 1250 acaccctgct ggatgccttg gagacgctgg gagagagact tgccaagcag 1300 aagattgagg accacttgtt gagctctgga aagttcatgt atctagaagg 1350 taatgcagac tctgccwtgt cctaagtgtg attctcttca ggaagtgaga 1400 ccttccctgg tttacctttt ttctggaaaa agcccaactg gactccagtc 1450 agtaggaaag tgccacaatt gtcacatgac cggtactgga agaaactctc 1500 ccatccaaca tcacccagtg gatggaacat cctgtaactt ttcactgcac 1550 ttggcattat ttttataagc tgaatgtgat aataaggaca ctatggaaat 1600 gtctggatca ttccgtttgt gcgtactttg agatttggtt tgggatgtca 1650 ttgttttcac agcacttttt tatcctaatg taaatgcttt atttatttat 1700 ttgggctaca ttgtaagatc catctacaaa aaaaaaaaaa aaaaaaaaag 1750 ggcggccgcg actctagagt cgacctgcag aagcttggcc gccatggcc 1799 - 76nn -<210> 49 <211> 440 <212> PRT
<213> Homo sapiens <400> 49 Met Glu Gln Arg Gly Gln Asn Ala Pro Ala Ala Ser Gly Ala Arg Lys Arg His Gly Pro Gly Pro Arg Glu Ala Arg Gly Ala Arg Pro Gly Pro Arg Val Pro Lys Thr Leu Val Leu Val Val Ala Ala Val Leu Leu Leu Val Ser Ala Glu Ser Ala Leu Ile Thr Gln Gln Asp Leu Ala Pro Gin Gln Arg Ala Ala Pro Gln Gln Lys Arg Ser Ser Pro Ser Glu Gly Leu Cys Pro Pro Gly His His Ile Ser Glu Asp Gly Arg Asp Cys Ile Ser Cys Lys Tyr Gly Gln Asp Tyr Ser Thr His Trp Asn Asp Leu Leu Phe Cys Leu Arg Cys Thr Arg Cys Asp Ser Gly Glu Val Glu Leu Ser Pro Cys Thr Thr Thr Arg Asn Thr Val Cys Gln Cys Glu Glu Gly Thr Phe Arg Glu Glu Asp Ser Pro Glu Met Cys Arg Lys Cys Arg Thr Gly Cys Pro Arg Gly Met Val Lys Val Gly Asp Cys Thr Pro Trp Ser Asp Ile Glu Cys Val His Lys Glu Ser Gly Thr Lys His Ser Gly Glu Ala Pro Ala Val Glu Glu Thr Val Thr Ser Ser Pro Gly Thr Pro Ala Ser Pro Cys Ser Leu Ser Gly Ile Ile Ile Gly Val Thr Val Ala Ala Val Val Leu Ile Val Ala Val Phe Val Cys Lys Ser Leu Leu Trp Lys Lys Val Leu Pro Tyr Leu Lys Gly Ile Cys Ser Gly Gly Gly Gly Asp Pro Glu Arg Val Asp Arg Ser Ser Gln Arg Pro Gly Ala Glu Asp Asn - 76oo -Val Leu Asn Glu Ile Val Ser Ile Leu Gln Pro Thr Gln Val Pro Glu Gln Glu Met Glu Val Gln Glu Pro Ala Glu Pro Thr Gly Val Asn Met Leu Ser Pro Gly Glu Ser Glu His Leu Leu Glu Pro Ala Glu Ala Glu Arg Ser Gln Arg Arg Arg Leu Leu Val Pro Ala Asn Glu Gly Asp Pro Thr Glu Thr Leu Arg Gln Cys Phe Asp Asp Phe Ala Asp Leu Val Pro Phe Asp Ser Trp Glu Pro Leu Met Arg Lys Leu Gly Leu Met Asp Asn Glu Ile Lys Val Ala Lys Ala Glu Ala Ala Gly His Arg Asp Thr Leu Tyr Thr Met Leu Ile Lys Trp Val Asn Lys Thr Gly Arg Asp Ala Ser Val His Thr Leu Leu Asp Ala Leu Glu Thr Leu Gly Glu Arg Leu Ala Lys Gln Lys Ile Glu Asp His Leu Leu Ser Ser Gly Lys Phe Met Tyr Leu Glu Gly Asn Ala Asp Ser Ala Met Ser <210> 50 <211> 1323 <212> DNA
<213> Homo sapiens <400> 50 atggaacaac ggggacagaa cgccccggcc gcttcggggg cccggaaaag 50 gcacggccca ggacccaggg aggcgcgggg agccaggcct gggcccaggg 100 tccccaagac ccttgtgctc gttgtcgccg cggtcctgct gttggtctca 150 gctgagtctg ctctgatcac ccaagaagac ctagctcccc agcagagagc 200 ggccccacaa caaaagaggt ccagcccctc agagggattg tgtccacctg 250 gacaccatat ctcagaagac ggtagagatt gcatctcctg caaatatgga 300 caggactata gcactcactg gaatgacctc cttttctgct tgcgctgcac 350 caggtgtgat tcaggtgaag tggagctaag tccgtgcacc acgaccagaa 400 acacagtgtg tcagtgcgaa gaaggcacct tccgggaaga agattctcct 450 - 76pp -gagatgtgcc ggaagtgccg cacagggtgt cccagaggga tggtcaaggt 500 cggtgattgt acaccctgga gtgacatcga atgtgtccac aaagaatcag 550 gtacaaagca cagtggggaa gccccagctg tggaggagac ggtgacctcc 600 agcccaggga ctcctgcctc tccctgttct ctctcaggca tcatcatagg 650 agtcacagtt gcagccgtag tcttgattgt ggctgtgttt gtttgcaagt 700 ctttactgtg gaagaaagtc cttccttacc tgaaaggcat ctgctcaggt 750 ggtggtgggg accctgagcg tgtggacaga agctcacaac gacctggggc 800 tgaggacaat gtcctcaatg agatcgtgag tatcttgcag cccacccagg 850 tccctgagca ggaaatggaa gtccaggagc cagcagagcc aacaggtgtc 900 aacatgttgt cccccgggga gtcagagcat ctgctggaac cggcagaagc 950 tgaaaggtct cagaggagga ggctgctggt tccagcaaat gaaggtgatc 1000 ccactgagac tctgagacag tgcttcgatg actttgcaga cttggtgccc 1050 tttgactcct gggagccgct catgaggaag ttgggcctca tggacaatga 1100 gataaaggtg gctaaagctg aggcagcggg ccacagggac accttgtaca 1150 cgatgctgat aaagtgggtc aacaaaaccg ggcgagatgc ctctgtccac 1200 accctgctgg atgccttgga gacgctggga gagagacttg ccaagcagaa 1250 gattgaggac cacttgttga gctctggaaa gttcatgtat ctagaaggta 1300 atgcagactc tgccatgtcc taa 1323 <210> 51 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 51 Glu Val Gln Leu Val Gln Ser Gly Gly Gly Val Glu Arg Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Gly Ile Asn Trp Gln Gly Gly Ser Thr Gly Tyr Ala Asp Ser Val Lys Gly Arg Val Thr Ile Ser Arg Asp Asn Ala - 76qq -Lys Asn Ser Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Ile Leu Gly Ala Gly Arg Gly Trp Tyr Phe Asp Tyr Trp Gly Lys Gly Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly - 76rr -Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gin Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gin Gin Gly Asn Val Phe Ser Cys Ser Val Net His Glu Ala Leu His Asn His Tyr Thr Gin Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 52 <211> 213 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 52 Ser Glu Leu Thr Gin Asp Pro Ala Val Ser Val Ala Leu Gly Gin Thr Val Arg Ile Thr Cys Ser Gly Asp Ser Leu Arg Ser Tyr Tyr Ala Ser Trp Tyr Gin Gin Lys Pro Gly Gin Ala Pro Val Leu Val Ile Tyr Gly Ala Asn Asn Arg Pro Ser Gly Ile Pro Asp Arg Phe Ser Gly Ser Ser Ser Gly Asn Thr Ala Ser Leu Thr Ile Thr Gly Ala Gin Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Asn Ser Ala Asp Ser Ser Gly Asn His Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly Gin Pro Lys Ala Ala Pro Ser Val Thr Leu Phe Pro Pro Ser Ser Glu Glu Leu Gin Ala Asn Lys Ala Thr Leu Val Cys Leu Ile Ser Asp Phe Tyr Pro Gly Ala Val Thr Val Ala Trp Lys Ala Asp Ser Ser Pro Val Lys Ala Gly Val Glu Thr Thr Thr Pro - 76ss -Ser Lys Gin Ser Asn Asn Lys Tyr Ala Ala Ser Ser Tyr Leu Ser Leu Thr Pro Glu Gin Trp Lys Ser His Lys Ser Tyr Ser Cys Gin Val Thr His Glu Gly Ser Thr Val Glu Lys Thr Val Ala Pro Thr Glu Cys Ser <210> 53 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 53 Glu Val Gin Leu Val Gin Her Gly Gly Gly Val Glu Arg Pro Gly Gly Her Leu Arg Leu Her Cys Ala Ala Her Gly Phe Thr Phe Asp Asp Tyr Gly Met Her Trp Val Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Gly Ile Asn Trp Asn Gly Gly Her Thr G1y Tyr Ala Asp Her Val Lys Gly Arg Val Thr Ile Her Arg Asp Asn Ala Lys Asn Her Leu Tyr Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Ile Leu Gly Ala Gly Arg Gly Trp Tyr Phe Asp Leu Trp Gly Lys Gly Thr Thr Val Thr Val Her Her Ala Her Thr Lys Gly Pro Her Val Phe Pro Leu Ala Pro Her Her Lys Her Thr Her Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Her Trp Asn Her Gly Ala Leu Thr Her Gly Val His Thr Phe Pro Ala Val Leu Gin Her Her Gly Leu Tyr Her Leu Her Her Val Val Thr Val Pro Her Ser - 76tt -Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gin Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 54 <211> 213 <212> PRT
<213> Artificial sequence <220>
- 76uu -<223> Sequence is synthesized.
<400> 54 Her Glu Leu Thr Gln Asp Pro Ala Val Her Val Ala Leu Gly Gln Thr Val Arg Ile Thr Cys Gln Gly Asp Her Leu Arg Her Tyr Tyr Ala Her Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Val Leu Val Ile Tyr Gly Lys Asn Asn Arg Pro Her Gly Ile Pro Asp Arg Phe Her Gly Her Her Her Gly Asn Thr Ala Her Leu Thr Ile Thr Gly Ala Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Asn Her Arg Asp Her Her Gly Asn His Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly Gln Pro Lys Ala Ala Pro Her Val Thr Leu Phe Pro Pro Ser Ser Glu Glu Leu Gln Ala Asn Lys Ala Thr Leu Val Cys Leu Ile Her Asp Phe Tyr Pro Gly Ala Val Thr Val Ala Trp Lys Ala Asp Her Her Pro Val Lys Ala Gly Val Glu Thr Thr Thr Pro Her Lys Gln Her Asn Asn Lys Tyr Ala Ala Her Her Tyr Leu Her Leu Thr Pro Glu Gln Trp Lys Her His Lys Her Tyr Her Cys Gln Val Thr His Glu Gly Her Thr Val Glu Lys Thr Val Ala Pro Thr Glu Cys Her <210> 55 <211> 126 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 55 Glu Val Gln Leu Val Gln Her Gly Gly Gly Val Glu Arg Pro Gly - 76w -Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr Ala Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Gly Ile Asn Trp Gln Gly Gly Ser Thr Gly Tyr Ala Asp Ser Val Lys Gly Arg Val Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Lys Ile Leu Gly Ala Gly Arg Gly Trp Tyr Phe Asp Tyr Trp Gly Lys Gly Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro <210> 56 <211> 108 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 56 Ser Glu Leu Thr Gln Asp Pro Ala Val Ser Val Ala Leu Gly Gln Thr Val Arg Ile Thr Cys Ser Gly Asp Ser Leu Arg Ser Tyr Tyr Ala Ser Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Val Leu Val Ile Tyr Gly Ala Asn Asn Arg Pro Ser Gly Ile Pro Asp Arg Phe Ser Gly Ser Ser Ser Gly Asn Thr Ala Ser Leu Thr Ile Thr Gly Ala Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Asn Ser Ala Asp Ser Ser Gly Asn His Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly <210> 57 <211> 10 <212> PRT
- 76ww -<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 57 Arg Ala Ser Ser Ser Val Ser Tyr Met His <210> 58 <211> 7 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 58 Ala Pro Ser Asn Leu Ala Ser <210> 59 <211> 9 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 59 Gin Gin Trp Ser Phe Asn Pro Pro Thr <210> 60 <211> 10 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 60 Gly Tyr Thr Phe Thr Ser Tyr Asn Met His <210> 61 <211> 17 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 61 Ala Ile Tyr Pro Gly Asn Gly Asp Thr Ser Tyr Asn Gln Lys Phe Lys Gly - 76xx -<210> 62 <211> 13 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 62 Val Val Tyr Tyr Ser Asn Her Tyr Trp Tyr Phe Asp Val <210> 63 <211> 213 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 63 Asp Ile Gin Met Thr Gln Her Pro Her Her Leu Her Ala Her Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Her Her Ser Val Her Tyr Met His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Pro Leu Ile Tyr Ala Pro Her Asn Leu Ala Her Gly Val Pro Her Arg Phe Her Gly Her Gly Her Gly Thr Asp Phe Thr Leu Thr Ile Her Her Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Trp Ser Phe Asn Pro Pro Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Her Val Phe Ile Phe Pro Pro Her Asp Glu Gln Leu Lys Ser Gly Thr Ala Her Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Her Gln Glu Her Val Thr Glu Gln Asp Her Lys Asp Her Thr Tyr Ser Leu Ser Her Thr Leu Thr Leu Her Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val - 76yy -Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys <210> 64 <211> 213 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 64 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Ser Ser Val Ser Tyr Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Pro Leu Ile Tyr Ala Pro Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Trp Ala Phe Asn Pro Pro Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys - 76zz -<210> 65 <211> 452 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 65 Glu Val Gln Leu Val Glu Her Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Thr Her Tyr Asn Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Ala Ile Tyr Pro Gly Asn Gly Asp Thr Ser Tyr Asn Gln Lys Phe Lys Gly Arg Phe Thr Ile Ser Val Asp Lys Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Val Tyr Tyr Her Asn Her Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Her Thr Lys Gly Pro Her Val Phe Pro Leu Ala Pro Her Her Lys Ser Thr Her Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Her Trp Asn Her Gly Ala Leu Thr Her Gly Val His Thr Phe Pro Ala Val Leu Gln Her Her Gly Leu Tyr Her Leu Her Her Val Val Thr Val Pro Her Her Her Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Her Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Her Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Her Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr - 76aaa -Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 66 <211> 452 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 66 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Asn Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu - 76bbb -Glu Trp Val Gly Ala Ile Tyr Pro Gly Asn Gly Ala Thr Ser Tyr Asn Gln Lys Phe Lys Gly Arg Phe Thr Ile Ser Val Asp Lys Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Val Tyr Tyr Ser Tyr Arg Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ala Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Ala Ala Leu Pro Ala Pro Ile Ala Ala Thr Ile Ser Lys Ala Lys - 76ccc -Gly Gin Pro Arg Glu Pro Gin Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gin Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys <210> 67 <211> 10 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<220>
<221> Xaa <222> 9 <223> Xaa is M or L.
<400> 67 Arg Ala Ser Ser Ser Val Ser Tyr Xaa His <210> 68 <211> 9 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<220>
<221> Xaa <222> 4 <223> Xaa is S or A.
<400> 68 Gln Gln Trp Xaa Phe Asn Pro Pro Thr <210> 69 <211> 17 - 76ddd -<212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<220>
<221> Xaa <222> 8 <223> Xaa is D or A.
<400> 69 Ala Ile Tyr Pro Giy Asn Gly Xaa Thr Ser Tyr Asn Gln Lys Phe Lys Gly <210> 70 <211> 13 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<220>
<221> Xaa <222> 6 <223> Xaa is N, A, Y, W or D.
<220>
<221> Xaa <222> 7 <223> Xaa is S or R.
<400> 70 Val Val Tyr Tyr Ser Xaa Xaa Tyr Trp Tyr Phe Asp Val <210> 71 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 71 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Asn Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Ala Ile Tyr Pro Gly Asn Gly Asp Thr Ser Tyr - 76eee -Asn Gln Lys Phe Lys Gly Arg Phe Thr Ile Ser Val Asp Lys Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Val Tyr Tyr Ser Asn Ser Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg - 76fff -Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly <210> 72 <211> 451 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 72 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Asn Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Ala Ile Tyr Pro Gly Asn Gly Ala Thr Ser Tyr Asn Gln Lys Phe Lys Gly Arg Phe Thr Ile Ser Val Asp Lys Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Val Tyr Tyr Ser Tyr Arg Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu - 76ggg -Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ala Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Ala Ala Leu Pro Ala Pro Ile Ala Ala Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn G1y Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro - 76hhh -Gly <210> 73 <211> 107 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 73 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Ser Ser Val Ser Tyr Leu His Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Pro Leu Ile Tyr Ala Pro Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Trp Ala Phe Asn Pro Pro Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg <210> 74 <211> 122 <212> PRT
<213> Artificial sequence <220>
<223> Sequence is synthesized.
<400> 74 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Phe Thr Ser Tyr Asn Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Gly Ala Ile Tyr Pro Gly Asn Gly Ala Thr Ser Tyr Asn Gln Lys Phe Lys Gly Arg Phe Thr Ile Ser Val Asp Lys Ser - 76iii -Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Val Val Tyr Tyr Ser Tyr Arg Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
Claims (7)
1. A pharmaceutical formulation comprising pertuzumab at a concentration from 20mg/mL to 40mg/mL, histidine-acetate buffer at a concentration from 10mM to 40mM, sucrose at a concentration from 60 mM to 250 mM, and polysorbate 20 at a concentration from 0.0 1% to 0.1%, wherein the pH of the formulation is from 5.5 to 6.5, and wherein the pertuzumab comprises variable light and variable heavy amino acid sequences shown as SEQ
ID NOs: 3 and 4 respectively.
ID NOs: 3 and 4 respectively.
2. The pharmaceutical formulation according to claim 1, wherein the pertuzumab comprises a light chain amino acid sequence shown as SEQ ID NO: 15 and a heavy chain amino acid sequence shown as SEQ ID NO: 16.
3. The pharmaceutical formulation according to claim 1 or 2, wherein the pH of said formulation is from 5.8 to 6.2.
4. The pharmaceutical formulation according to any one of claims 1 to 3, wherein the formulation comprises 30mg/mL pertuzumab, 20mM histidine-acetate, 120mM
sucrose, and 0.02% polysorbate 20, wherein the pH of the formulation is 6Ø
sucrose, and 0.02% polysorbate 20, wherein the pH of the formulation is 6Ø
5. The pharmaceutical formulation according any one of claims 1 to 4 for use in treatment of a cancer.
6. The pharmaceutical formulation for use according to claim 5, wherein the cancer is a HER2-expressing cancer.
7. Use of the pharmaceutical formulation of any one of claims 1 to 4 for treating a cancer in a subject.
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US62041304P | 2004-10-20 | 2004-10-20 | |
| US60/620,413 | 2004-10-20 | ||
| PCT/US2005/037471 WO2006044908A2 (en) | 2004-10-20 | 2005-10-19 | Antibody formulation in histidine-acetate buffer |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CA2579861A1 CA2579861A1 (en) | 2006-04-27 |
| CA2579861C true CA2579861C (en) | 2012-12-18 |
Family
ID=36203665
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CA2579861A Expired - Lifetime CA2579861C (en) | 2004-10-20 | 2005-10-19 | Formulation of pertuzumab in a histidine-acetate buffer |
Country Status (34)
| Country | Link |
|---|---|
| US (7) | US20060088523A1 (en) |
| EP (3) | EP1802344B1 (en) |
| JP (4) | JP5025482B2 (en) |
| KR (1) | KR101243590B1 (en) |
| CN (2) | CN102319430A (en) |
| AU (1) | AU2005295394B2 (en) |
| BR (1) | BRPI0516299B8 (en) |
| CA (1) | CA2579861C (en) |
| CR (1) | CR9129A (en) |
| DK (1) | DK1802344T3 (en) |
| EC (1) | ECSP077308A (en) |
| ES (1) | ES2389911T3 (en) |
| GT (1) | GT200500298A (en) |
| HR (1) | HRP20120893T1 (en) |
| IL (3) | IL181738A (en) |
| JO (1) | JO3000B1 (en) |
| MA (1) | MA29014B1 (en) |
| MY (1) | MY146100A (en) |
| NO (1) | NO343683B1 (en) |
| NZ (1) | NZ553625A (en) |
| PA (1) | PA8650001A1 (en) |
| PE (2) | PE20061043A1 (en) |
| PL (1) | PL1802344T3 (en) |
| PT (1) | PT1802344E (en) |
| RS (1) | RS52512B (en) |
| RU (2) | RU2426554C2 (en) |
| SG (1) | SG196859A1 (en) |
| SI (1) | SI1802344T1 (en) |
| SV (1) | SV2006002275A (en) |
| TN (1) | TNSN07088A1 (en) |
| TW (1) | TWI394582B (en) |
| UA (1) | UA89798C2 (en) |
| WO (1) | WO2006044908A2 (en) |
| ZA (1) | ZA200702521B (en) |
Families Citing this family (851)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ZA9811162B (en) | 1997-12-12 | 2000-06-07 | Genentech Inc | Treatment with anti-ERBB2 antibodies. |
| US20030086924A1 (en) * | 1999-06-25 | 2003-05-08 | Genentech, Inc. | Treatment with anti-ErbB2 antibodies |
| US6949245B1 (en) * | 1999-06-25 | 2005-09-27 | Genentech, Inc. | Humanized anti-ErbB2 antibodies and treatment with anti-ErbB2 antibodies |
| US20040013667A1 (en) * | 1999-06-25 | 2004-01-22 | Genentech, Inc. | Treatment with anti-ErbB2 antibodies |
| US20030228309A1 (en) * | 2000-11-08 | 2003-12-11 | Theodora Salcedo | Antibodies that immunospecifically bind to TRAIL receptors |
| US20060062786A1 (en) * | 2000-11-08 | 2006-03-23 | Human Genome Sciences, Inc. | Antibodies that immunospecifically bind to TRAIL receptors |
| ATE446317T1 (en) | 2001-05-11 | 2009-11-15 | Ludwig Inst For Cancer Res Ltd | SPECIFIC BINDING PROTEINS AND THEIR USE |
| US20100056762A1 (en) | 2001-05-11 | 2010-03-04 | Old Lloyd J | Specific binding proteins and uses thereof |
| US7348003B2 (en) | 2001-05-25 | 2008-03-25 | Human Genome Sciences, Inc. | Methods of treating cancer using antibodies that immunospecifically bind to TRAIL receptors |
| US20050214209A1 (en) * | 2001-05-25 | 2005-09-29 | Human Genome Sciences, Inc. | Antibodies that immunospecifically bind to TRAIL receptors |
| US20050129616A1 (en) * | 2001-05-25 | 2005-06-16 | Human Genome Sciences, Inc. | Antibodies that immunospecifically bind to TRAIL receptors |
| US7361341B2 (en) * | 2001-05-25 | 2008-04-22 | Human Genome Sciences, Inc. | Methods of treating cancer using antibodies that immunospecifically bind to trail receptors |
| CN1610696A (en) * | 2001-12-20 | 2005-04-27 | 人体基因组科学有限公司 | Antibodies that immunospecifically bind to TRAIL receptors |
| US7229617B2 (en) * | 2002-11-27 | 2007-06-12 | Irm Llc | Methods and compositions for inducing apoptosis in cancer cells |
| GEP20094629B (en) | 2003-03-19 | 2009-03-10 | Biogen Idec Inc | Nogo receptor binding protein |
| CN1980957A (en) | 2004-03-23 | 2007-06-13 | 比奥根艾迪克Ma公司 | Receptor coupling agents and therapeutic uses thereof |
| SV2006002143A (en) * | 2004-06-16 | 2006-01-26 | Genentech Inc | USE OF AN ANTIBODY FOR THE TREATMENT OF CANCER RESISTANT TO PLATINUM |
| PT1776136E (en) | 2004-06-24 | 2012-12-05 | Biogen Idec Inc | Treatment of conditions involving demyelination |
| KR20180004850A (en) | 2004-07-22 | 2018-01-12 | 제넨테크, 인크. | Her2 antibody composition |
| JO3000B1 (en) | 2004-10-20 | 2016-09-05 | Genentech Inc | Antibody Formulations. |
| ZA200704796B (en) * | 2004-12-07 | 2008-11-26 | Genentech Inc | Selecting patients for therapy with a HER inhibitor |
| PL1846030T3 (en) * | 2005-01-21 | 2019-05-31 | Genentech Inc | Fixed dosing of her antibodies |
| US8029783B2 (en) * | 2005-02-02 | 2011-10-04 | Genentech, Inc. | DR5 antibodies and articles of manufacture containing same |
| EP3195879A1 (en) * | 2005-02-23 | 2017-07-26 | Genentech, Inc. | Extending time to disease progression or survival in cancer patients |
| NZ561137A (en) * | 2005-03-08 | 2011-09-30 | Pharmacia & Upjohn Co Llc | Stable anti-CTLA-4 antibody compositions with chelating agents |
| BRPI0613387A2 (en) | 2005-07-08 | 2011-01-11 | Biogen Idec Inc | isolated antibody or antigen binding fragment thereof and its use, isolated polynucleotide, composition, vector, host cell, anti-sp35 antibody and method for producing the same, isolated polypeptide, in vitro method for reducing inhibition of axonal growth and in vitro method for inhibiting cone collapse growth |
| PE20070207A1 (en) | 2005-07-22 | 2007-03-09 | Genentech Inc | COMBINED TREATMENT OF TUMORS THAT EXPRESS HER |
| BRPI0614850A2 (en) * | 2005-08-19 | 2011-04-19 | Centocor Inc | proteolysis resistant antibody preparations |
| US20070212397A1 (en) * | 2005-09-15 | 2007-09-13 | Roth Daniel B | Pharmaceutical delivery device and method for providing ocular treatment |
| EP2543384A3 (en) | 2005-12-02 | 2013-04-10 | Biogen Idec MA Inc. | Treatment of conditions involving demyelination |
| KR101398713B1 (en) | 2005-12-20 | 2014-06-12 | 브리스톨-마이어스 스큅 컴퍼니 | Compositions and methods for producing a composition |
| AR058568A1 (en) | 2005-12-20 | 2008-02-13 | Bristol Myers Squibb Co | METHODS TO PRODUCE A COMPOSITION WITH CTLA4-IG MOLECULES FROM A CROP MEANS |
| NZ569108A (en) | 2005-12-20 | 2011-09-30 | Bristol Myers Squibb Co | Formulations of CTLA4Ig stabilised using sugars |
| US9309316B2 (en) | 2005-12-20 | 2016-04-12 | Bristol-Myers Squibb Company | Stable subcutaneous protein formulations and uses thereof |
| MX2008016344A (en) | 2006-06-21 | 2009-02-12 | Ge Healthcare Ltd | Radiopharmaceutical products. |
| KR101546441B1 (en) | 2006-12-20 | 2015-08-24 | 엠엠알글로벌, 인코포레이티드 | Antibodies and methods for making and using them |
| AU2013202392B2 (en) * | 2006-12-20 | 2016-02-25 | Mmrglobal, Inc. | Antibodies and methods for making and using them |
| US8128926B2 (en) | 2007-01-09 | 2012-03-06 | Biogen Idec Ma Inc. | Sp35 antibodies and uses thereof |
| CN110613845B (en) | 2007-01-25 | 2025-08-26 | 达娜-法勃肿瘤研究所公司 | Use of anti-EGFR antibodies in treating diseases mediated by EGFR mutants |
| WO2008109440A2 (en) | 2007-03-02 | 2008-09-12 | Genentech, Inc. | Predicting response to a her dimerisation inhibitor based on low her3 expression |
| ES2542152T3 (en) | 2007-03-15 | 2015-07-31 | Ludwig Institute For Cancer Research Ltd. | Treatment method using EGFR antibodies and Src inhibitors and related formulations |
| BRPI0809209A2 (en) | 2007-03-29 | 2014-09-02 | Abbott Lab | CRYSTALINE IL-12 ANTI-HUMAN ANTIBODIES |
| US9283276B2 (en) | 2007-08-14 | 2016-03-15 | Ludwig Institute For Cancer Research Ltd. | Monoclonal antibody 175 targeting the EGF receptor and derivatives and uses thereof |
| KR102467302B1 (en) | 2007-09-26 | 2022-11-14 | 추가이 세이야쿠 가부시키가이샤 | Modified antibody constant region |
| EP2205071B1 (en) * | 2007-10-11 | 2015-07-22 | Biogen MA Inc. | Lingo-1 antagonists and trkb agonists for use in the treatment of glaucoma |
| WO2009061500A1 (en) * | 2007-11-08 | 2009-05-14 | Biogen Idec Ma Inc. | Use of lingo-4 antagonists in the treatment of conditions involving demyelination |
| US8883146B2 (en) | 2007-11-30 | 2014-11-11 | Abbvie Inc. | Protein formulations and methods of making same |
| CN101896163A (en) * | 2007-12-21 | 2010-11-24 | 弗·哈夫曼-拉罗切有限公司 | Antibody formulations |
| US9266967B2 (en) | 2007-12-21 | 2016-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
| US20090162359A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
| PE20091174A1 (en) | 2007-12-27 | 2009-08-03 | Chugai Pharmaceutical Co Ltd | LIQUID FORMULATION WITH HIGH CONCENTRATION OF ANTIBODY CONTENT |
| WO2009083225A2 (en) * | 2007-12-28 | 2009-07-09 | Biolnvent International Ab | Formulation |
| TWI472339B (en) | 2008-01-30 | 2015-02-11 | Genentech Inc | Composition comprising antibody that binds to domain ii of her2 and acidic variants thereof |
| US20110182888A1 (en) * | 2008-04-08 | 2011-07-28 | Peter Ordentlich | Administration of an Inhibitor of HDAC, an Inhibitor of HER-2, and a Selective Estrogen Receptor Modulator |
| AU2009241589B2 (en) | 2008-04-29 | 2013-10-10 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
| US9109026B2 (en) | 2008-06-03 | 2015-08-18 | Abbvie, Inc. | Dual variable domain immunoglobulins and uses thereof |
| EP3002299A1 (en) | 2008-06-03 | 2016-04-06 | AbbVie Inc. | Dual variable domain immunoglobulins and uses thereof |
| BRPI0812682A2 (en) | 2008-06-16 | 2010-06-22 | Genentech Inc | metastatic breast cancer treatment |
| TW201012475A (en) | 2008-07-08 | 2010-04-01 | Abbott Lab | Prostaglandin E2 dual variable domain immunoglobulins and uses thereof |
| CA2729961C (en) | 2008-07-09 | 2018-05-01 | Biogen Idec Ma Inc. | Li113, li62 variant co2, anti-lingo antibodies |
| TW201438738A (en) | 2008-09-16 | 2014-10-16 | 建南德克公司 | Method for treating progressive multiple sclerosis |
| MX2011003013A (en) * | 2008-09-19 | 2011-04-11 | Pfizer | Stable liquid antibody formulation. |
| TWI440469B (en) | 2008-09-26 | 2014-06-11 | Chugai Pharmaceutical Co Ltd | Improved antibody molecules |
| US8268314B2 (en) | 2008-10-08 | 2012-09-18 | Hoffmann-La Roche Inc. | Bispecific anti-VEGF/anti-ANG-2 antibodies |
| US20110293605A1 (en) * | 2008-11-12 | 2011-12-01 | Hasige Sathish | Antibody formulation |
| WO2010059787A1 (en) * | 2008-11-20 | 2010-05-27 | Genentech, Inc. | Therapeutic protein formulations |
| JO3672B1 (en) | 2008-12-15 | 2020-08-27 | Regeneron Pharma | High Affinity Human Antibodies to PCSK9 |
| WO2010075249A2 (en) | 2008-12-22 | 2010-07-01 | Genentech, Inc. | A method for treating rheumatoid arthritis with b-cell antagonists |
| FR2944448B1 (en) | 2008-12-23 | 2012-01-13 | Adocia | STABLE PHARMACEUTICAL COMPOSITION COMPRISING AT LEAST ONE MONODONAL ANTIBODY AND AT LEAST ONE AMPHIPHILIC POLYSACHARIDE COMPRISING SUBSTITUENTS DERIVED FROM HYDROFOB ALCOHOLS OR HYDROPHOBIC AMINES. |
| US8623395B2 (en) | 2010-01-29 | 2014-01-07 | Forsight Vision4, Inc. | Implantable therapeutic device |
| PL2391419T3 (en) | 2009-01-29 | 2019-12-31 | Forsight Vision4, Inc. | Posterior segment drug delivery |
| EP2403873A1 (en) | 2009-03-05 | 2012-01-11 | Ablynx N.V. | Novel antigen binding dimer-complexes, methods of making/avoiding and uses thereof |
| US9265834B2 (en) | 2009-03-05 | 2016-02-23 | Ablynx N.V. | Stable formulations of polypeptides and uses thereof |
| PE20120359A1 (en) * | 2009-03-06 | 2012-04-13 | Genentech Inc | FORMULATION WITH ANTIBODY |
| WO2010106812A1 (en) * | 2009-03-19 | 2010-09-23 | Chugai Seiyaku Kabushiki Kaisha | Pharmaceutical formulation containing improved antibody molecules |
| PE20120591A1 (en) | 2009-04-02 | 2012-05-23 | Roche Glycart Ag | MULTI-SPECIFIC ANTIBODIES INCLUDING FULL-LENGTH ANTIBODIES AND SINGLE-CHAIN FAB FRAGMENTS |
| EP2417156B1 (en) | 2009-04-07 | 2015-02-11 | Roche Glycart AG | Trivalent, bispecific antibodies |
| SG10201401995UA (en) * | 2009-05-04 | 2014-08-28 | Abbvie Biotechnology Ltd | Stable high protein concentration formulations of human anti-tnf-alpha-antibodies |
| US20100316639A1 (en) | 2009-06-16 | 2010-12-16 | Genentech, Inc. | Biomarkers for igf-1r inhibitor therapy |
| US9676845B2 (en) | 2009-06-16 | 2017-06-13 | Hoffmann-La Roche, Inc. | Bispecific antigen binding proteins |
| MX346002B (en) * | 2009-06-17 | 2017-03-01 | Abbvie Biotherapeutics Inc | Anti-vegf antibodies and their uses. |
| US8703132B2 (en) | 2009-06-18 | 2014-04-22 | Hoffmann-La Roche, Inc. | Bispecific, tetravalent antigen binding proteins |
| US9345661B2 (en) * | 2009-07-31 | 2016-05-24 | Genentech, Inc. | Subcutaneous anti-HER2 antibody formulations and uses thereof |
| AU2013202020B2 (en) * | 2009-07-31 | 2014-11-27 | F. Hoffmann-La Roche Ag | Subcutaneous anti-HER2 antibody formulation |
| US8221753B2 (en) | 2009-09-30 | 2012-07-17 | Tracon Pharmaceuticals, Inc. | Endoglin antibodies |
| US9884117B2 (en) * | 2009-09-03 | 2018-02-06 | Ablynx N.V. | Stable formulations of polypeptides and uses thereof |
| WO2011029823A1 (en) | 2009-09-09 | 2011-03-17 | Novartis Ag | Monoclonal antibody reactive with cd63 when expressed at the surface of degranulated mast cells |
| AR078161A1 (en) * | 2009-09-11 | 2011-10-19 | Hoffmann La Roche | VERY CONCENTRATED PHARMACEUTICAL FORMULATIONS OF AN ANTIBODY ANTI CD20. USE OF THE FORMULATION. TREATMENT METHOD |
| AU2010296018B2 (en) | 2009-09-16 | 2016-05-05 | Genentech, Inc. | Coiled coil and/or tether containing protein complexes and uses thereof |
| ES2594893T3 (en) * | 2009-12-16 | 2016-12-23 | Abbvie Biotherapeutics Inc. | Anti HER2 antibodies and their uses |
| KR101989628B1 (en) * | 2009-12-21 | 2019-06-14 | 제넨테크, 인크. | Antibody formulation |
| FR2958646B1 (en) | 2010-04-07 | 2012-05-18 | Adocia | POLYSACCHARIDES COMPRISING FUNCTIONAL CARBOXYL GROUPS SUBSTITUTED WITH A HYDROPHOBIC ACID DERIVATIVE. |
| TWI609698B (en) | 2010-01-20 | 2018-01-01 | 中外製藥股份有限公司 | Stabilized antibody-containing solution preparation |
| US10166142B2 (en) | 2010-01-29 | 2019-01-01 | Forsight Vision4, Inc. | Small molecule delivery with implantable therapeutic device |
| US9120855B2 (en) | 2010-02-10 | 2015-09-01 | Novartis Ag | Biologic compounds directed against death receptor 5 |
| CA2784211C (en) | 2010-02-18 | 2019-12-24 | Genentech, Inc. | Neuregulin antagonists and use thereof in treating cancer |
| ES2765418T3 (en) | 2010-03-01 | 2020-06-09 | Bayer Healthcare Llc | Monoclonal Antibodies Optimized Against Tissue Factor Pathway Inhibitor (TFPI) |
| JP5937059B2 (en) * | 2010-03-22 | 2016-06-22 | ジェネンテック, インコーポレイテッド | Compositions and methods useful for stabilizing protein-containing formulations |
| BR112012022044A2 (en) | 2010-03-24 | 2020-08-25 | Genentech Inc | ''antibody, immunoconjugate, pharmaceutical formulation, antibody use, treatment method, isolated bispecific antibody and host cell''. |
| AR080793A1 (en) | 2010-03-26 | 2012-05-09 | Roche Glycart Ag | BISPECIFIC ANTIBODIES |
| WO2011147834A1 (en) | 2010-05-26 | 2011-12-01 | Roche Glycart Ag | Antibodies against cd19 and uses thereof |
| JP6320753B2 (en) | 2010-05-27 | 2018-05-09 | ゲンマブ エー/エス | Monoclonal antibody against HER2 |
| CA2794731C (en) | 2010-06-18 | 2019-03-19 | Genentech, Inc. | Anti-axl antibodies and methods of use |
| WO2011161119A1 (en) | 2010-06-22 | 2011-12-29 | F. Hoffmann-La Roche Ag | Antibodies against insulin-like growth factor i receptor and uses thereof |
| MY184736A (en) * | 2010-06-24 | 2021-04-20 | Genentech Inc | Compositions and methods containing alkylglycosides for stabilizing protein-containing formulations |
| WO2011161189A1 (en) | 2010-06-24 | 2011-12-29 | F. Hoffmann-La Roche Ag | Anti-hepsin antibodies and methods of use |
| EP2399604A1 (en) * | 2010-06-25 | 2011-12-28 | F. Hoffmann-La Roche AG | Novel antibody formulation |
| JOP20190250A1 (en) * | 2010-07-14 | 2017-06-16 | Regeneron Pharma | Stable formulas containing anti-NGF antibodies |
| WO2012007495A1 (en) | 2010-07-15 | 2012-01-19 | F. Hoffmann-La Roche Ag | Antibodies specifically binding to human tslpr and methods of use |
| WO2012010582A1 (en) | 2010-07-21 | 2012-01-26 | Roche Glycart Ag | Anti-cxcr5 antibodies and methods of use |
| NZ607480A (en) | 2010-08-03 | 2014-10-31 | Abbott Lab | Dual variable domain immunoglobulins and uses thereof |
| CA2807535C (en) | 2010-08-05 | 2019-03-19 | Forsight Vision4, Inc. | Injector apparatus and method for drug delivery |
| BR112013002532A2 (en) | 2010-08-05 | 2016-05-31 | Hoffmann La Roche | anti-mhc antibody anti-viral cytokine fusion protein |
| CN103209664A (en) | 2010-08-05 | 2013-07-17 | 弗赛特影像4股份有限公司 | implantable therapeutic device |
| EP2600876B1 (en) | 2010-08-05 | 2015-04-29 | Forsight Vision4, Inc. | Combined drug delivery methods and apparatus |
| BR112013003279A2 (en) | 2010-08-13 | 2016-06-14 | Genentech In | "Methods for treating a disease, method for neutralizing or blocking il-1ß and / or il-18 activity, antibody, uses of an antibody and uses of a monoclonal antibody" |
| MX2013001336A (en) | 2010-08-13 | 2013-03-08 | Roche Glycart Ag | Anti-tenascin-c a2 antibodies and methods of use. |
| NZ703653A (en) | 2010-08-13 | 2016-09-30 | Roche Glycart Ag | Anti-fap antibodies and methods of use |
| JP5758004B2 (en) | 2010-08-24 | 2015-08-05 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Bispecific antibodies comprising Fv fragments stabilized by disulfides |
| TW201215405A (en) | 2010-08-25 | 2012-04-16 | Hoffmann La Roche | Antibodies against IL-18R1 and uses thereof |
| PH12013500337A1 (en) | 2010-08-26 | 2017-08-23 | Abbvie Inc | Dual variable domain immunoglobulins and uses thereof |
| CN103282042B (en) | 2010-09-17 | 2014-12-10 | 巴克斯特国际公司 | Immunoglobulins stabilized at mildly acidic to neutral pH by aqueous formulations with histidine |
| WO2012045703A1 (en) | 2010-10-05 | 2012-04-12 | Novartis Ag | Anti-il12rbeta1 antibodies and their use in treating autoimmune and inflammatory disorders |
| EP3354280B1 (en) | 2010-10-06 | 2020-07-29 | Regeneron Pharmaceuticals, Inc. | Stabilized formulations containing anti-interleukin-4 receptor (il-4r) antibodies |
| EP2635601B1 (en) | 2010-11-04 | 2016-07-20 | Boehringer Ingelheim International GmbH | Anti-il-23 antibodies |
| CA2815840A1 (en) | 2010-11-10 | 2012-05-18 | Genentech, Inc. | Methods and compositions for neural disease immunotherapy |
| LT2637690T (en) | 2010-11-11 | 2016-10-25 | Abbvie Biotechnology Ltd | HIGH CONCENTRATION ANTI-TNFalpha ANTIBODY LIQUID FORMULATIONS |
| US20140031769A1 (en) | 2010-11-19 | 2014-01-30 | Forsight Vision4, Inc. | Therapeutic agent formulations for implanted devices |
| US9458240B2 (en) | 2010-12-10 | 2016-10-04 | Novartis Pharma Ag | Anti-BAFFR antibody formulations |
| TWI708944B (en) | 2010-12-16 | 2020-11-01 | 美商建南德克公司 | Diagnosis and treatments relating to th2 inhibition |
| AU2011349443B2 (en) | 2010-12-20 | 2015-12-24 | Genentech, Inc. | Anti-mesothelin antibodies and immunoconjugates |
| PH12013501339A1 (en) | 2010-12-22 | 2013-08-28 | Genentech Inc | Anti-pcsk9 antibodies and methods of use |
| SG191153A1 (en) | 2010-12-23 | 2013-07-31 | Hoffmann La Roche | Polypeptide-polynucleotide-complex and its use in targeted effector moiety delivery |
| EP2471554A1 (en) * | 2010-12-28 | 2012-07-04 | Hexal AG | Pharmaceutical formulation comprising a biopharmaceutical drug |
| BR112013014644A2 (en) | 2011-01-03 | 2017-03-07 | F Hoffmann - La Roche Ag | pharmaceutical composition and complex |
| BR112013018877A2 (en) | 2011-01-28 | 2016-10-04 | Sanofi Sa | pharmaceutical compositions comprising human antibodies to pcsk9 |
| AU2012215572A1 (en) | 2011-02-10 | 2013-05-02 | Roche Glycart Ag | Improved immunotherapy |
| MX341921B (en) | 2011-02-28 | 2016-09-07 | Hoffmann La Roche | Antigen binding proteins. |
| RU2013141078A (en) | 2011-02-28 | 2015-04-10 | Ф. Хоффманн-Ля Рош Аг | SINGLE VALVE ANTI-BINDING PROTEINS |
| TR201815420T4 (en) | 2011-03-29 | 2018-11-21 | Roche Glycart Ag | Antibody fc variants. |
| ES2676205T3 (en) | 2011-03-31 | 2018-07-17 | Merck Sharp & Dohme Corp. | Stable antibody formulations for the human PD-1 receptor of programmed death and related treatments |
| BR112013024717A2 (en) | 2011-04-07 | 2017-08-08 | Genentech Inc | isolated antibody, isolated nucleic acid, host cell, immunoconjugate, pharmaceutical formulation, method of treating an individual who has cancer and method of inhibiting cell proliferation in an individual |
| US20140170148A1 (en) * | 2011-04-20 | 2014-06-19 | Genmab A/S | Bispecific antibodies against her2 |
| AU2012244816B2 (en) | 2011-04-20 | 2015-12-10 | Roche Glycart Ag | Method and constructs for the pH dependent passage of the blood-brain-barrier |
| WO2012143524A2 (en) | 2011-04-20 | 2012-10-26 | Genmab A/S | Bispecific antibodies against her2 and cd3 |
| WO2012146630A1 (en) | 2011-04-29 | 2012-11-01 | F. Hoffmann-La Roche Ag | N-terminal acylated polypeptides, methods for their production and uses thereof |
| KR102014512B1 (en) * | 2011-05-02 | 2019-08-26 | 밀레니엄 파머슈티컬스 인코퍼레이티드 | FORMULATION FOR ANTI-α4β7 ANTIBODY |
| PH12013502294A1 (en) | 2011-05-16 | 2014-01-27 | Genentech Inc | Fgfr1 agonists and methods of use |
| EP2721067B1 (en) | 2011-06-15 | 2019-07-31 | F.Hoffmann-La Roche Ag | Anti-human epo receptor antibodies and methods of use |
| AR086982A1 (en) | 2011-06-22 | 2014-02-05 | Hoffmann La Roche | ELIMINATION OF DIANA CELLS BY SPECIFIC CYTOTOXIC T-CELLS OF VIRUSES USING COMPLEXES THAT INCLUDE MHC CLASS I |
| WO2013003620A2 (en) | 2011-06-28 | 2013-01-03 | Forsight Vision4, Inc. | Diagnostic methods and apparatus |
| US20130004484A1 (en) | 2011-06-30 | 2013-01-03 | Genentech, Inc. | Anti-c-met antibody formulations |
| AR087305A1 (en) | 2011-07-28 | 2014-03-12 | Regeneron Pharma | STABILIZED FORMULATIONS CONTAINING ANTI-PCSK9 ANTIBODIES, PREPARATION METHOD AND KIT |
| CN103890007A (en) | 2011-08-17 | 2014-06-25 | 霍夫曼-拉罗奇有限公司 | Neuregulin antibodies and uses thereof |
| EP2747781B1 (en) | 2011-08-23 | 2017-11-15 | Roche Glycart AG | Bispecific antibodies specific for t-cell activating antigens and a tumor antigen and methods of use |
| MX2014002053A (en) | 2011-08-23 | 2014-04-25 | Roche Glycart Ag | Anti-mcsp antibodies. |
| AR087601A1 (en) | 2011-08-23 | 2014-04-03 | Roche Glycart Ag | ANTIBODIES WITHOUT FC THAT INCLUDE TWO FAB FRAGMENTS AND METHODS OF USE |
| US20130084286A1 (en) | 2011-08-31 | 2013-04-04 | Thomas E. Januario | Diagnostic markers |
| BR112014005720A2 (en) | 2011-09-15 | 2017-12-12 | Genentech Inc | method of selecting and / or identifying a usp1 antagonist, uaf1 antagonist and / or an id antagonist that promotes a change in the cellular fate of said method |
| LT2755600T (en) | 2011-09-16 | 2021-04-26 | Forsight Vision4, Inc. | Fluid exchange apparatus |
| RU2014114119A (en) | 2011-09-23 | 2015-10-27 | Рош Гликарт Аг | BSPECIFIC ANTI-EGFR / ANTI IGF-1R-ANTIBODIES |
| ES3023516T3 (en) | 2011-10-14 | 2025-06-02 | Hoffmann La Roche | Uses for and article of manufacture including her2 dimerization inhibitor pertuzumab |
| KR102102862B1 (en) | 2011-10-14 | 2020-04-22 | 제넨테크, 인크. | ANTI-HtrA1 ANTIBODIES AND METHODS OF USE |
| US9358250B2 (en) | 2011-10-15 | 2016-06-07 | Genentech, Inc. | Methods of using SCD1 antagonists |
| WO2013059531A1 (en) | 2011-10-20 | 2013-04-25 | Genentech, Inc. | Anti-gcgr antibodies and uses thereof |
| EP4088736A1 (en) | 2011-10-25 | 2022-11-16 | Prothena Biosciences Limited | Humanized anti-amyloid antibody formulations and methods |
| AU2012328980A1 (en) | 2011-10-28 | 2014-04-24 | Genentech, Inc. | Therapeutic combinations and methods of treating melanoma |
| DK3378535T5 (en) | 2011-10-28 | 2024-09-30 | Prothena Biosciences Ltd | HUMANIZED ANTIBODIES THAT RECOGNIZE ALPHA-SYNUCLEIN |
| CA3078979C (en) * | 2011-10-31 | 2022-10-11 | Genentech, Inc. | Formulation comprising an anti-il13 antibody having extended stability |
| CN104066748A (en) | 2011-11-21 | 2014-09-24 | 霍夫曼-拉罗奇有限公司 | Purification of anti-c-met antibody |
| DE102011056142A1 (en) * | 2011-12-07 | 2013-06-13 | Manfred Rüdinger | Metabolizable salts and their use in diagnostics and therapy |
| CA2861610A1 (en) | 2011-12-30 | 2013-07-04 | Abbvie Inc. | Dual specific binding proteins directed against il-13 and/or il-17 |
| KR20140119114A (en) | 2012-01-18 | 2014-10-08 | 제넨테크, 인크. | Methods of using fgf19 modulators |
| EP2804629A1 (en) | 2012-01-18 | 2014-11-26 | Genentech, Inc. | Anti-lrp5 antibodies and methods of use |
| CN104169299B (en) * | 2012-01-23 | 2018-06-05 | 瑞泽恩制药公司 | Stabilized preparations containing anti-Ang-2 antibody |
| CN108517010A (en) | 2012-01-27 | 2018-09-11 | 普罗典娜生物科学有限公司 | Identify the humanized antibody of alpha-synapse nucleoprotein |
| US10010448B2 (en) | 2012-02-03 | 2018-07-03 | Forsight Vision4, Inc. | Insertion and removal methods and apparatus for therapeutic devices |
| RU2644341C2 (en) | 2012-02-10 | 2018-02-08 | Дженентек, Инк. | Single-chain antibodies and other heteromultimers |
| MX366804B (en) | 2012-02-11 | 2019-07-25 | Genentech Inc | R-spondin translocations and methods using the same. |
| EP2814587B1 (en) | 2012-02-15 | 2018-05-02 | F.Hoffmann-La Roche Ag | Fc-receptor based affinity chromatography |
| AR090244A1 (en) * | 2012-03-08 | 2014-10-29 | Hoffmann La Roche | FORMULATION OF ANTI-SELECTINE ANTIBODY P |
| BR122019026701B1 (en) * | 2012-03-26 | 2023-01-24 | Sanofi | STABLE IGG4-BASED BINDER FORMULATIONS, KIT, AND PRE-FILLED DEVICE OR CONTAINER |
| US9592289B2 (en) | 2012-03-26 | 2017-03-14 | Sanofi | Stable IgG4 based binding agent formulations |
| AR090549A1 (en) | 2012-03-30 | 2014-11-19 | Genentech Inc | ANTI-LGR5 AND IMMUNOCATE PLAYERS |
| CN104245738B (en) | 2012-04-05 | 2018-02-02 | 弗·哈夫曼-拉罗切有限公司 | For people TWEAK and people IL17 bispecific antibody and application thereof |
| US20130281355A1 (en) | 2012-04-24 | 2013-10-24 | Genentech, Inc. | Cell culture compositions and methods for polypeptide production |
| KR20150006000A (en) | 2012-05-01 | 2015-01-15 | 제넨테크, 인크. | Anti-pmel17 antibodies and immunoconjugates |
| WO2013165791A1 (en) * | 2012-05-03 | 2013-11-07 | Boehringer Ingelheim International Gmbh | Anti-il-23p19 antibodies |
| US20140004131A1 (en) * | 2012-05-04 | 2014-01-02 | Novartis Ag | Antibody formulation |
| WO2013170191A1 (en) | 2012-05-11 | 2013-11-14 | Genentech, Inc. | Methods of using antagonists of nad biosynthesis from nicotinamide |
| US9796780B2 (en) | 2012-05-14 | 2017-10-24 | Biogen Ma Inc. | LINGO-2 antagonists for treatment of conditions involving motor neurons |
| ES2682761T3 (en) | 2012-05-18 | 2018-09-21 | Genentech, Inc. | High concentration monoclonal antibody formulations |
| AR092325A1 (en) | 2012-05-31 | 2015-04-15 | Regeneron Pharma | STABILIZED FORMULATIONS CONTAINING ANTI-DLL4 ANTIBODIES AND KIT |
| US20130323242A1 (en) * | 2012-06-01 | 2013-12-05 | Ophthotech Corp. | Compositions comprising an anti-pdgf aptamer and a vegf antagonist |
| US9216219B2 (en) * | 2012-06-12 | 2015-12-22 | Novartis Ag | Anti-BAFFR antibody formulation |
| KR20150023711A (en) | 2012-06-15 | 2015-03-05 | 제넨테크, 인크. | Anti-pcsk9 antibodies, formulations, dosing, and methods of use |
| CA2877363A1 (en) | 2012-06-21 | 2013-12-27 | Indiana University Research And Technology Corporation | Incretin receptor ligand polypeptide fc-region fusion polypeptides and conjugates with altered fc-effector function |
| CN104395340B9 (en) | 2012-06-27 | 2018-11-30 | 弗·哈夫曼-拉罗切有限公司 | Method of tailoring selective and multispecific therapeutic molecules comprising at least two different targeting entities and uses thereof |
| JP6203838B2 (en) | 2012-06-27 | 2017-09-27 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Method for selecting and creating tailor-made highly selective and multispecific targeting entities comprising at least two different binding entities and uses thereof |
| EP2867254B1 (en) | 2012-06-27 | 2017-10-25 | F. Hoffmann-La Roche AG | Method for making antibody fc-region conjugates comprising at least one binding entity that specifically binds to a target and uses thereof |
| EP3138578B1 (en) | 2012-07-04 | 2022-01-12 | F. Hoffmann-La Roche AG | Anti-theophylline antibodies and methods of use |
| CA2872192A1 (en) | 2012-07-04 | 2014-01-09 | F. Hoffmann-La Roche Ag | Anti-biotin antibodies and methods of use |
| RU2684595C2 (en) | 2012-07-04 | 2019-04-09 | Ф.Хоффманн-Ля Рош Аг | Kovalent-related conjuates of antigen-antibody |
| TW201408697A (en) | 2012-07-09 | 2014-03-01 | Genentech Inc | Anti-CD79b antibodies and immunoconjugates |
| CN104428007B (en) | 2012-07-09 | 2018-03-16 | 基因泰克公司 | Immunoconjugates comprising anti-CD22 antibody |
| US20140030280A1 (en) | 2012-07-09 | 2014-01-30 | Genentech, Inc. | Anti-cd79b antibodies and immunoconjugates |
| IN2014DN10510A (en) | 2012-07-09 | 2015-08-21 | Genentech Inc | |
| DK3495387T3 (en) | 2012-07-13 | 2021-11-08 | Roche Glycart Ag | Bispecific anti-VEGF / anti-ANG-2 antibodies and their use in the treatment of ocular vascular diseases |
| CN104508132B (en) | 2012-08-02 | 2017-09-15 | 弗·哈夫曼-拉罗切有限公司 | Method for producing soluble FcR as an Fc fusion to an inert immunoglobulin Fc region and uses thereof |
| EP3434695B1 (en) | 2012-08-07 | 2020-12-02 | Roche Glycart AG | Improved immunotherapy |
| FR2994390B1 (en) | 2012-08-10 | 2014-08-15 | Adocia | METHOD FOR LOWERING THE VISCOSITY OF HIGH CONCENTRATION PROTEIN SOLUTIONS |
| US9592297B2 (en) | 2012-08-31 | 2017-03-14 | Bayer Healthcare Llc | Antibody and protein formulations |
| US8883979B2 (en) | 2012-08-31 | 2014-11-11 | Bayer Healthcare Llc | Anti-prolactin receptor antibody formulations |
| UA115789C2 (en) | 2012-09-05 | 2017-12-26 | Трейкон Фармасутікалз, Інк. | Antibody formulations and uses thereof |
| TWI595007B (en) | 2012-09-10 | 2017-08-11 | Neotope Biosciences Ltd | Anti-mcam antibodies and associated methods of use |
| JP6405311B2 (en) | 2012-09-14 | 2018-10-17 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Method for making and selecting molecules comprising at least two different entities and uses thereof |
| CA2887050A1 (en) | 2012-10-04 | 2014-04-10 | Novelmed Therapeutics, Inc. | Alternative pathway specific antibodies for treating hemolytic diseases |
| UA118441C2 (en) | 2012-10-08 | 2019-01-25 | Протена Біосаєнсиз Лімітед | Antibodies recognizing alpha-synuclein |
| JP6444874B2 (en) | 2012-10-08 | 2018-12-26 | ロシュ グリクアート アーゲー | Fc-free antibody comprising two Fab fragments and methods of use |
| JP2015534568A (en) | 2012-10-08 | 2015-12-03 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Cell penetrating peptides that bind to IRF5 |
| EP2839860B1 (en) | 2012-10-12 | 2019-05-01 | MedImmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| US9492563B2 (en) | 2012-10-30 | 2016-11-15 | Esperance Pharmaceuticals, Inc. | Antibody/drug conjugates and methods of use |
| JP6339578B2 (en) | 2012-10-31 | 2018-06-06 | タケダ・ゲー・エム・ベー・ハーTakeda GmbH | Lyophilized preparation containing GM-CSF neutralizing compound |
| EP2727602A1 (en) * | 2012-10-31 | 2014-05-07 | Takeda GmbH | Method for preparation of a high concentration liquid formulation of an antibody |
| AR093297A1 (en) * | 2012-10-31 | 2015-05-27 | Amgen Res Munich Gmbh | LIQUID FORMULATION THAT INCLUDES A GM-CSF NEUTRALIZING COMPOUND |
| TW201811825A (en) | 2012-11-01 | 2018-04-01 | 美商艾伯維有限公司 | Anti-VEGF/DLL4 dual variable region immunoglobulin and use thereof |
| CA2884431A1 (en) | 2012-11-08 | 2014-05-15 | F. Hoffmann-La Roche Ag | Her3 antigen binding proteins binding to the beta-hairpin of her3 |
| CA2890669A1 (en) | 2012-11-13 | 2014-05-22 | Genetech, Inc. | Anti-hemagglutinin antibodies and methods of use |
| US20140154255A1 (en) | 2012-11-30 | 2014-06-05 | Abbvie Biotherapeutics Inc. | Anti-vegf antibodies and their uses |
| UA117466C2 (en) | 2012-12-13 | 2018-08-10 | Мерк Шарп Енд Доме Корп. | STABLE COMPOSITION IN THE VIEW OF AN ANTIBODY ANTIBODY TO IL-23p19 |
| MX2015007575A (en) * | 2012-12-13 | 2016-03-15 | Univ Pennsylvania | CONSTRUCTIONS OF ANTIBODIES OF DNA AND METHOD TO USE THEM. |
| KR20150097688A (en) | 2012-12-21 | 2015-08-26 | 에프. 호프만-라 로슈 아게 | Disulfide-linked multivalent mhc class i comprising multi-function proteins |
| US20150343058A1 (en) * | 2012-12-21 | 2015-12-03 | Glenmark Pharmaceuticals S.A. | Antibody formulation |
| WO2014116749A1 (en) | 2013-01-23 | 2014-07-31 | Genentech, Inc. | Anti-hcv antibodies and methods of using thereof |
| BR112015017338B1 (en) | 2013-02-08 | 2022-11-29 | Novartis Ag | ISOLATED THERAPEUTIC HUMAN ANTIBODY OR ANTIGEN-BINDING PORTION THEREOF, ITS USE AND PRODUCTION PROCESS, PHARMACEUTICAL COMPOSITION, ISOLATED NUCLEIC ACID MOLECULE, CLONING OR EXPRESSION VECTOR AND TRANSGENIC MICRO-ORGANISM |
| WO2015198217A2 (en) | 2013-02-08 | 2015-12-30 | Novartis Ag | Compositions and methods for long-acting antibodies targeting il-17 |
| JP2016509045A (en) | 2013-02-22 | 2016-03-24 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | How to treat cancer and prevent drug resistance |
| WO2014131715A1 (en) | 2013-02-26 | 2014-09-04 | Roche Glycart Ag | Anti-mcsp antibodies |
| JP2016510751A (en) | 2013-03-06 | 2016-04-11 | ジェネンテック, インコーポレイテッド | Methods of treating and preventing anticancer drug resistance |
| US10344060B2 (en) | 2013-03-12 | 2019-07-09 | Amgen Inc. | Potent and selective inhibitors of Nav1.7 |
| AR096927A1 (en) | 2013-03-12 | 2016-02-10 | Amgen Inc | POWERFUL AND SELECTIVE INHIBITORS OF NaV1.7 |
| WO2014140174A1 (en) | 2013-03-13 | 2014-09-18 | Spirogen Sàrl | Pyrrolobenzodiazepines and conjugates thereof |
| CN105209069B (en) | 2013-03-13 | 2019-08-23 | 豪夫迈·罗氏有限公司 | Antibody formulation |
| EP2968565A2 (en) | 2013-03-14 | 2016-01-20 | Genentech, Inc. | Methods of treating cancer and preventing cancer drug resistance |
| WO2014152959A1 (en) | 2013-03-14 | 2014-09-25 | Forsight Vision4, Inc. | Systems for sustained intraocular delivery of low solubility compounds from a port delivery system implant |
| US9562099B2 (en) | 2013-03-14 | 2017-02-07 | Genentech, Inc. | Anti-B7-H4 antibodies and immunoconjugates |
| CN105189552B (en) | 2013-03-14 | 2019-08-02 | 基因泰克公司 | Anti-B7-H4 Antibodies and Immunoconjugates |
| US20160002342A1 (en) * | 2013-03-15 | 2016-01-07 | Xinghang Ma | Anti-prolactin receptor antibody formulations |
| CN105143252A (en) | 2013-03-15 | 2015-12-09 | 豪夫迈·罗氏有限公司 | Il-22 polypeptides and il-22 Fc fusion proteins and methods of use |
| JP2016517441A (en) | 2013-03-15 | 2016-06-16 | ジェネンテック, インコーポレイテッド | Anti-CRTh2 antibody and method of use |
| WO2014151006A2 (en) | 2013-03-15 | 2014-09-25 | Genentech, Inc. | Biomarkers and methods of treating pd-1 and pd-l1 related conditions |
| US10017732B2 (en) | 2013-03-15 | 2018-07-10 | Genentech, Inc. | Cell culture compositions with antioxidants and methods for polypeptide production |
| JP6568514B2 (en) | 2013-03-15 | 2019-08-28 | エーシー イミューン エス.エー. | Anti-tau antibodies and methods of use |
| CA2904448A1 (en) | 2013-03-15 | 2014-09-18 | Tariq Ghayur | Dual specific binding proteins directed against il-1.beta. and/or il-17 |
| HK1211963A1 (en) | 2013-03-15 | 2016-06-03 | 豪夫迈.罗氏有限公司 | Compositions and methods for diagnosis and treatment of hepatic cancers |
| EP2970465B1 (en) * | 2013-03-15 | 2019-09-25 | Takeda GmbH | Formulation of an antibody and use thereof |
| CN105339001A (en) | 2013-03-15 | 2016-02-17 | 基因泰克公司 | Ways to treat cancer and prevent cancer resistance |
| WO2014160884A1 (en) | 2013-03-28 | 2014-10-02 | Forsight Vision4, Inc. | Ophthalmic implant for delivering therapeutic substances |
| WO2014161570A1 (en) | 2013-04-03 | 2014-10-09 | Roche Glycart Ag | Antibodies against human il17 and uses thereof |
| UA118028C2 (en) | 2013-04-03 | 2018-11-12 | Рош Глікарт Аг | Bispecific antibodies specific for fap and dr5, antibodies specific for dr5 and methods of use |
| CA2907776C (en) * | 2013-04-16 | 2020-04-14 | Genentech, Inc. | Pertuzumab variants and evaluation thereof |
| PE20151807A1 (en) | 2013-04-29 | 2015-12-02 | Hoffmann La Roche | MODIFIED ANTIBODIES OF BINDING TO HUMAN FCRN AND METHOD OF USE |
| JP6618893B2 (en) | 2013-04-29 | 2019-12-11 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Asymmetric antibodies with altered FC receptor binding and methods of use |
| WO2014177461A1 (en) | 2013-04-29 | 2014-11-06 | F. Hoffmann-La Roche Ag | Fcrn-binding abolished anti-igf-1r antibodies and their use in the treatment of vascular eye diseases |
| JP2014214153A (en) * | 2013-04-30 | 2014-11-17 | ニプロ株式会社 | Pharmaceutical preparation of aqueous solution and method for producing the same |
| HRP20240107T1 (en) | 2013-05-20 | 2024-04-12 | F. Hoffmann - La Roche Ag | Anti-transferrin receptor antibodies and methods of use |
| US10513555B2 (en) | 2013-07-04 | 2019-12-24 | Prothena Biosciences Limited | Antibody formulations and methods |
| MX2016000364A (en) | 2013-07-12 | 2016-05-09 | Ophthotech Corp | METHODS TO TREAT OR PREVENT OPHTHALMOLOGICAL AFFECTIONS. |
| WO2015014979A1 (en) | 2013-08-01 | 2015-02-05 | F. Hoffmann-La Roche Ag | Tnfa-il-17 bispecific antibodies |
| BR112016002198A2 (en) * | 2013-08-14 | 2017-09-12 | Novartis Ag | Methods of treating sporadic inclusion body myositis |
| AU2014314053C1 (en) | 2013-08-30 | 2023-11-02 | Takeda Pharmaceutical Company Limited | Antibodies neutralizing GM-CSF for use in the treatment of rheumatoid arthritis or as analgesics |
| JP2016537399A (en) | 2013-09-17 | 2016-12-01 | ジェネンテック, インコーポレイテッド | Method using anti-LGR5 antibody |
| MX375378B (en) * | 2013-09-27 | 2025-03-06 | Genentech Inc | ANTI-PDL1 ANTIBODY FORMULATIONS. |
| RU2016115866A (en) | 2013-10-11 | 2017-11-16 | Ф. Хоффманн-Ля Рош Аг | MULTI-SPECIFIC ANTIBODIES WITH EXCHANGED DOMAINS AND SAME VARIABLE DOMAINS OF EASY CHAIN |
| CN105814078A (en) | 2013-10-11 | 2016-07-27 | 豪夫迈·罗氏有限公司 | Nsp4 inhibitors and methods of use |
| MX2016004802A (en) | 2013-10-18 | 2016-07-18 | Genentech Inc | Anti-rsp02 and/or anti-rsp03 antibodies and their uses. |
| AR098155A1 (en) | 2013-10-23 | 2016-05-04 | Genentech Inc | METHODS TO DIAGNOSTIC AND TREAT EOSYNOPHYL DISORDERS |
| EP3071181B1 (en) | 2013-11-18 | 2021-03-24 | Formycon AG | Pharmaceutical composition of an anti-vegf antibody |
| JP6590803B2 (en) | 2013-11-21 | 2019-10-16 | ゲンマブ エー/エス | Antibody-drug conjugate lyophilized formulation |
| RU2718990C1 (en) | 2013-11-21 | 2020-04-15 | Ф. Хоффманн-Ля Рош Аг | Antibodies to alpha-synuclein and methods of using |
| PE20160712A1 (en) | 2013-12-13 | 2016-07-26 | Genentech Inc | ANTI-CD33 ANTIBODIES AND IMMUNOCONJUGATES |
| WO2015095410A1 (en) | 2013-12-17 | 2015-06-25 | Genentech, Inc. | Methods of treating cancer using pd-1 axis binding antagonists and an anti-cd20 antibody |
| CN112353943A (en) | 2013-12-17 | 2021-02-12 | 豪夫迈·罗氏有限公司 | Methods of treating cancer with PD-1 axis binding antagonists and taxanes |
| JP2017501167A (en) | 2013-12-17 | 2017-01-12 | ジェネンテック, インコーポレイテッド | Combination therapy comprising OX40 binding agonist and PD-1 axis binding antagonist |
| US10137170B2 (en) | 2013-12-20 | 2018-11-27 | Indiana University Research And Technology Corporation | Lipidated incretin receptor ligand human immunoglobulin Fc-region fusion polypeptides |
| CA2932958A1 (en) | 2013-12-20 | 2015-06-25 | F. Hoffmann-La Roche Ag | Humanized anti-tau(ps422) antibodies and methods of use |
| TWI728373B (en) | 2013-12-23 | 2021-05-21 | 美商建南德克公司 | Antibodies and methods of use |
| EP3089759B1 (en) | 2014-01-03 | 2018-12-05 | F. Hoffmann-La Roche AG | Covalently linked polypeptide toxin-antibody conjugates |
| CA2930154A1 (en) | 2014-01-03 | 2015-07-09 | F. Hoffmann-La Roche Ag | Covalently linked helicar-anti-helicar antibody conjugates and uses thereof |
| WO2015101586A1 (en) | 2014-01-03 | 2015-07-09 | F. Hoffmann-La Roche Ag | Bispecific anti-hapten/anti-blood brain barrier receptor antibodies, complexes thereof and their use as blood brain barrier shuttles |
| JP6557664B2 (en) | 2014-01-06 | 2019-08-07 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Monovalent blood-brain barrier shuttle module |
| CA2931986A1 (en) | 2014-01-15 | 2015-07-23 | F. Hoffmann-La Roche Ag | Fc-region variants with modified fcrn- and maintained protein a-binding properties |
| JP2017505305A (en) | 2014-01-24 | 2017-02-16 | ジェネンテック, インコーポレイテッド | Methods using anti-STEAP1 antibodies and immunoconjugates |
| KR20160111039A (en) | 2014-02-08 | 2016-09-23 | 제넨테크, 인크. | Methods of treating alzheimer's disease |
| ES2873248T3 (en) | 2014-02-08 | 2021-11-03 | Hoffmann La Roche | Methods to treat Alzheimer's disease |
| TR201810635T4 (en) | 2014-02-12 | 2018-08-27 | Hoffmann La Roche | Anti-jagged1 antibodies and methods of use. |
| KR20160124165A (en) | 2014-02-21 | 2016-10-26 | 제넨테크, 인크. | Anti-il-13/il-17 bispecific antibodies and uses thereof |
| SG11201607109QA (en) | 2014-02-28 | 2016-09-29 | Merus Nv | Antibodies that bind egfr and erbb3 |
| LT3110849T (en) | 2014-02-28 | 2020-12-10 | Merus N.V. | Antibody that binds erbb-2 and erbb-3 |
| EP3116911B8 (en) * | 2014-03-12 | 2019-10-23 | Prothena Biosciences Limited | Anti-mcam antibodies and associated methods of use |
| EP3119490B1 (en) | 2014-03-21 | 2021-09-08 | F. Hoffmann-La Roche AG | In vitro prediction of in vivo half-life of antibodies |
| US20170107294A1 (en) | 2014-03-21 | 2017-04-20 | Nordlandssykehuset Hf | Anti-cd14 antibodies and uses thereof |
| CN106103486B (en) | 2014-03-31 | 2020-04-21 | 豪夫迈·罗氏有限公司 | Anti-OX40 antibodies and methods of use |
| CA2943834A1 (en) | 2014-03-31 | 2015-10-08 | Genentech, Inc. | Combination therapy comprising anti-angiogenesis agents and ox40 binding agonists |
| WO2015159254A1 (en) | 2014-04-16 | 2015-10-22 | Biocon Ltd. | Stable protein formulations comprising a molar excess of sorbitol |
| JP2015209384A (en) * | 2014-04-24 | 2015-11-24 | ミレニアム ファーマシューティカルズ, インコーポレイテッドMillennium Pharmaceuticals, Inc. | Pharmaceutical formulation |
| KR20160141857A (en) | 2014-04-25 | 2016-12-09 | 제넨테크, 인크. | Methods of treating early breast cancer with trastuzumab-mcc-dm1 and pertuzumab |
| CN105012949A (en) * | 2014-04-28 | 2015-11-04 | 上海药明康德新药开发有限公司 | Preparation of recombinant human anti-human TNF-alpha monoclonal antibody |
| KR20170003582A (en) | 2014-05-22 | 2017-01-09 | 제넨테크, 인크. | Anti-gpc3 antibodies and immunoconjugates |
| ES2607489T3 (en) | 2014-05-23 | 2017-03-31 | Ares Trading S.A. | Liquid pharmaceutical composition |
| JP2017524371A (en) | 2014-05-23 | 2017-08-31 | ジェネンテック, インコーポレイテッド | MIT biomarkers and methods of use |
| ES2572919T3 (en) | 2014-05-23 | 2016-06-03 | Ares Trading S.A. | Liquid pharmaceutical composition |
| EP2946765B1 (en) | 2014-05-23 | 2016-08-31 | Ares Trading S.A. | Liquid pharmaceutical composition |
| CA2949982A1 (en) | 2014-06-11 | 2015-12-17 | Genentech, Inc. | Anti-lgr5 antibodies and uses thereof |
| CN107073121A (en) | 2014-06-13 | 2017-08-18 | 基因泰克公司 | Methods of treating and preventing cancer drug resistance |
| AR100978A1 (en) | 2014-06-26 | 2016-11-16 | Hoffmann La Roche | ANTI-Tau HUMANIZED ANTIBODY BRAIN LAUNCHERS (pS422) AND USES OF THE SAME |
| EP3164419B1 (en) | 2014-06-26 | 2024-07-24 | F. Hoffmann-La Roche AG | Anti-brdu antibodies and methods of use |
| WO2016007775A1 (en) | 2014-07-11 | 2016-01-14 | Genentech, Inc. | Notch pathway inhibition |
| JP6581194B2 (en) | 2014-07-15 | 2019-09-25 | フォーサイト・ビジョン フォー・インコーポレーテッドForsight Vision4, Inc. | Ocular implant delivery device and method |
| EP3708679A1 (en) | 2014-07-24 | 2020-09-16 | Boehringer Ingelheim International GmbH | Biomarkers useful in the treatment of il-23a related diseases |
| CA2957548A1 (en) | 2014-08-08 | 2016-02-11 | Forsight Vision4, Inc. | Stable and soluble formulations of receptor tyrosine kinase inhibitors, and methods of preparation thereof |
| DK4074735T3 (en) | 2014-08-28 | 2025-07-14 | Bioatla Inc | CONDITIONALLY ACTIVE CHIMERIC ANTIGEN RECEPTORS FOR MODIFIED T-CELLS |
| AU2015311913B2 (en) | 2014-09-03 | 2019-09-12 | Boehringer Ingelheim International Gmbh | Compound targeting IL-23A and TNF-alpha and uses thereof |
| EP3193940A1 (en) | 2014-09-10 | 2017-07-26 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| CN107108724A (en) | 2014-09-12 | 2017-08-29 | 豪夫迈·罗氏有限公司 | Cysteine engineered antibodies and conjugates |
| MX2017003126A (en) | 2014-09-12 | 2017-08-28 | Genentech Inc | Anti-her2 antibodies and immunoconjugates. |
| CN113698485A (en) | 2014-09-12 | 2021-11-26 | 基因泰克公司 | anti-B7-H4 antibodies and immunoconjugates |
| SG11201701627PA (en) | 2014-09-12 | 2017-03-30 | Genentech Inc | Anti-cll-1 antibodies and immunoconjugates |
| WO2016044334A1 (en) * | 2014-09-15 | 2016-03-24 | Genentech, Inc. | Antibody formulations |
| RU2727663C2 (en) | 2014-09-17 | 2020-07-22 | Дженентек, Инк. | Immunoconjugates, containing antibodies against her2 and pyrrolbenzodiazepines |
| RS60349B8 (en) | 2014-09-23 | 2022-10-31 | Hoffmann La Roche | Method of using anti-cd79b immunoconjugates |
| TW201628649A (en) * | 2014-10-09 | 2016-08-16 | 再生元醫藥公司 | Method for reducing microscopic particles in a pharmaceutical formulation |
| JP2017536102A (en) | 2014-10-16 | 2017-12-07 | ジェネンテック, インコーポレイテッド | Anti-alpha-synuclein antibodies and methods of use |
| CN107106590B (en) * | 2014-10-24 | 2022-10-18 | 阿斯利康(瑞典)有限公司 | Combination (I) |
| WO2016073157A1 (en) | 2014-11-06 | 2016-05-12 | Genentech, Inc. | Anti-ang2 antibodies and methods of use thereof |
| PL3215528T3 (en) | 2014-11-06 | 2020-01-31 | F.Hoffmann-La Roche Ag | Fc-region variants with modified fcrn-binding and methods of use |
| BR112017006591A2 (en) | 2014-11-06 | 2018-01-16 | Hoffmann La Roche | heterodimeric polypeptide, pharmaceutical formulation and use of a heterodimeric polypeptide |
| TWI705827B (en) * | 2014-11-07 | 2020-10-01 | 瑞士商諾華公司 | Methods for treating ocular diseases |
| WO2016077369A1 (en) | 2014-11-10 | 2016-05-19 | Genentech, Inc. | Animal model for nephropathy and agents for treating the same |
| US10093730B2 (en) | 2014-11-10 | 2018-10-09 | Genentech, Inc. | Anti-interleukin-33 antibodies and uses thereof |
| WO2016077371A1 (en) | 2014-11-10 | 2016-05-19 | Forsight Vision4, Inc. | Expandable drug delivery devices and method of use |
| US9926375B2 (en) | 2014-11-12 | 2018-03-27 | Tracon Pharmaceuticals, Inc. | Anti-endoglin antibodies and uses thereof |
| US10155820B2 (en) | 2014-11-12 | 2018-12-18 | Tracon Pharmaceuticals, Inc. | Anti-endoglin antibodies and uses thereof |
| MX391388B (en) | 2014-11-14 | 2025-03-21 | Hoffmann La Roche | ANTIGEN-BINDING MOLECULES THAT COMPRISE A LIGAND TRIMER FROM THE TNF FAMILY. |
| KR20170096112A (en) | 2014-11-17 | 2017-08-23 | 제넨테크, 인크. | Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists |
| WO2016081643A1 (en) | 2014-11-19 | 2016-05-26 | Genentech, Inc. | Anti-transferrin receptor antibodies and methods of use |
| JP6993228B2 (en) | 2014-11-19 | 2022-03-03 | ジェネンテック, インコーポレイテッド | Anti-transferrin receptor / anti-BACE1 multispecific antibody and usage |
| CN107108745B (en) | 2014-11-19 | 2021-01-12 | 基因泰克公司 | Antibodies against BACE1 and their use for immunotherapy of neurological diseases |
| CN107206072B (en) | 2014-11-20 | 2022-01-21 | 豪夫迈·罗氏有限公司 | Combination therapy of the T cell activating bispecific antigen binding molecule CD3 ABD folate receptor 1(FolR1) and a PD-1 axis binding antagonist |
| JP6721590B2 (en) | 2014-12-03 | 2020-07-15 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Multispecific antibody |
| PL3227336T3 (en) | 2014-12-05 | 2019-11-29 | Hoffmann La Roche | Anti-cd79b antibodies and methods of use |
| KR20170085595A (en) | 2014-12-10 | 2017-07-24 | 제넨테크, 인크. | Blood brain barrier receptor antibodies and methods of use |
| CN104922668B (en) * | 2014-12-10 | 2019-08-23 | 信达生物制药(苏州)有限公司 | A kind of stable anti-VEGF antibody preparation and application thereof |
| US10093733B2 (en) | 2014-12-11 | 2018-10-09 | Abbvie Inc. | LRP-8 binding dual variable domain immunoglobulin proteins |
| EP3633371A1 (en) | 2014-12-18 | 2020-04-08 | F. Hoffmann-La Roche AG | Assay and method for determining cdc eliciting antibodies |
| BR112017011235A2 (en) | 2014-12-19 | 2018-02-06 | Chugai Pharmaceutical Co Ltd | anti-c5 antibodies and methods of use |
| EP4600372A3 (en) | 2014-12-19 | 2025-11-19 | Chugai Seiyaku Kabushiki Kaisha | Anti-myostatin antibodies, polypeptides containing variant fc regions, and methods of use |
| AR103173A1 (en) | 2014-12-22 | 2017-04-19 | Novarits Ag | PHARMACEUTICAL PRODUCTS AND STABLE LIQUID COMPOSITIONS OF ANTIBODIES IL-17 |
| US20180000932A1 (en) * | 2014-12-31 | 2018-01-04 | Novelmed Therapeutics, Inc. | Formulation of aglycosylated therapeutic antibodies |
| WO2016112270A1 (en) | 2015-01-08 | 2016-07-14 | Biogen Ma Inc. | Lingo-1 antagonists and uses for treatment of demyelinating disorders |
| WO2016117346A1 (en) | 2015-01-22 | 2016-07-28 | Chugai Seiyaku Kabushiki Kaisha | A combination of two or more anti-c5 antibodies and methods of use |
| TWI688572B (en) | 2015-01-26 | 2020-03-21 | 美商宏觀基因股份有限公司 | Multivalent molecules comprising dr5-binding domains |
| AU2016210918A1 (en) * | 2015-01-28 | 2017-07-13 | Pfizer Inc., | Stable aqueous anti- vascular endothelial growth factor (VEGF) antibody formulation |
| CN105985435B (en) * | 2015-01-30 | 2019-10-15 | 嘉和生物药业有限公司 | Mutant antibody of fully human HER2 antibody and its encoding gene and application |
| WO2016126638A1 (en) | 2015-02-04 | 2016-08-11 | Boehringer Ingelheim International Gmbh | Methods of treating inflammatory diseases |
| CN114773469B (en) | 2015-02-05 | 2025-12-19 | 中外制药株式会社 | Antibodies comprising ion concentration-dependent antigen binding domains, variants of the FC region, IL-8-binding antibodies and uses thereof |
| CA2976298A1 (en) * | 2015-02-13 | 2016-08-18 | Sanofi | Stable liquid formulation for monoclonal antibodies |
| TWI805046B (en) | 2015-02-27 | 2023-06-11 | 日商中外製藥股份有限公司 | Use of IL-6 receptor antibody for preparing pharmaceutical composition |
| WO2016149276A1 (en) | 2015-03-16 | 2016-09-22 | Genentech, Inc. | Methods of detecting and quantifying il-13 and uses in diagnosing and treating th2-associated diseases |
| WO2016146833A1 (en) | 2015-03-19 | 2016-09-22 | F. Hoffmann-La Roche Ag | Biomarkers for nad(+)-diphthamide adp ribosyltransferase resistance |
| HRP20211159T1 (en) | 2015-04-24 | 2021-10-29 | F. Hoffmann - La Roche Ag | Methods of identifying bacteria comprising binding polypeptides |
| JP2018520642A (en) | 2015-05-01 | 2018-08-02 | ジェネンテック, インコーポレイテッド | Mask anti-CD3 antibody and method of use thereof |
| WO2016177913A1 (en) | 2015-05-07 | 2016-11-10 | Novimmune Sa | Methods and compositions for diagnosis and treatment of disorders in patients with elevated levels of cxcl9 and other biomarkers |
| US11091543B2 (en) | 2015-05-07 | 2021-08-17 | Swedish Orphan Biovitrum Ag | Methods, compositions and dosing regimens for treating or preventing interferon-gamma related indications |
| JP6524266B2 (en) | 2015-05-29 | 2019-06-05 | エクスプレッション、パソロジー、インコーポレイテッドExpression Pathology, Inc. | Quantification of Her2 protein for optimal cancer therapy |
| HK1250723A1 (en) | 2015-05-29 | 2019-01-11 | F. Hoffmann-La Roche Ag | Humanized anti-ebola virus glycoprotein antibodies and methods of use |
| HRP20241134T1 (en) | 2015-05-30 | 2024-11-22 | F. Hoffmann-La Roche Ag | METHODS OF TREATMENT OF HER2-POSITIVE PREVIOUSLY UNTREATED METASTATIC BREAST CANCER |
| EP3302552A1 (en) | 2015-06-02 | 2018-04-11 | H. Hoffnabb-La Roche Ag | Compositions and methods for using anti-il-34 antibodies to treat neurological diseases |
| CR20180013A (en) | 2015-06-05 | 2018-12-06 | Ac Immune Sa | ANTI-TAU ANTIBODIES AND METHODS OF USE. |
| MX2017014740A (en) | 2015-06-08 | 2018-08-15 | Genentech Inc | Methods of treating cancer using anti-ox40 antibodies. |
| EP3303397A1 (en) | 2015-06-08 | 2018-04-11 | H. Hoffnabb-La Roche Ag | Methods of treating cancer using anti-ox40 antibodies and pd-1 axis binding antagonists |
| TW201710286A (en) | 2015-06-15 | 2017-03-16 | 艾伯維有限公司 | Binding proteins against VEGF, PDGF, and/or their receptors |
| HK1255483A1 (en) | 2015-06-15 | 2019-08-16 | 基因泰克公司 | Antibodies and immunoconjugates |
| EP3310811B1 (en) | 2015-06-16 | 2021-06-16 | Genentech, Inc. | Anti-cd3 antibodies and methods of use |
| US10501545B2 (en) | 2015-06-16 | 2019-12-10 | Genentech, Inc. | Anti-CLL-1 antibodies and methods of use |
| JP6871874B2 (en) | 2015-06-16 | 2021-05-19 | ジェネンテック, インコーポレイテッド | Humanized affinity maturation antibody against FcRH5 and usage |
| HK1251493A1 (en) | 2015-06-17 | 2019-02-01 | 豪夫迈‧罗氏有限公司 | Methods of treating locally advanced or metastatic breast cancers using pd-1 axis binding antagonists and taxanes |
| EP3310812B1 (en) | 2015-06-17 | 2025-07-30 | F. Hoffmann-La Roche AG | Anti-her2 antibodies and methods of use |
| KR101808234B1 (en) * | 2015-06-23 | 2017-12-12 | (주)알테오젠 | A stable liquid formulation of fusion protein with IgG Fc domain |
| EP3744732B1 (en) | 2015-06-24 | 2025-09-10 | F. Hoffmann-La Roche AG | Humanized anti-tau(ps422) antibodies and methods of use |
| CN107531788B (en) | 2015-06-24 | 2022-06-21 | 豪夫迈·罗氏有限公司 | Trispecific antibodies specific for HER2 and blood brain barrier receptors and methods of use |
| CN120665195A (en) | 2015-06-24 | 2025-09-19 | 豪夫迈·罗氏有限公司 | Anti-transferrin receptor antibodies with tailored affinities |
| TWI899515B (en) | 2015-08-04 | 2025-10-01 | 美商再生元醫藥公司 | Taurine supplemented cell culture medium and methods of use |
| ES3052976T3 (en) | 2015-08-18 | 2026-01-16 | Regeneron Pharma | Anti-pcsk9 inhibitory antibodies for treating patients with hyperlipidemia undergoing lipoprotein apheresis |
| FI3769781T3 (en) * | 2015-08-19 | 2023-06-07 | Astrazeneca Ab | STABLE ANTI-IFNAR1 FORMULATION |
| EP3932953A1 (en) | 2015-08-28 | 2022-01-05 | F. Hoffmann-La Roche AG | Anti-hypusine antibodies and uses thereof |
| CA2993423C (en) | 2015-09-18 | 2024-03-12 | Chugai Seiyaku Kabushiki Kaisha | Il-8-binding antibodies and uses thereof |
| RU2763916C2 (en) | 2015-09-23 | 2022-01-11 | Дженентек, Инк. | Optimized options of anti-vegf antibodies |
| HK1252996A1 (en) | 2015-09-24 | 2019-06-06 | 豪夫迈.罗氏有限公司 | Methods for the treatment of epilepsy |
| JP6955487B2 (en) | 2015-09-24 | 2021-10-27 | アブビトロ, エルエルシー | HIV antibody composition and usage |
| HRP20241752T1 (en) | 2015-09-25 | 2025-02-28 | F. Hoffmann - La Roche Ag | ANTI-TIGIT ANTIBODIES AND METHODS OF USE |
| JP6921062B2 (en) * | 2015-09-28 | 2021-08-18 | スーヂョウ サンケイディア バイオファーマスーティカルズ カンパニー リミテッド | Stable anti-PD-1 antibody pharmaceutical preparation and its application in pharmaceuticals |
| AR106188A1 (en) | 2015-10-01 | 2017-12-20 | Hoffmann La Roche | ANTI-CD19 HUMANIZED HUMAN ANTIBODIES AND METHODS OF USE |
| PE20181092A1 (en) | 2015-10-02 | 2018-07-09 | Hoffmann La Roche | ANTI-PD1 ANTIBODIES AND METHODS OF USE |
| MX2018003820A (en) | 2015-10-02 | 2018-12-10 | F Hoffmann La Roche Ag | Bispecific antibodies specific for a costimulatory tnf receptor. |
| AU2016333512B2 (en) | 2015-10-02 | 2022-11-17 | F. Hoffmann-La Roche Ag | Bispecific anti-human CD20/human transferrin receptor antibodies and methods of use |
| EP3150636A1 (en) | 2015-10-02 | 2017-04-05 | F. Hoffmann-La Roche AG | Tetravalent multispecific antibodies |
| AR106189A1 (en) | 2015-10-02 | 2017-12-20 | Hoffmann La Roche | BIESPECTIFIC ANTIBODIES AGAINST HUMAN A-b AND THE HUMAN TRANSFERRINE RECEIVER AND METHODS OF USE |
| MA43345A (en) | 2015-10-02 | 2018-08-08 | Hoffmann La Roche | PYRROLOBENZODIAZEPINE ANTIBODY-DRUG CONJUGATES AND METHODS OF USE |
| ES2886569T3 (en) | 2015-10-02 | 2021-12-20 | Hoffmann La Roche | Bispecific antibodies specific for PD1 and TIM3 |
| KR20180075537A (en) | 2015-10-06 | 2018-07-04 | 제넨테크, 인크. | Methods for treating multiple sclerosis |
| RU2018116402A (en) | 2015-10-07 | 2019-11-07 | Ф. Хоффманн-Ля Рош Аг | BESPECIFIC ANTIBODIES FOUR PRINCIPLES REGARDING THE COSTIMULATORY TNF RECEPTOR |
| MA45326A (en) | 2015-10-20 | 2018-08-29 | Genentech Inc | CALICHEAMICIN-ANTIBODY-DRUG CONJUGATES AND METHODS OF USE |
| MA45517B1 (en) | 2015-10-23 | 2021-04-30 | Merus Nv | Cancer growth inhibitor binding molecules |
| EP3184547A1 (en) | 2015-10-29 | 2017-06-28 | F. Hoffmann-La Roche AG | Anti-tpbg antibodies and methods of use |
| MA44334A (en) | 2015-10-29 | 2018-09-05 | Novartis Ag | ANTIBODY CONJUGATES INCLUDING A TOLL-TYPE RECEPTOR AGONIST |
| EP3368074A2 (en) | 2015-10-30 | 2018-09-05 | Hoffmann-La Roche AG | Anti-factor d antibodies and conjugates |
| EP3368579B1 (en) | 2015-10-30 | 2021-11-24 | F. Hoffmann-La Roche AG | Hinge modified antibody fragments and methods of making |
| JP6998869B2 (en) | 2015-11-08 | 2022-02-04 | ジェネンテック, インコーポレイテッド | Screening method for multispecific antibody |
| EP3374399A1 (en) | 2015-11-11 | 2018-09-19 | Opi Vi- IP Holdco LLC | Composition and methods for anti-tnfr2 antibodies |
| WO2017087280A1 (en) | 2015-11-16 | 2017-05-26 | Genentech, Inc. | Methods of treating her2-positive cancer |
| EP3377009B1 (en) | 2015-11-20 | 2020-10-28 | ForSight Vision4, Inc. | Porous structures for extended release drug delivery devices |
| US11058769B2 (en) * | 2015-12-07 | 2021-07-13 | Merck Patent Gmbh | Aqueous pharmaceutical formulation comprising anti-PD-L1 antibody Avelumab |
| CR20180364A (en) | 2015-12-18 | 2018-08-22 | Chugai Pharmaceutical Co Ltd | ANTI-C5 ANTIBODIES AND METHODS OF USE |
| TWI868415B (en) | 2015-12-18 | 2025-01-01 | 日商中外製藥股份有限公司 | Anti-myostatin antibodies, polypeptides containing variant fc regions, and methods of use |
| EP3400246B1 (en) | 2016-01-08 | 2020-10-21 | H. Hoffnabb-La Roche Ag | Methods of treating cea-positive cancers using pd-1 axis binding antagonists and anti-cea/anti-cd3 bispecific antibodies |
| KR20180100224A (en) | 2016-01-11 | 2018-09-07 | 노바르티스 아게 | Immune-stimulated humanized monoclonal antibodies against human interleukin-2, and fusion proteins thereof |
| SG11201805534TA (en) | 2016-01-13 | 2018-07-30 | Genmab As | Formulation for antibody and drug conjugate thereof |
| CA3011739A1 (en) | 2016-01-20 | 2017-07-27 | Genentech, Inc. | High dose treatments for alzheimer's disease |
| AU2017222620B2 (en) | 2016-02-24 | 2022-06-16 | Biomarin Pharmaceutical Inc. | Targeted therapeutic lysosomal enzyme fusion proteins, associated formulations and uses thereof |
| CN114191428B (en) * | 2016-03-02 | 2024-09-24 | 卫材研究发展管理有限公司 | Eribulin-based antibody-drug conjugates and methods of use |
| EP4112641A1 (en) | 2016-03-15 | 2023-01-04 | Chugai Seiyaku Kabushiki Kaisha | Methods of treating cancers using pd-1 axis binding antagonists and anti-gpc3 antibodies |
| EP3231813A1 (en) | 2016-03-29 | 2017-10-18 | F. Hoffmann-La Roche AG | Trimeric costimulatory tnf family ligand-containing antigen binding molecules |
| CN113017981B (en) | 2016-04-05 | 2023-07-25 | 弗赛特影像4股份有限公司 | drug delivery device |
| US20170319688A1 (en) | 2016-04-14 | 2017-11-09 | Genentech, Inc. | Anti-rspo3 antibodies and methods of use |
| CN109563164A (en) | 2016-04-15 | 2019-04-02 | 生物蛋白有限公司 | Anti-AXL antibodies, antibody fragment and their immunoconjugates with and application thereof |
| MX2018013342A (en) | 2016-05-02 | 2019-05-09 | Hoffmann La Roche | The contorsbody - a single chain target binder. |
| EP3243836A1 (en) | 2016-05-11 | 2017-11-15 | F. Hoffmann-La Roche AG | C-terminally fused tnf family ligand trimer-containing antigen binding molecules |
| JP7285076B2 (en) | 2016-05-11 | 2023-06-01 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Antigen-binding molecule comprising a TNF family ligand trimer and a tenascin-binding portion |
| JP7089483B2 (en) | 2016-05-11 | 2022-06-22 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Modified anti-tenascin antibody and usage |
| EP3243832A1 (en) | 2016-05-13 | 2017-11-15 | F. Hoffmann-La Roche AG | Antigen binding molecules comprising a tnf family ligand trimer and pd1 binding moiety |
| MX394735B (en) | 2016-05-13 | 2025-03-24 | Bioatla Llc | ANTI-ROR2 ANTIBODIES, ANTIBODY FRAGMENTS, THEIR IMMUNOCONJUGATES AND THEIR USES. |
| MA51586A (en) | 2016-06-02 | 2019-04-10 | Abbvie Inc | GLUCOCORTICOID RECEPTOR AND IMMUNOCONJUGATE AGONIST |
| CN109476648B (en) | 2016-06-06 | 2022-09-13 | 豪夫迈·罗氏有限公司 | Sevelamer antibody-drug conjugates and methods of use |
| BR112018074771A2 (en) | 2016-06-06 | 2019-03-06 | F. Hoffmann-La Roche Ag | fusion proteins for ophthalmology with increased eye retention |
| EP3472200B1 (en) | 2016-06-17 | 2026-01-28 | Chugai Seiyaku Kabushiki Kaisha | Anti-myostatin antibodies and methods of use |
| CN109563160B (en) | 2016-06-24 | 2023-02-28 | 豪夫迈·罗氏有限公司 | Anti-polyubiquitin multispecific antibody |
| CA3028238C (en) * | 2016-06-30 | 2024-01-02 | Celltrion Inc. | Stable liquid pharmaceutical preparation |
| EP3478717B1 (en) | 2016-07-04 | 2022-01-05 | F. Hoffmann-La Roche AG | Novel antibody format |
| CN109963871A (en) | 2016-08-05 | 2019-07-02 | 豪夫迈·罗氏有限公司 | Multivalent and multiepitopic antibodies with agonistic activity and methods of use |
| KR102102734B1 (en) | 2016-08-05 | 2020-04-22 | 추가이 세이야쿠 가부시키가이샤 | Composition for the treatment or prevention of IL-8 related diseases |
| WO2018029124A1 (en) | 2016-08-08 | 2018-02-15 | F. Hoffmann-La Roche Ag | Therapeutic and diagnostic methods for cancer |
| SG10201607778XA (en) | 2016-09-16 | 2018-04-27 | Chugai Pharmaceutical Co Ltd | Anti-Dengue Virus Antibodies, Polypeptides Containing Variant Fc Regions, And Methods Of Use |
| RS64550B1 (en) | 2016-09-23 | 2023-09-29 | Hoffmann La Roche | Uses of il-13 antagonists for treating atopic dermatitis |
| JP7089507B2 (en) | 2016-09-26 | 2022-06-22 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Predicting response to PD-1 axis inhibitors |
| EP3525829A1 (en) | 2016-10-11 | 2019-08-21 | Medimmune Limited | Antibody-drug conjugates with immune-mediated therapy agents |
| EP3532091A2 (en) | 2016-10-29 | 2019-09-04 | H. Hoffnabb-La Roche Ag | Anti-mic antibidies and methods of use |
| EP3534948A1 (en) | 2016-11-04 | 2019-09-11 | Genentech, Inc. | Treatment of her2-positive breast cancer |
| CN109923128A (en) | 2016-11-15 | 2019-06-21 | 基因泰克公司 | Administration for being treated with anti-CD20/ AntiCD3 McAb bispecific antibody |
| TW201829463A (en) | 2016-11-18 | 2018-08-16 | 瑞士商赫孚孟拉羅股份公司 | anti-HLA-G antibody and use thereof |
| JOP20190100A1 (en) | 2016-11-19 | 2019-05-01 | Potenza Therapeutics Inc | Anti-gitr antigen-binding proteins and methods of use thereof |
| JP7313684B2 (en) | 2016-11-21 | 2023-07-25 | キュレアブ ゲーエムベーハー | Anti-GP73 antibodies and immunoconjugates |
| CA3043487A1 (en) | 2016-11-21 | 2018-05-24 | Just Biotherapeutics, Inc. | Aflibercept formulations and uses thereof |
| TWI789371B (en) | 2016-12-07 | 2023-01-11 | 美商建南德克公司 | Anti-tau antibodies and methods of use |
| IL266911B2 (en) | 2016-12-07 | 2024-10-01 | Genentech Inc | Antibodies against tau and their uses in treating tauopathy, maintaining or increasing memory capacity or slowing memory loss |
| JP2020511408A (en) | 2016-12-12 | 2020-04-16 | ジェネンテック, インコーポレイテッド | Method of treating cancer using anti-PD-L1 antibody and anti-androgen drug |
| KR20190097107A (en) | 2016-12-14 | 2019-08-20 | 프로제너티, 인크. | Treatment and apparatus of gastrointestinal diseases with JAK inhibitors |
| WO2018112232A1 (en) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Treatment of a disease of the gastrointestinal tract with an il-12/il-23 inhibitor released using an ingestible device |
| EP3554541B1 (en) | 2016-12-14 | 2023-06-07 | Biora Therapeutics, Inc. | Treatment of a disease of the gastrointestinal tract with a chemokine/chemokine receptor inhibitor |
| US11426566B2 (en) | 2016-12-14 | 2022-08-30 | Biora Therapeutics, Inc. | Treatment of a disease of the gastrointestinal tract with a TLR modulator |
| AU2017378406A1 (en) | 2016-12-14 | 2019-06-13 | Biora Therapeutics, Inc. | Treatment of a disease of the gastrointestinal tract with an immunosuppressant |
| CN118873822A (en) | 2016-12-14 | 2024-11-01 | 比奥拉治疗股份有限公司 | Using TNF inhibitors to treat gastrointestinal disorders |
| EP3554345A1 (en) | 2016-12-14 | 2019-10-23 | Progenity, Inc. | Treatment of a disease of the gastrointestinal tract with a smad7 inhibitor |
| CN116712540A (en) | 2016-12-14 | 2023-09-08 | 比奥拉治疗股份有限公司 | Treatment of gastrointestinal disorders using integrin inhibitors |
| CA3046093A1 (en) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Treatment of a disease of the gastrointestinal tract with an il-1 inhibitor |
| WO2018112237A1 (en) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Treatment of a disease of the gastrointestinal tract with an il-6r inhibitor |
| CN110087682B (en) | 2016-12-19 | 2023-12-15 | 豪夫迈·罗氏有限公司 | Combination therapy with targeted 4-1BB (CD137) agonists |
| EP3559034B1 (en) | 2016-12-20 | 2020-12-02 | H. Hoffnabb-La Roche Ag | Combination therapy of anti-cd20/anti-cd3 bispecific antibodies and 4-1bb (cd137) agonists |
| AU2017381656B2 (en) | 2016-12-21 | 2020-07-02 | F. Hoffmann-La Roche Ag | Re-use of enzymes in in vitro glycoengineering of antibodies |
| WO2018114879A1 (en) | 2016-12-21 | 2018-06-28 | F. Hoffmann-La Roche Ag | Method for in vitro glycoengineering of antibodies |
| MX2019006266A (en) | 2016-12-21 | 2019-08-21 | Hoffmann La Roche | In vitro glycoengineering of antibodies. |
| WO2018119312A1 (en) | 2016-12-22 | 2018-06-28 | Genentech, Inc. | Methods and formulations for reducing reconstitution time of lyophilized polypeptides |
| JOP20190134A1 (en) | 2016-12-23 | 2019-06-02 | Potenza Therapeutics Inc | Anti-neuropilin antigen-binding proteins and methods of use thereof |
| CN110325550B (en) | 2016-12-23 | 2024-03-08 | 诺华股份有限公司 | Factor XI Antibodies and How to Use |
| CN108239150A (en) | 2016-12-24 | 2018-07-03 | 信达生物制药(苏州)有限公司 | Anti- PCSK9 antibody and application thereof |
| CA3046092A1 (en) | 2016-12-28 | 2018-07-05 | Genentech, Inc. | Treatment of advanced her2 expressing cancer |
| MX2019007795A (en) | 2017-01-03 | 2019-08-16 | Hoffmann La Roche | BISPECIFIC ANTIGEN BINDING MOLECULES INCLUDING CLONE 20H4.9 ANTI-4-1BB. |
| CN117752782A (en) | 2017-01-17 | 2024-03-26 | 豪夫迈·罗氏有限公司 | Subcutaneous HER2 antibody formulation |
| EP3580240A1 (en) | 2017-02-10 | 2019-12-18 | H. Hoffnabb-La Roche Ag | Anti-tryptase antibodies, compositions thereof, and uses thereof |
| AU2018227036B2 (en) * | 2017-03-01 | 2021-07-08 | Medimmune Limited | Formulations of monoclonal antibodies |
| KR20190096384A (en) | 2017-03-02 | 2019-08-19 | 제넨테크, 인크. | HER2-positive breast cancer adjuvant treatment |
| MX2019011141A (en) | 2017-03-22 | 2019-11-05 | Genentech Inc | Optimized antibody compositions for treatment of ocular disorders. |
| CN108623686A (en) | 2017-03-25 | 2018-10-09 | 信达生物制药(苏州)有限公司 | Anti- OX40 antibody and application thereof |
| CN110494446A (en) | 2017-03-28 | 2019-11-22 | 基因泰克公司 | Methods of treating neurodegenerative diseases |
| WO2018178074A1 (en) | 2017-03-29 | 2018-10-04 | F. Hoffmann-La Roche Ag | Trimeric antigen binding molecules specific for a costimulatory tnf receptor |
| WO2018178055A1 (en) | 2017-03-29 | 2018-10-04 | F. Hoffmann-La Roche Ag | Bispecific antigen binding molecule for a costimulatory tnf receptor |
| CN110382542B (en) | 2017-03-29 | 2023-06-09 | 豪夫迈·罗氏有限公司 | Bispecific antigen-binding molecules targeting co-stimulatory TNF receptors |
| US20210401895A1 (en) | 2017-03-30 | 2021-12-30 | Progenity, Inc. | Treatment of a disease of the gastrointestinal tract with live biotherapeutics |
| JOP20190203A1 (en) | 2017-03-30 | 2019-09-03 | Potenza Therapeutics Inc | Anti-tigit antigen-binding proteins and methods of use thereof |
| CA3054159A1 (en) | 2017-03-30 | 2018-10-04 | Progenity, Inc. | Treatment of a disease of the gastrointestinal tract with a chst15 inhibitor |
| EP3600414A1 (en) | 2017-03-30 | 2020-02-05 | Progenity Inc. | Treatment of a disease of the gastrointestinal tract with il-10 or an il-10 agonist |
| EP4108183A1 (en) | 2017-03-30 | 2022-12-28 | Biora Therapeutics, Inc. | Treatment of a disease of the gastrointestinal tract with an immune modulatory agent released using an ingestible device |
| WO2018183932A1 (en) | 2017-03-30 | 2018-10-04 | Progenity Inc. | Treatment of a disease of the gastrointestinal tract with a il-13 inhibitor |
| MX2019011660A (en) | 2017-03-31 | 2019-11-18 | Merus Nv | Erbb-2 and erbb3 binding bispecific antibodies for use in the treatment f cells that have an nrg1 fusion gene. |
| EP3603669B1 (en) | 2017-03-31 | 2024-06-19 | Meiji Seika Pharma Co., Ltd. | Aqueous formulation, aqueous formulation in injector, antibody protein disaggregating agent, and antibody protein disaggregation method |
| CA3053358A1 (en) | 2017-04-04 | 2018-10-11 | F. Hoffmann-La Roche Ag | Novel bispecific antigen binding molecules capable of specific binding to cd40 and to fap |
| PE20210256A1 (en) | 2017-04-05 | 2021-02-10 | Hoffmann La Roche | ANTI-LAG3 ANTIBODIES |
| TWI690538B (en) | 2017-04-05 | 2020-04-11 | 瑞士商赫孚孟拉羅股份公司 | Bispecific antibodies specifically binding to pd1 and lag3 |
| CN108686205B (en) * | 2017-04-07 | 2021-12-10 | 海正生物制药有限公司 | Lyophilized preparation of infliximab |
| CN108686204A (en) * | 2017-04-07 | 2018-10-23 | 浙江海正药业股份有限公司 | Include the infliximab composition of histidine buffer system |
| WO2018189220A1 (en) | 2017-04-13 | 2018-10-18 | F. Hoffmann-La Roche Ag | An interleukin-2 immunoconjugate, a cd40 agonist, and optionally a pd-1 axis binding antagonist for use in methods of treating cancer |
| WO2018191660A1 (en) | 2017-04-14 | 2018-10-18 | Genentech, Inc. | Diagnostic and therapeutic methods for cancer |
| TW201841656A (en) | 2017-04-21 | 2018-12-01 | 美商建南德克公司 | Use of klk5 antagonists for treatment of a disease |
| EP3615695A1 (en) | 2017-04-24 | 2020-03-04 | Genentech, Inc. | Erbb2/her2 mutations in the transmebrane or juxtamembrane domain |
| EP3615572A1 (en) | 2017-04-27 | 2020-03-04 | Tesaro Inc. | Antibody agents directed against lymphocyte activation gene-3 (lag-3) and uses thereof |
| AR111651A1 (en) | 2017-04-28 | 2019-08-07 | Novartis Ag | CONJUGATES OF ANTIBODIES THAT INCLUDE TOLL TYPE RECEIVER AGONISTS AND COMBINATION THERAPIES |
| US11851486B2 (en) | 2017-05-02 | 2023-12-26 | National Center Of Neurology And Psychiatry | Method for predicting and evaluating therapeutic effect in diseases related to IL-6 and neutrophils |
| JOP20190260A1 (en) | 2017-05-02 | 2019-10-31 | Merck Sharp & Dohme | Stable formulations of programmed death receptor 1 (pd-1) antibodies and methods of use thereof |
| RU2019138507A (en) | 2017-05-02 | 2021-06-02 | Мерк Шарп И Доум Корп. | ANTIBODY AGAINST LAG3 AND JOINT ANTIBODY AGAINST LAG3 AND ANTIBODY AGAINST PD-1 |
| TWI797124B (en) | 2017-05-05 | 2023-04-01 | 香港商安立璽榮生醫(香港)有限公司 | Anti-interferon gamma antibodies and uses thereof |
| SG11202003754YA (en) | 2017-05-16 | 2020-05-28 | Bhamis Research Laboratory Pvt Ltd | High concentration protein formulations with reduced viscosity |
| BR112019024230A2 (en) | 2017-05-17 | 2020-06-09 | Merus N.V. | combination of an erbb-2 / erbb-3 bispecific antibody with endocrine therapy for breast cancer |
| EP3625252A1 (en) | 2017-05-18 | 2020-03-25 | H. Hoffnabb-La Roche Ag | Reduction of application-related side reaction of a therapeutic antibody |
| CN118356488A (en) * | 2017-05-30 | 2024-07-19 | 百时美施贵宝公司 | Compositions comprising anti-LAG-3 antibodies or anti-LAG-3 antibodies and anti-PD-1 or anti-PD-L1 antibodies |
| EP3418302A1 (en) | 2017-06-19 | 2018-12-26 | F. Hoffmann-La Roche AG | Administration routes for immune agonists |
| JP2020521788A (en) | 2017-06-02 | 2020-07-27 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | Route of administration of immune agonist |
| SG11202000658PA (en) | 2017-07-26 | 2020-02-27 | Forty Seven Inc | Anti-sirp-alpha antibodies and related methods |
| JP7407699B2 (en) | 2017-07-28 | 2024-01-04 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Bispecific antibody preparation |
| AU2018312816B2 (en) | 2017-08-09 | 2021-05-27 | Merus N.V. | Antibodies that bind EGFR and cMET |
| EP3665197A2 (en) | 2017-08-11 | 2020-06-17 | H. Hoffnabb-La Roche Ag | Anti-cd8 antibodies and uses thereof |
| WO2019036363A1 (en) | 2017-08-14 | 2019-02-21 | Progenity Inc. | Treatment of a disease of the gastrointestinal tract with glatiramer or a pharmaceutically acceptable salt thereof |
| CA3070774A1 (en) | 2017-08-25 | 2019-02-28 | Five Prime Therapeutics, Inc. | B7-h4 antibodies and methods of use thereof |
| CN109422811A (en) | 2017-08-29 | 2019-03-05 | 信达生物制药(苏州)有限公司 | Anti-CD47 antibody and use thereof |
| EP3684413A1 (en) | 2017-09-20 | 2020-07-29 | Chugai Seiyaku Kabushiki Kaisha | Dosage regimen for combination therapy using pd-1 axis binding antagonists and gpc3 targeting agent |
| UA128389C2 (en) | 2017-09-29 | 2024-07-03 | Чугаі Сейяку Кабусікі Кайся | A MULTISPECIFIC ANTIGEN-BINDING MOLECULE HAVING THE ACTIVITY TO REPLACE THE COFACTOR FUNCTION OF BLOOD COAGULATION FACTOR VIII (FVIII) AND A PHARMACEUTICAL COMPOSITION CONTAINING SAID MOLECULE AS AN ACTIVE INGREDIENT |
| PE20210115A1 (en) | 2017-10-16 | 2021-01-19 | Eisai Randd Man Co Ltd | ANTI-TAU ANTIBODIES AND USE OF THEM |
| AU2018358883B2 (en) | 2017-10-30 | 2025-09-25 | F. Hoffmann-La Roche Ag | Method for in vivo generation of multispecific antibodies from monospecific antibodies |
| TW201930353A (en) | 2017-11-01 | 2019-08-01 | 瑞士商赫孚孟拉羅股份公司 | Combination therapy with targeted OX40 agonists |
| JP2021500902A (en) | 2017-11-01 | 2021-01-14 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | New TNF family ligand trimer-containing antigen-binding molecule |
| MX2020004571A (en) | 2017-11-01 | 2020-08-24 | Hoffmann La Roche | CONTORSBODIES 2+1 BISPECIFIC. |
| EP3704150A1 (en) | 2017-11-01 | 2020-09-09 | F. Hoffmann-La Roche AG | The compbody - a multivalent target binder |
| ES2907054T3 (en) | 2017-11-01 | 2022-04-21 | Hoffmann La Roche | TriFab-Contorsbody |
| CN111246886B (en) * | 2017-11-02 | 2022-03-15 | 正大天晴药业集团股份有限公司 | Pharmaceutical composition of anti-PD-L1 humanized monoclonal antibody |
| JP7731196B2 (en) | 2017-11-14 | 2025-08-29 | 中外製薬株式会社 | Anti-C1s Antibodies and Methods of Use |
| EP3713591A1 (en) | 2017-11-20 | 2020-09-30 | Just-Evotec Biologics, Inc. | Aflibercept formulations containing a lysine salt as tonicifying agent and uses thereof |
| WO2019103906A1 (en) | 2017-11-21 | 2019-05-31 | Forsight Vision4, Inc. | Fluid exchange apparatus for expandable port delivery system and methods of use |
| US20220071901A1 (en) * | 2017-11-30 | 2022-03-10 | Bio-Thera Solutions, Ltd. | A liquid formulation of humanized antibody for treating il-6-mediated diseases |
| PE20201286A1 (en) | 2017-12-01 | 2020-11-24 | Abbvie Inc | GLUCOCORTICOID RECEPTOR AGONIST AND IMMUNOCONJUGATES OF THIS |
| EP3502140A1 (en) | 2017-12-21 | 2019-06-26 | F. Hoffmann-La Roche AG | Combination therapy of tumor targeted icos agonists with t-cell bispecific molecules |
| EP3728321A1 (en) | 2017-12-22 | 2020-10-28 | F. Hoffmann-La Roche AG | Use of pilra binding agents for treatment of a disease |
| WO2019129137A1 (en) | 2017-12-27 | 2019-07-04 | 信达生物制药(苏州)有限公司 | Anti-lag-3 antibody and uses thereof |
| CN115925943A (en) | 2017-12-27 | 2023-04-07 | 信达生物制药(苏州)有限公司 | Anti-PD-L1 antibodies and uses thereof |
| WO2019129136A1 (en) | 2017-12-27 | 2019-07-04 | 信达生物制药(苏州)有限公司 | Anti-pd-l1 antibody and uses thereof |
| EP3731865A1 (en) | 2017-12-29 | 2020-11-04 | F. Hoffmann-La Roche AG | Method for improving vegf-receptor blocking selectivity of an anti-vegf antibody |
| AU2019205090A1 (en) | 2018-01-05 | 2020-08-06 | Ac Immune Sa | Misfolded TDP-43 binding molecules |
| US12247060B2 (en) | 2018-01-09 | 2025-03-11 | Marengo Therapeutics, Inc. | Calreticulin binding constructs and engineered T cells for the treatment of diseases |
| CA3088649A1 (en) | 2018-01-16 | 2019-07-25 | Lakepharma, Inc. | Bispecific antibody that binds cd3 and another target |
| US20210031012A1 (en) | 2018-01-26 | 2021-02-04 | Progenity, Inc. | Treatment of a disease of the gastrointestinal tract with a pde4 inhibitor |
| EP3743437A1 (en) | 2018-01-26 | 2020-12-02 | F. Hoffmann-La Roche AG | Il-22 fc fusion proteins and methods of use |
| SI3743088T1 (en) * | 2018-01-26 | 2023-01-31 | F. Hoffmann - La Roche Ag | Il-22 fc compositions and methods of use |
| CA3081125C (en) | 2018-02-01 | 2025-09-16 | Innovent Biologics (Suzhou) Co., Ltd. | Fully humanized anti-b cell maturation antigen (bcma) single-chain antibody and use thereof |
| WO2019153200A1 (en) | 2018-02-08 | 2019-08-15 | 北京韩美药品有限公司 | Anti-pd-1/anti-her2 natural antibody structure-like bispecific antibody in heterodimeric form and preparation thereof |
| CN111757894B (en) | 2018-02-14 | 2025-02-25 | Abba疗法股份公司 | Anti-human PD-L2 antibody |
| CN111757751A (en) | 2018-02-21 | 2020-10-09 | 豪夫迈·罗氏有限公司 | Dosage regimen for treatment with IL-22 Fc fusion protein |
| SG11202007821WA (en) * | 2018-02-21 | 2020-09-29 | Five Prime Therapeutics Inc | B7-h4 antibody formulations |
| CA3092108A1 (en) | 2018-02-26 | 2019-08-29 | Genentech, Inc. | Dosing for treatment with anti-tigit and anti-pd-l1 antagonist antibodies |
| KR20200144094A (en) | 2018-03-02 | 2020-12-28 | 파이브 프라임 테라퓨틱스, 인크. | B7-H4 antibody and methods of use thereof |
| CA3092002A1 (en) | 2018-03-13 | 2019-09-19 | F. Hoffmann-La Roche Ag | Therapeutic combination of 4-1 bb agonists with anti-cd20 antibodies |
| TWI841551B (en) | 2018-03-13 | 2024-05-11 | 瑞士商赫孚孟拉羅股份公司 | Combination therapy with targeted 4-1bb (cd137) agonists |
| US20200040103A1 (en) | 2018-03-14 | 2020-02-06 | Genentech, Inc. | Anti-klk5 antibodies and methods of use |
| US12152073B2 (en) | 2018-03-14 | 2024-11-26 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
| US11891432B2 (en) | 2018-03-15 | 2024-02-06 | Chugai Seiyaku Kabushiki Kaisha | Anti-dengue virus antibodies having cross-reactivity to Zika virus and methods of use |
| TWI841554B (en) | 2018-03-21 | 2024-05-11 | 丹麥商珍美寶股份有限公司 | Methods of treating cancer with a combination of a platinum-based agent and an anti-tissue factor antibody-drug conjugate |
| US11840568B2 (en) | 2018-04-02 | 2023-12-12 | Mab-Venture Biopharm Co., Ltd. | Lymphocyte activation gene-3 (LAG-3) binding antibody and use thereof |
| WO2019195313A1 (en) * | 2018-04-04 | 2019-10-10 | Pollack Aryeh L | Anti-vegf antagonist and pedf agonist constructs and uses thereof |
| JP2021521159A (en) * | 2018-04-10 | 2021-08-26 | ドクター レディズ ラボラトリーズ リミテッド | Antibody preparation |
| AR114284A1 (en) | 2018-04-13 | 2020-08-12 | Hoffmann La Roche | HER2 TARGETING ANTIGEN BINDING MOLECULES COMPOSING 4-1BBL |
| AR114789A1 (en) | 2018-04-18 | 2020-10-14 | Hoffmann La Roche | ANTI-HLA-G ANTIBODIES AND THE USE OF THEM |
| AR115052A1 (en) | 2018-04-18 | 2020-11-25 | Hoffmann La Roche | MULTI-SPECIFIC ANTIBODIES AND THE USE OF THEM |
| EP3560945A1 (en) | 2018-04-27 | 2019-10-30 | F. Hoffmann-La Roche AG | Methods for purification of polypeptides using polysorbates |
| BR112020022642A2 (en) | 2018-05-07 | 2021-02-17 | Genmab A/S | method to treat cancer in an individual, and, kit |
| CN118948760A (en) | 2018-05-10 | 2024-11-15 | 瑞泽恩制药公司 | Preparations containing high concentrations of VEGF receptor fusion protein |
| MX2020012418A (en) | 2018-05-23 | 2021-04-28 | Adc Therapeutics Sa | Molecular adjuvant. |
| US12168691B2 (en) | 2018-05-31 | 2024-12-17 | Board Of Regents, The University Of Texas System | VHS format bi-specific antibodies specific for HER2 and VEGF and use thereof |
| JP7372237B2 (en) | 2018-06-04 | 2023-10-31 | 中外製薬株式会社 | Antigen-binding molecules with altered half-lives in the cytoplasm |
| EP3810095A1 (en) | 2018-06-20 | 2021-04-28 | Progenity, Inc. | Treatment of a disease of the gastrointestinal tract with a tnf inhibitor |
| EP3810085A1 (en) | 2018-06-20 | 2021-04-28 | Progenity, Inc. | Treatment of a disease of the gastrointestinal tract with an integrin inhibitor |
| US20210363233A1 (en) | 2018-06-20 | 2021-11-25 | Progenity, Inc. | Treatment of a disease of the gastrointestinal tract with an il-12/il-23 inhibitor |
| US12171764B2 (en) | 2018-06-20 | 2024-12-24 | Biora Therapeutics, Inc. | Treatment of a disease of the gastrointestinal tract with a JAK or other kinase inhibitor |
| WO2019246317A1 (en) | 2018-06-20 | 2019-12-26 | Progenity, Inc. | Treatment of a disease or condition in a tissue originating from the endoderm |
| US20230041197A1 (en) | 2018-06-20 | 2023-02-09 | Progenity, Inc. | Treatment of a disease of the gastrointestinal tract with an immunomodulator |
| MY205645A (en) | 2018-06-23 | 2024-11-02 | Genentech Inc | Methods of treating lung cancer with a pd-1 axis binding antagonist, a platinum agent, and a topoisomerase ii inhibitor |
| AU2019297451A1 (en) | 2018-07-03 | 2021-01-28 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| TW202035447A (en) | 2018-07-04 | 2020-10-01 | 瑞士商赫孚孟拉羅股份公司 | Novel bispecific agonistic 4-1bb antigen binding molecules |
| AU2019305637A1 (en) | 2018-07-18 | 2021-03-11 | Genentech, Inc. | Methods of treating lung cancer with a PD-1 axis binding antagonist, an antimetabolite, and a platinum agent |
| CN110732023B (en) * | 2018-07-18 | 2023-06-16 | 江苏恒瑞医药股份有限公司 | HER2 antibody pharmaceutical composition and application thereof |
| WO2020017901A1 (en) * | 2018-07-19 | 2020-01-23 | (주)셀트리온 | Stable liquid pharmaceutical preparation |
| SG11202100373VA (en) | 2018-07-20 | 2021-02-25 | Surface Oncology Inc | Anti-cd112r compositions and methods |
| KR20210040827A (en) | 2018-07-25 | 2021-04-14 | 이노벤트 바이오로직스 (쑤저우) 컴퍼니, 리미티드 | Anti TIGIT antibody and its use |
| CN113286824A (en) | 2018-08-03 | 2021-08-20 | 中外制药株式会社 | Antigen binding molecules comprising two antigen binding domains linked to each other |
| CN112839960B (en) | 2018-08-10 | 2024-09-06 | 中外制药株式会社 | Anti-CD137 antigen binding molecules and their applications |
| TW202021618A (en) | 2018-08-17 | 2020-06-16 | 美商23與我有限公司 | Anti-il1rap antibodies and methods of use thereof |
| JP7475336B2 (en) | 2018-09-21 | 2024-04-26 | ジェネンテック, インコーポレイテッド | Diagnostic methods for triple-negative breast cancer |
| JP7512210B2 (en) | 2018-09-21 | 2024-07-08 | イノベント バイオロジックス (スウツォウ) カンパニー,リミテッド | Novel interleukin 2 and uses thereof |
| AU2019344875B2 (en) | 2018-09-21 | 2021-12-23 | Innovent Biologics (Suzhou) Co., Ltd. | Novel interleukin 2 and use thereof |
| MX2021003548A (en) | 2018-10-01 | 2021-05-27 | Hoffmann La Roche | Bispecific antigen binding molecules comprising anti-fap clone 212. |
| EP3861025A1 (en) | 2018-10-01 | 2021-08-11 | F. Hoffmann-La Roche AG | Bispecific antigen binding molecules with trivalent binding to cd40 |
| WO2020081493A1 (en) | 2018-10-16 | 2020-04-23 | Molecular Templates, Inc. | Pd-l1 binding proteins |
| MA54052A (en) | 2018-10-29 | 2022-02-09 | Hoffmann La Roche | ANTIBODY FORMULATION |
| TWI844571B (en) | 2018-10-30 | 2024-06-11 | 丹麥商珍美寶股份有限公司 | Methods of treating cancer with a combination of an anti-vegf antibody and an anti-tissue factor antibody-drug conjugate |
| CN113454111A (en) * | 2018-11-06 | 2021-09-28 | 健玛保 | Antibody formulation |
| MX2021005394A (en) | 2018-11-07 | 2021-07-06 | Merck Sharp & Dohme Llc | Co-formulations of anti-lag3 antibodies and anti-pd-1 antibodies. |
| CA3101670C (en) | 2018-11-27 | 2024-02-06 | Innovent Biologics (Suzhou) Co., Ltd. | Anti-il-23p19 antibody and use thereof |
| JP7671248B2 (en) | 2018-12-05 | 2025-05-01 | ジェネンテック, インコーポレイテッド | Diagnostic methods and compositions for cancer immunotherapy |
| KR20210100668A (en) | 2018-12-06 | 2021-08-17 | 제넨테크, 인크. | Combination therapy of diffuse large B-cell lymphoma comprising an anti-CD79b immunoconjugate, an alkylating agent and an anti-CD20 antibody |
| SG11202104012QA (en) * | 2018-12-14 | 2021-05-28 | Morphosys Ag | Antibody formulations |
| CA3119241A1 (en) * | 2018-12-18 | 2020-06-25 | Novartis Ag | Protein solution formulation containing high concentration of an anti-vegf antibody |
| AR117327A1 (en) | 2018-12-20 | 2021-07-28 | 23Andme Inc | ANTI-CD96 ANTIBODIES AND METHODS OF USE OF THEM |
| TW202035442A (en) | 2018-12-20 | 2020-10-01 | 美商建南德克公司 | Modified antibody fcs and methods of use |
| EP3898682A1 (en) | 2018-12-21 | 2021-10-27 | F. Hoffmann-La Roche AG | Tumor-targeted agonistic cd28 antigen binding molecules |
| CN113195531B (en) | 2018-12-21 | 2025-03-04 | 豪夫迈·罗氏有限公司 | Antibodies that bind to VEGF and IL-1β and methods of use thereof |
| CN113286822A (en) | 2018-12-21 | 2021-08-20 | 豪夫迈·罗氏有限公司 | Tumor-targeting hyperactive CD28 antigen binding molecules |
| JP2022514950A (en) | 2018-12-21 | 2022-02-16 | 23アンドミー・インコーポレイテッド | Anti-IL-36 antibody and how to use it |
| CN111375057B (en) * | 2018-12-28 | 2024-06-21 | 上海复宏汉霖生物技术股份有限公司 | Pharmaceutical formulation comprising anti-Her 2 monoclonal antibody |
| US20220073630A1 (en) | 2018-12-28 | 2022-03-10 | Hoffmann-La Roche, Inc. | A peptide-mhc-i-antibody fusion protein for therapeutic use in a patient with amplified immune response |
| MX2021008434A (en) | 2019-01-14 | 2021-09-23 | Genentech Inc | Methods of treating cancer with a pd-1 axis binding antagonist and an rna vaccine. |
| CN113329763A (en) | 2019-01-22 | 2021-08-31 | 豪夫迈·罗氏有限公司 | Immunoglobulin a antibodies and methods of making and using |
| JPWO2020153467A1 (en) | 2019-01-24 | 2021-12-02 | 中外製薬株式会社 | New cancer antigens and antibodies against those antigens |
| TWI756621B (en) | 2019-01-25 | 2022-03-01 | 大陸商信達生物製藥(蘇州)有限公司 | Novel bispecific antibody molecules and bispecific antibodies that simultaneously bind pd-l1 and lag-3 |
| US11634485B2 (en) | 2019-02-18 | 2023-04-25 | Eli Lilly And Company | Therapeutic antibody formulation |
| AU2020224681A1 (en) | 2019-02-21 | 2021-09-16 | Marengo Therapeutics, Inc. | Antibody molecules that bind to NKp30 and uses thereof |
| SG11202109061YA (en) | 2019-02-21 | 2021-09-29 | Marengo Therapeutics Inc | Multifunctional molecules that bind to t cell related cancer cells and uses thereof |
| KR20210133237A (en) | 2019-02-27 | 2021-11-05 | 제넨테크, 인크. | Dosing for treatment with anti-TIGIT and anti-CD20 or anti-CD38 antibodies |
| CN111686247B (en) * | 2019-03-13 | 2022-07-29 | 苏州康乃德生物医药有限公司 | Liquid composition comprising antibody to human interleukin-4 receptor alpha |
| JP7730761B2 (en) | 2019-03-14 | 2025-08-28 | ジェネンテック, インコーポレイテッド | Treatment of cancer with HER2xCD3 bispecific antibodies in combination with anti-HER2 MAB |
| TW202519263A (en) * | 2019-03-21 | 2025-05-16 | 美商再生元醫藥公司 | Stabilized formulations containing anti-il-33 antibodies |
| EP3952996A1 (en) | 2019-04-12 | 2022-02-16 | F. Hoffmann-La Roche AG | Bispecific antigen binding molecules comprising lipocalin muteins |
| TW202043291A (en) | 2019-04-19 | 2020-12-01 | 美商建南德克公司 | Anti-mertk antibodies and methods of use |
| TWI879768B (en) | 2019-05-03 | 2025-04-11 | 美商建南德克公司 | Methods of treating cancer with an anti-pd-l1 antibody |
| CA3136831A1 (en) * | 2019-05-03 | 2020-11-12 | Five Prime Therapeutics, Inc. | Pharmaceutical formulations containing cd80 extracellular domain-fc fusion proteins |
| AU2020275415B2 (en) | 2019-05-14 | 2026-01-15 | Genentech, Inc. | Methods of using anti-CD79B immunoconjugates to treat follicular lymphoma |
| KR20220012270A (en) | 2019-05-23 | 2022-02-03 | 에이씨 이뮨 에스.에이. | Anti-TDP-43 binding molecules and uses thereof |
| BR112021024112A2 (en) | 2019-06-04 | 2022-03-22 | Jiangsu Hengrui Medicine Co | Antibody capable of binding to thymic stromal lymphopoietin and its use |
| CA3141378A1 (en) | 2019-06-26 | 2020-12-30 | F. Hoffmann-La Roche Ag | Fusion of an antibody binding cea and 4-1bbl |
| WO2020260326A1 (en) | 2019-06-27 | 2020-12-30 | F. Hoffmann-La Roche Ag | Novel icos antibodies and tumor-targeted antigen binding molecules comprising them |
| MX2022000111A (en) | 2019-07-10 | 2022-02-10 | Chugai Pharmaceutical Co Ltd | MOLECULES OF UNION TO CLAUDIN-6 AND THEIR USES. |
| AR119382A1 (en) | 2019-07-12 | 2021-12-15 | Hoffmann La Roche | PRE-TARGETING ANTIBODIES AND METHODS OF USE |
| WO2021021924A1 (en) * | 2019-07-29 | 2021-02-04 | Huang Cai Gu | Formulation of antibody based drugs for treating lung cancer by inhalation |
| AU2020336980B2 (en) * | 2019-08-29 | 2025-07-10 | Vir Biotechnology, Inc. | Antibody compositions and methods for treating hepatitis B virus infection |
| EP4021943A4 (en) * | 2019-08-30 | 2023-09-13 | Dragonfly Therapeutics, Inc. | PHARMACEUTICAL FORMULATIONS AND DOSAGE SCHEDULES FOR MULTI-SPECIFIC BINDING PROTEINS THAT BIND HER2, NKG2D AND CD16 FOR CANCER TREATMENT |
| WO2021046159A1 (en) | 2019-09-04 | 2021-03-11 | Genentech, Inc. | Cd8 binding agents and uses thereof |
| EP4031579A2 (en) | 2019-09-18 | 2022-07-27 | F. Hoffmann-La Roche AG | Anti-klk7 antibodies, anti-klk5 antibodies, multispecific anti-klk5/klk7 antibodies, and methods of use |
| AU2020351734A1 (en) | 2019-09-27 | 2022-04-14 | Genentech, Inc. | Dosing for treatment with anti-TIGIT and anti-PD-L1 antagonist antibodies |
| JP2023507053A (en) * | 2019-10-12 | 2023-02-21 | バイオ-セラ ソリューションズ リミテッド | Anti-CD20 Antibody Preparations and Use of Anti-CD20 Antibodies for Treatment of CD20-Positive Diseases |
| PH12022550835A1 (en) | 2019-10-18 | 2023-07-03 | Forty Seven Inc | Combination therapies for treating myelodysplastic syndromes and acute myeloid leukemia |
| CA3153880A1 (en) | 2019-10-18 | 2020-06-09 | Juana Elva HERNANDEZ MONTALVO | Methods of using anti-cd79b immunoconjugates to treat diffuse large b-cell lymphoma |
| WO2021079337A1 (en) * | 2019-10-23 | 2021-04-29 | Cadila Healthcare Limited | Pharmaceutical formulation of anti-her2 antibody and preparation thereof |
| US12297451B1 (en) | 2019-10-25 | 2025-05-13 | Regeneron Pharmaceuticals, Inc. | Cell culture medium |
| JP2022553803A (en) | 2019-11-06 | 2022-12-26 | ジェネンテック, インコーポレイテッド | Diagnostic and therapeutic methods for the treatment of blood cancers |
| EP4058061A1 (en) * | 2019-11-13 | 2022-09-21 | Pfizer Inc. | Stable aqueous anti-tfpi antibody formulation |
| US20220411482A1 (en) * | 2019-11-15 | 2022-12-29 | Silk Technologies, Ltd. | Stable formulations of silk-derived protein |
| WO2021111007A1 (en) * | 2019-12-06 | 2021-06-10 | CSL Behring Lengnau AG | Stable compositions of fc multimers |
| KR20220113790A (en) | 2019-12-13 | 2022-08-16 | 제넨테크, 인크. | Anti-LY6G6D Antibodies and Methods of Use |
| CU20190104A7 (en) * | 2019-12-17 | 2021-08-06 | Ct Inmunologia Molecular | STABLE FORMULATION OF THE NIMOTUZUMAB ANTIBODY |
| US11739142B2 (en) | 2019-12-18 | 2023-08-29 | Hoffmann-La Roche Inc. | Bispecific anti-CCL2 antibodies |
| KR20240035914A (en) | 2019-12-27 | 2024-03-18 | 추가이 세이야쿠 가부시키가이샤 | Anti-ctla-4 antibody and use thereof |
| EP4084823A4 (en) | 2020-01-03 | 2024-05-15 | Marengo Therapeutics, Inc. | Anti-tcr antibody molecules and uses thereof |
| CN114929734A (en) | 2020-01-09 | 2022-08-19 | 豪夫迈·罗氏有限公司 | Novel antigen binding molecules comprising 4-1BBL trimers |
| CN110818795B (en) | 2020-01-10 | 2020-04-24 | 上海复宏汉霖生物技术股份有限公司 | anti-TIGIT antibodies and methods of use |
| CA3168600A1 (en) * | 2020-01-21 | 2021-07-29 | Innovent Biologics (Suzhou) Co., Ltd. | Recombinant fully human anti-tigit monoclonal antibody formulation, method for preparing same and use thereof |
| WO2022050954A1 (en) | 2020-09-04 | 2022-03-10 | Genentech, Inc. | Dosing for treatment with anti-tigit and anti-pd-l1 antagonist antibodies |
| WO2021194481A1 (en) | 2020-03-24 | 2021-09-30 | Genentech, Inc. | Dosing for treatment with anti-tigit and anti-pd-l1 antagonist antibodies |
| CN116650628A (en) | 2020-01-31 | 2023-08-29 | 基因泰克公司 | Methods for Inducing Neoepitope-Specific T Cells Using PD-1 Axis Binding Antagonists and RNA Vaccines |
| WO2021160154A1 (en) | 2020-02-10 | 2021-08-19 | 上海诗健生物科技有限公司 | Cldn18.2 antibody and use thereof |
| US20230096452A1 (en) | 2020-02-10 | 2023-03-30 | Shanghai Escugen Biotechnology Co., Ltd. | Claudin 18.2 antibody and use thereof |
| TWI895351B (en) | 2020-02-12 | 2025-09-01 | 日商中外製藥股份有限公司 | Anti-CD137 antigen binding molecules for the treatment of cancer |
| US20230192832A1 (en) * | 2020-03-04 | 2023-06-22 | Shanghai Henlius Biotech, Inc. | Pharmaceutical formulation comprising bevacizumab |
| WO2021177980A1 (en) | 2020-03-06 | 2021-09-10 | Genentech, Inc. | Combination therapy for cancer comprising pd-1 axis binding antagonist and il6 antagonist |
| WO2021181317A1 (en) * | 2020-03-11 | 2021-09-16 | Lupin Limited | Monoclonal antibody pharmaceutical composition |
| JP7767298B2 (en) | 2020-03-13 | 2025-11-11 | ジェネンテック, インコーポレイテッド | Anti-interleukin-33 antibodies and uses thereof |
| KR102811560B1 (en) | 2020-03-19 | 2025-05-22 | 제넨테크, 인크. | Isotype-selective anti-TGF-beta antibodies and methods of use |
| CA3175728A1 (en) | 2020-03-19 | 2021-09-23 | Innovent Biologics (Suzhou) Co., Ltd. | Interleukin-2 mutant and use thereof |
| MX2022011752A (en) | 2020-03-24 | 2022-10-18 | Genentech Inc | Tie2-binding agents and methods of use. |
| EP4126940A1 (en) | 2020-03-30 | 2023-02-08 | F. Hoffmann-La Roche AG | Antibody that binds to vegf and pdgf-b and methods of use |
| AR121706A1 (en) | 2020-04-01 | 2022-06-29 | Hoffmann La Roche | OX40 AND FAP-TARGETED BSPECIFIC ANTIGEN-BINDING MOLECULES |
| WO2021207662A1 (en) | 2020-04-10 | 2021-10-14 | Genentech, Inc. | Use of il-22fc for the treatment or prevention of pneumonia, acute respiratory distress syndrome, or cytokine release syndrome |
| KR20230015328A (en) | 2020-04-17 | 2023-01-31 | 허치슨 메디파르마 리미티드 | Anti-OX40 Antibodies and Uses Thereof |
| BR112022021441A2 (en) | 2020-04-24 | 2022-12-13 | Genentech Inc | METHODS TO TREAT FOLLICULAR LYMPHOMA AND DIFFUSE LARGE B-CELL LYMPHOMA AND KITS |
| WO2021222167A1 (en) | 2020-04-28 | 2021-11-04 | Genentech, Inc. | Methods and compositions for non-small cell lung cancer immunotherapy |
| IL297830A (en) | 2020-05-03 | 2023-01-01 | Levena Suzhou Biopharma Co Ltd | Anti-drug compounds (adcs) comprising an anti-trop-2 antibody, compounds comprising such adcs, as well as methods for their production and use |
| JP2023524257A (en) | 2020-05-05 | 2023-06-09 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Prediction of response to PD-1 axis inhibitors |
| TWI802882B (en) * | 2020-05-13 | 2023-05-21 | 大陸商信達生物制藥(蘇州)有限公司 | Preparation comprising anti-IL-23p19 antibody, its preparation method and use |
| JP2023528375A (en) | 2020-05-29 | 2023-07-04 | 23アンドミー・インコーポレイテッド | ANTI-CD200R1 ANTIBODY AND METHOD OF USE THEREOF |
| WO2021247457A2 (en) | 2020-06-01 | 2021-12-09 | Genentech, Inc. | Methods for making extracellular vesicles and uses thereof |
| JP2023527918A (en) | 2020-06-08 | 2023-06-30 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Anti-HBV antibody and method of use |
| CN113769082A (en) * | 2020-06-10 | 2021-12-10 | 上海君实生物医药科技股份有限公司 | anti-IL-17A antibody pharmaceutical composition and application thereof |
| WO2021252977A1 (en) | 2020-06-12 | 2021-12-16 | Genentech, Inc. | Methods and compositions for cancer immunotherapy |
| FI129383B (en) * | 2020-06-15 | 2022-01-31 | Faron Pharmaceuticals Oy | STABLE ANTI-CLEVER-1 ANTIBODY FORMULATION |
| MX2022015877A (en) | 2020-06-16 | 2023-01-24 | Genentech Inc | Methods and compositions for treating triple-negative breast cancer. |
| MX2022015881A (en) | 2020-06-18 | 2023-01-24 | Genentech Inc | Treatment with anti-tigit antibodies and pd-1 axis binding antagonists. |
| US20230235040A1 (en) | 2020-06-22 | 2023-07-27 | Almirall, S.A. | Anti-il-36 antibodies and methods of use thereof |
| IL297880A (en) | 2020-06-23 | 2023-01-01 | Hoffmann La Roche | Agonistic cd28 antigen-binding molecules targeting her2 |
| JP2023531067A (en) | 2020-06-25 | 2023-07-20 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Anti-CD3/Anti-CD28 Bispecific Antigen Binding Molecules |
| IL299376A (en) | 2020-06-29 | 2023-02-01 | Genentech Inc | Pertuzuniab plus trastuzumab fixed dose combination |
| IL299150A (en) * | 2020-06-29 | 2023-02-01 | Hanall Biopharma Co Ltd | Anti-FCRN antibody formulation |
| MX2023000339A (en) | 2020-07-10 | 2023-02-09 | Hoffmann La Roche | Antibodies which bind to cancer cells and target radionuclides to said cells. |
| CN116406377A (en) | 2020-07-17 | 2023-07-07 | 基因泰克公司 | Anti-NOTCH2 antibodies and methods of use thereof |
| EP4189121A1 (en) | 2020-08-03 | 2023-06-07 | Genentech, Inc. | Diagnostic and therapeutic methods for lymphoma |
| JP2023537761A (en) | 2020-08-14 | 2023-09-05 | エイシー イミューン ソシエテ アノニム | Humanized anti-TDP-43 binding molecules and uses thereof |
| WO2022036129A1 (en) | 2020-08-14 | 2022-02-17 | F. Hoffmann-La Roche Ag | Methods for treating multiple sclerosis with ocrelizumab |
| EP4204448A2 (en) | 2020-08-27 | 2023-07-05 | cureab GmbH | Anti-golph2 antibodies for macrophage and dendritic cell differentiation |
| EP4208201A1 (en) | 2020-09-04 | 2023-07-12 | F. Hoffmann-La Roche AG | Antibody that binds to vegf-a and ang2 and methods of use |
| PE20231575A1 (en) | 2020-09-14 | 2023-10-04 | Ichnos Sciences SA | ANTIBODIES THAT BIND IL1RAP AND USES OF THESE |
| TWI836278B (en) | 2020-10-05 | 2024-03-21 | 美商建南德克公司 | Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies |
| CN116685325A (en) | 2020-10-20 | 2023-09-01 | 豪夫迈·罗氏有限公司 | Combination therapy of PD-1 axis binding antagonists and LRRK2 inhibitors |
| CA3192306A1 (en) | 2020-10-20 | 2022-04-28 | Burkhard Ludewig | Antibodies or antigen-binding fragments specifically binding to gremlin-1 and uses thereof |
| TW202233671A (en) | 2020-10-20 | 2022-09-01 | 美商建南德克公司 | Peg-conjugated anti-mertk antibodies and methods of use |
| CN116782929A (en) | 2020-11-02 | 2023-09-19 | Ucb生物制药有限责任公司 | Use of anti-TREM1 neutralizing antibodies for the treatment of motor neuron degenerative disorders |
| IL302217A (en) | 2020-11-04 | 2023-06-01 | Genentech Inc | Dosing for treatment with anti-cd20/anti-cd3 bispecific antibodies and anti-cd79b antibody drug conjugates |
| EP4240492A2 (en) | 2020-11-04 | 2023-09-13 | Genentech, Inc. | Dosing for treatment with anti-cd20/anti-cd3 bispecific antibodies |
| CA3196076A1 (en) | 2020-11-04 | 2022-05-12 | Chi-Chung Li | Subcutaneous dosing of anti-cd20/anti-cd3 bispecific antibodies |
| CN117916261A (en) | 2020-11-16 | 2024-04-19 | 豪夫迈·罗氏有限公司 | Combination therapy with FAP-targeted CD40 agonists |
| AU2021391054A1 (en) | 2020-12-02 | 2023-06-22 | Shanghai Henlius Biotech, Inc. | ANTI-GARP/TGFβ ANTIBODIES AND METHODS OF USE |
| WO2022116858A1 (en) * | 2020-12-03 | 2022-06-09 | 江苏恒瑞医药股份有限公司 | Anti-tslp antibody pharmaceutical composition and use thereof |
| JP2023551983A (en) | 2020-12-07 | 2023-12-13 | ユーシービー バイオファルマ エスアールエル | Antibodies against interleukin-22 |
| JP2023551981A (en) | 2020-12-07 | 2023-12-13 | ユーシービー バイオファルマ エスアールエル | Multispecific antibodies and antibody combinations |
| WO2022132636A1 (en) * | 2020-12-14 | 2022-06-23 | AmMax Bio, Inc. | High concentration formulations of anti-csf1 and anti-csf1r antibodies |
| CR20230263A (en) | 2020-12-17 | 2023-08-21 | Hoffmann La Roche | Anti-hla-g antibodies and use thereof |
| IL303992A (en) | 2020-12-29 | 2023-08-01 | Cemm Forschungszentrum F?R Molekulare Medizin Gmbh | Anti-april antibodies and uses thereof |
| AU2022206061A1 (en) | 2021-01-06 | 2023-07-06 | F. Hoffmann-La Roche Ag | Combination therapy employing a pd1-lag3 bispecific antibody and a cd20 t cell bispecific antibody |
| JP2024504931A (en) | 2021-01-12 | 2024-02-02 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Split antibodies that bind to cancer cells and target radionuclides to said cells |
| US20240173442A1 (en) | 2021-01-13 | 2024-05-30 | Hoffmann-La Roche Inc. | Combination therapy |
| WO2022162587A1 (en) | 2021-01-27 | 2022-08-04 | Centre Hospitalier Universitaire Vaudois (C.H.U.V.) | Anti-sars-cov-2 antibodies and use thereof in the treatment of sars-cov-2 infection |
| WO2022162203A1 (en) | 2021-01-28 | 2022-08-04 | Vaccinvent Gmbh | Method and means for modulating b-cell mediated immune responses |
| CN117120084A (en) | 2021-01-28 | 2023-11-24 | 维肯芬特有限责任公司 | Methods and means for modulating B cell-mediated immune responses |
| EP4288458A1 (en) | 2021-02-03 | 2023-12-13 | Genentech, Inc. | Multispecific binding protein degrader platform and methods of use |
| GB202102396D0 (en) | 2021-02-19 | 2021-04-07 | Adc Therapeutics Sa | Molecular adjuvant |
| JP2024512377A (en) | 2021-03-12 | 2024-03-19 | ジェネンテック, インコーポレイテッド | Anti-KLK7 antibodies, anti-KLK5 antibodies, multispecific anti-KLK5/KLK7 antibodies, and methods of use |
| AR125344A1 (en) | 2021-04-15 | 2023-07-05 | Chugai Pharmaceutical Co Ltd | ANTI-C1S ANTIBODY |
| KR20240007184A (en) | 2021-05-12 | 2024-01-16 | 제넨테크, 인크. | Methods for using anti-CD79B immunoconjugates to treat diffuse large B-cell lymphoma |
| AU2022273541A1 (en) | 2021-05-14 | 2023-11-30 | Genentech, Inc. | Methods for treatment of cd20-positive proliferative disorder with mosunetuzumab and polatuzumab vedotin |
| AR126009A1 (en) | 2021-06-02 | 2023-08-30 | Hoffmann La Roche | CD28 ANTIGEN-BINDING AGONIST MOLECULES THAT TARGET EPCAM |
| TW202306994A (en) | 2021-06-04 | 2023-02-16 | 日商中外製藥股份有限公司 | Anti-ddr2 antibodies and uses thereof |
| EP4351582B1 (en) | 2021-06-09 | 2025-10-08 | F. Hoffmann-La Roche AG | Combination of a particular braf inhibitor (paradox breaker) and a pd-1 axis binding antagonist for use in the treatment of cancer |
| WO2022263638A1 (en) | 2021-06-17 | 2022-12-22 | Centre Hospitalier Universitaire Vaudois (C.H.U.V.) | Anti-sars-cov-2 antibodies and use thereof in the treatment of sars-cov-2 infection |
| WO2022263501A1 (en) | 2021-06-18 | 2022-12-22 | F. Hoffmann-La Roche Ag | Bispecific anti-ccl2 antibodies |
| CA3221833A1 (en) | 2021-06-25 | 2022-12-29 | Chugai Seiyaku Kabushiki Kaisha | Anti-ctla-4 antibody |
| MX2023014453A (en) | 2021-06-25 | 2024-01-31 | Chugai Pharmaceutical Co Ltd | Use of anti-ctla-4 antibody. |
| EP4363449A2 (en) | 2021-07-02 | 2024-05-08 | Genentech, Inc. | Methods and compositions for treating cancer |
| WO2023001884A1 (en) | 2021-07-22 | 2023-01-26 | F. Hoffmann-La Roche Ag | Heterodimeric fc domain antibodies |
| JP2024529451A (en) | 2021-07-28 | 2024-08-06 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Methods and Compositions for Treating Cancer |
| JP2024528217A (en) | 2021-08-03 | 2024-07-26 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | Bispecific antibodies and methods of use |
| US20240336697A1 (en) | 2021-08-07 | 2024-10-10 | Genentech, Inc. | Methods of using anti-cd79b immunoconjugates to treat diffuse large b-cell lymphoma |
| IL310382A (en) | 2021-08-27 | 2024-03-01 | Genentech Inc | Methods of treating tau pathologies |
| WO2023034750A1 (en) | 2021-08-30 | 2023-03-09 | Genentech, Inc. | Anti-polyubiquitin multispecific antibodies |
| WO2023053282A1 (en) | 2021-09-29 | 2023-04-06 | 中外製薬株式会社 | Cytotoxicity-inducing therapeutic agent for use in treatment of cancer |
| WO2023056403A1 (en) | 2021-09-30 | 2023-04-06 | Genentech, Inc. | Methods for treatment of hematologic cancers using anti-tigit antibodies, anti-cd38 antibodies, and pd-1 axis binding antagonists |
| CN118055767A (en) | 2021-10-06 | 2024-05-17 | 豪夫迈·罗氏有限公司 | Novel combination therapy |
| AR127269A1 (en) | 2021-10-08 | 2024-01-03 | Chugai Pharmaceutical Co Ltd | ANTI-HLA-DQ2.5 ANTIBODY FORMULATION |
| KR20240095442A (en) | 2021-11-03 | 2024-06-25 | 항저우 디에이씨 바이오테크 씨오, 엘티디 | Specific conjugation of antibodies |
| EP4426748A4 (en) | 2021-11-05 | 2025-11-26 | Mab Biotec Inc | MONOCLONAL ANTIBODIES AGAINST CARCINOEMBRYONAL ANTIGENS AND THEIR USES |
| EP4430072A1 (en) | 2021-11-10 | 2024-09-18 | Genentech, Inc. | Anti-interleukin-33 antibodies and uses thereof |
| CA3235206A1 (en) | 2021-11-16 | 2023-05-25 | Davide BASCO | Novel molecules for therapy and diagnosis |
| TW202337494A (en) | 2021-11-16 | 2023-10-01 | 美商建南德克公司 | Methods and compositions for treating systemic lupus erythematosus (sle) with mosunetuzumab |
| WO2023100095A1 (en) * | 2021-11-30 | 2023-06-08 | Enzene Biosciences Limited | Composition comprising her2 antibody, formulation and process of preparation thereof |
| WO2023109901A1 (en) | 2021-12-17 | 2023-06-22 | Shanghai Henlius Biotech, Inc. | Anti-ox40 antibodies and methods of use |
| EP4448578A4 (en) | 2021-12-17 | 2026-02-18 | Shanghai Henlius Biotech Inc | ANTI-OX40 ANTIBODIES, MULTISPECIFIC ANTIBODIES AND METHODS FOR USE |
| WO2023141445A1 (en) | 2022-01-19 | 2023-07-27 | Genentech, Inc. | Anti-notch2 antibodies and conjugates and methods of use |
| USD1033637S1 (en) | 2022-01-24 | 2024-07-02 | Forsight Vision4, Inc. | Fluid exchange device |
| IL315043A (en) | 2022-02-16 | 2024-10-01 | Ac Immune Sa | Humanized molecules that bind TDP-43 and uses thereof |
| JP2025514610A (en) | 2022-03-25 | 2025-05-09 | シャンハイ・ヘンリウス・バイオテック・インコーポレイテッド | Anti-MSLN antibodies and methods of use |
| IL315473A (en) | 2022-04-01 | 2024-11-01 | Hoffmann La Roche | New treatment for facioscapulohumeral muscular dystrophy (fshd) |
| WO2023191816A1 (en) | 2022-04-01 | 2023-10-05 | Genentech, Inc. | Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies |
| EP4504775A1 (en) | 2022-04-08 | 2025-02-12 | AC Immune SA | Anti-tdp-43 binding molecules |
| JP2025512342A (en) | 2022-04-13 | 2025-04-17 | ジェネンテック, インコーポレイテッド | Pharmaceutical compositions and methods of use of therapeutic proteins |
| TWI874962B (en) * | 2022-04-13 | 2025-03-01 | 美商建南德克公司 | Pharmaceutical compositions of mosunetuzumab and methods of use |
| EP4511395A1 (en) | 2022-04-20 | 2025-02-26 | Kantonsspital St. Gallen | Antibodies or antigen-binding fragments pan-specifically binding to gremlin-1 and gremlin-2 and uses thereof |
| AU2023257490A1 (en) * | 2022-04-22 | 2024-10-31 | Eirgenix, Inc. | Pharmaceutical compositons containing anti-her2 antibody for subcutaneous administration |
| CN119137157A (en) | 2022-05-03 | 2024-12-13 | 基因泰克公司 | Anti-Ly6E antibodies, immunoconjugates and uses thereof |
| AR129268A1 (en) | 2022-05-11 | 2024-08-07 | Hoffmann La Roche | ANTIBODY THAT BINDS TO VEGF-A AND IL6 AND METHODS OF USE |
| WO2023219613A1 (en) | 2022-05-11 | 2023-11-16 | Genentech, Inc. | Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies |
| WO2023237706A2 (en) | 2022-06-08 | 2023-12-14 | Institute For Research In Biomedicine (Irb) | Cross-specific antibodies, uses and methods for discovery thereof |
| WO2023250367A1 (en) | 2022-06-22 | 2023-12-28 | Genentech, Inc. | Methods for treatment of previously untreated follicular lymphoma with mosunetuzumab and lenalidomide |
| CA3261147A1 (en) | 2022-07-13 | 2024-01-18 | Genentech, Inc. | Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies |
| TW202409078A (en) * | 2022-07-18 | 2024-03-01 | 中國大陸商蘇州創勝醫藥集團有限公司 | Stable pharmaceutical formulation comprising anti-GREMLIN1 antibody |
| CN119604530A (en) | 2022-07-19 | 2025-03-11 | 基因泰克公司 | Administration of Therapeutic Antibodies Using Anti-FCRH5/Anti-CD3 Bispecific Antibodies |
| EP4558528A1 (en) | 2022-07-22 | 2025-05-28 | Genentech, Inc. | Anti-steap1 antigen-binding molecules and uses thereof |
| US11773160B1 (en) | 2022-08-05 | 2023-10-03 | Anaveon AG | Immune-stimulating IL-2 fusion proteins |
| TW202423979A (en) | 2022-08-22 | 2024-06-16 | 美商雅博得樂醫療公司 | Dll3 binding molecules and uses thereof |
| WO2024044675A1 (en) | 2022-08-25 | 2024-02-29 | Beigene, Ltd. | Methods of cancer treatment using anti-pd1 antibodies in combination with anti-tim3 antibodies |
| CN115440385B (en) * | 2022-08-30 | 2025-09-16 | 南京邮电大学 | Fuzzy high-utility mode mining method based on medical scene |
| CN120153254A (en) | 2022-09-01 | 2025-06-13 | 基因泰克公司 | Bladder cancer treatment and diagnosis |
| WO2024068996A1 (en) | 2022-09-30 | 2024-04-04 | Centre Hospitalier Universitaire Vaudois (C.H.U.V.) | Anti-sars-cov-2 antibodies and use thereof in the treatment of sars-cov-2 infection |
| TW202426505A (en) | 2022-10-25 | 2024-07-01 | 美商建南德克公司 | Therapeutic and diagnostic methods for cancer |
| IL320220A (en) | 2022-11-09 | 2025-06-01 | Cis Biopharma Ag | Anti-l1-cam antibodies and their uses for diagnostic and therapeutic applications |
| CN118056840A (en) | 2022-11-18 | 2024-05-21 | 南京诺艾新生物技术有限公司 | Receptor affinity preference site-specific coupled PEGylated interleukin-2 mutant and its use |
| TW202434306A (en) | 2022-11-24 | 2024-09-01 | 瑞士商百濟神州瑞士有限責任公司 | Anti-cea antibody drug conjugates and methods of use |
| IL320881A (en) | 2022-11-25 | 2025-07-01 | Chugai Pharmaceutical Co Ltd | Method for producing proteins |
| WO2024120516A1 (en) | 2022-12-08 | 2024-06-13 | 南京诺唯赞生物科技股份有限公司 | Antibodies specifically binding to rsv |
| TW202440550A (en) | 2022-12-15 | 2024-10-16 | 瑞士商赫孚孟拉羅股份公司 | Combination therapy for cancer treatment |
| JP2026501282A (en) | 2022-12-20 | 2026-01-14 | ジェネンテック, インコーポレイテッド | Methods of treating pancreatic cancer with pd-1 axis binding antagonists and rna vaccines |
| CN118873678A (en) | 2023-01-18 | 2024-11-01 | 泰励生物科技(上海)有限公司 | Antibody-drug conjugates and their uses |
| WO2024163009A1 (en) | 2023-01-31 | 2024-08-08 | Genentech, Inc. | Methods and compositions for treating urothelial bladder cancer |
| WO2024163494A1 (en) | 2023-01-31 | 2024-08-08 | F. Hoffmann-La Roche Ag | Methods and compositions for treating non-small cell lung cancer and triple-negative breast cancer |
| WO2024165045A1 (en) | 2023-02-09 | 2024-08-15 | Beigene, Ltd. | Self-stabilizing linker conjugates |
| AU2024231640A1 (en) | 2023-03-03 | 2025-10-16 | Beone Medicines I Gmbh | Muc1 and cd16a antibodies and methods of use |
| AR132043A1 (en) | 2023-03-03 | 2025-05-21 | Beigene Switzerland Gmbh | MUC1 ANTIBODIES AND METHODS OF USE |
| WO2024183636A1 (en) | 2023-03-03 | 2024-09-12 | Beigene Switzerland Gmbh | Cd16a antibodies and methods of use |
| WO2024184810A1 (en) | 2023-03-06 | 2024-09-12 | Beigene Switzerland Gmbh | Anti-cldn6 and anti-cd3 multispecific antibodies and methods of use |
| AR132064A1 (en) | 2023-03-06 | 2025-05-21 | Beigene Switzerland Gmbh | ANTI-CLDN6 ANTIBODIES AND METHODS OF USE |
| WO2024184811A1 (en) | 2023-03-06 | 2024-09-12 | Beigene Switzerland Gmbh | Anti-cd3 multispecific antibodies and methods of use |
| EP4676596A1 (en) | 2023-03-08 | 2026-01-14 | AC Immune SA | Anti-tdp-43 binding molecules and uses thereof |
| WO2024188965A1 (en) | 2023-03-13 | 2024-09-19 | F. Hoffmann-La Roche Ag | Combination therapy employing a pd1-lag3 bispecific antibody and an hla-g t cell bispecific antibody |
| WO2024194851A1 (en) | 2023-03-23 | 2024-09-26 | Beigene Switzerland Gmbh | Bioactive conjugate, preparation method therefor and use thereof |
| WO2024212827A1 (en) | 2023-04-12 | 2024-10-17 | Shanghai Kangabio Co., Limited | Multifunctional molecules comprising masked interleukin 12 and methods of use |
| CN120936604A (en) | 2023-04-13 | 2025-11-11 | 广州百济神州生物制药有限公司 | Targeting pyrrolobenzo Diazepine conjugates |
| AU2024270495A1 (en) | 2023-05-05 | 2025-10-09 | Genentech, Inc. | Dosing for treatment with anti-fcrh5/anti-cd3 bispecific antibodies |
| AU2024269754A1 (en) | 2023-05-08 | 2025-10-23 | F. Hoffmann-La Roche Ag | Targeted interferon alpha fusion proteins and methods of use |
| AR132805A1 (en) | 2023-06-01 | 2025-07-30 | Hoffmann La Roche | Immunostimulatory antigen-binding molecules that specifically bind to BCMA |
| CN121241068A (en) | 2023-06-01 | 2025-12-30 | 豪夫迈·罗氏有限公司 | Bispecific antibodies targeting BCMA and CD28 |
| CN121285742A (en) | 2023-06-08 | 2026-01-06 | 基因泰克公司 | Macrophage characterization for diagnostic and therapeutic methods of lymphoma |
| CN121443309A (en) | 2023-06-22 | 2026-01-30 | 基因泰克公司 | Treatment of multiple myeloma |
| WO2024263904A1 (en) | 2023-06-23 | 2024-12-26 | Genentech, Inc. | Methods for treatment of liver cancer |
| WO2024263195A1 (en) | 2023-06-23 | 2024-12-26 | Genentech, Inc. | Methods for treatment of liver cancer |
| TW202517294A (en) | 2023-07-11 | 2025-05-01 | 美商建南德克公司 | Compositions and methods for treating multiple sclerosis |
| WO2025032070A1 (en) | 2023-08-09 | 2025-02-13 | F. Hoffmann-La Roche Ag | Anti-a-beta protein antibodies, methods and uses thereof |
| WO2025037336A1 (en) * | 2023-08-12 | 2025-02-20 | Dr. Reddy's Laboratories Limited | Pharmaceutical formulations of anti-cd 20 antibody and methods of preparing the same |
| WO2025049277A1 (en) | 2023-08-25 | 2025-03-06 | Genentech, Inc. | Methods and compositions for treating non-small cell lung cancer comprising an anti-tigit antagonist antibody and a pd-1 axis binding antagonist |
| TW202511497A (en) | 2023-09-01 | 2025-03-16 | 瑞士商百濟神州瑞士有限責任公司 | Immune-related gene expression signatures and methods relating thereto |
| TW202515903A (en) | 2023-10-12 | 2025-04-16 | 瑞士商百濟神州瑞士有限責任公司 | Anti-pd-1-based treatment before and after surgery |
| WO2025106474A1 (en) | 2023-11-14 | 2025-05-22 | Genentech, Inc. | Therapeutic and diagnostic methods for treating cancer with anti-fcrh5/anti-cd3 bispecific antibodies |
| WO2025117848A1 (en) | 2023-12-01 | 2025-06-05 | Genentech, Inc. | Low-viscosity variants of antibodies |
| WO2025133042A2 (en) | 2023-12-22 | 2025-06-26 | F. Hoffmann-La Roche Ag | Activatable fusion proteins and methods of use |
| WO2025155602A1 (en) | 2024-01-16 | 2025-07-24 | Genentech, Inc. | Method of treating hemophilia a |
| WO2025155607A1 (en) | 2024-01-16 | 2025-07-24 | Genentech, Inc. | Methods of treating urothelial carcinoma with a pd-1 axis binding antagonist and an rna vaccine |
| WO2025174933A1 (en) | 2024-02-14 | 2025-08-21 | Genentech, Inc. | Methods for treatment of pancreatic cancer with anti-pd-l1 ab, anti-tigit ab, gemcitabine and nab-placlitaxel |
| WO2025176733A1 (en) | 2024-02-19 | 2025-08-28 | Université De Genève | Antibody-drug conjugates involving small molecule atr/chk1 inhibitors |
| WO2025238187A1 (en) | 2024-05-15 | 2025-11-20 | Cis Biopharma Ag | Immunoconjugates targeting l1-cam |
| WO2025238133A1 (en) | 2024-05-17 | 2025-11-20 | UCB Biopharma SRL | Multispecific antibody with binding specificity for il-11 and il-17 |
| WO2025238135A2 (en) | 2024-05-17 | 2025-11-20 | UCB Biopharma SRL | Antibody with binding specificity for il-11 |
| WO2025242909A1 (en) | 2024-05-24 | 2025-11-27 | Paul Scherrer Institut | CD30-targeting antibody-radioligand conjugates and their therapeutic use |
| WO2025250969A1 (en) | 2024-05-31 | 2025-12-04 | Vertex Pharmaceuticals Incorporated | Anti-cd74 antibodies, conjugates and uses thereof |
| WO2025261943A1 (en) | 2024-06-18 | 2025-12-26 | F. Hoffmann-La Roche Ag | Anti-cancer combinations comprising mosperafenib and folfox or folfiri |
| JP2026009843A (en) | 2024-06-25 | 2026-01-21 | ジェネンテック, インコーポレイテッド | Methods of treating cancer with subcutaneous administration of mosunetuzumab as monotherapy or in combination with lenalidomide |
| WO2026010945A1 (en) | 2024-07-04 | 2026-01-08 | Genentech, Inc. | Zifibancimig for use in methods for treating ocular diseases |
| WO2026010946A1 (en) | 2024-07-04 | 2026-01-08 | Genentech, Inc. | Zifibancimig for use in methods for treating ocular diseases via an ocular implant |
| CN121513192A (en) * | 2024-07-08 | 2026-02-13 | 武汉友芝友生物制药股份有限公司 | antibody preparations |
| WO2026013218A1 (en) | 2024-07-10 | 2026-01-15 | Ac Immune Sa | Anti-tdp-43 vectors, binding molecules and uses thereof |
| WO2026021476A1 (en) | 2024-07-24 | 2026-01-29 | Beone Guangzhou Biologics Manufacturing Co., Ltd. | Anti-cmet and anti-egfr multispecific antibody drug conjugates |
| EP4684803A1 (en) | 2024-07-25 | 2026-01-28 | CeMM - Forschungszentrum für Molekulare Medizin GmbH | Antibody conjugated chemical inducers of degradation of rbm39 and therapeutic uses thereof |
| WO2026030464A1 (en) | 2024-07-30 | 2026-02-05 | Genentech, Inc. | Dosage regimen for reducing cytokine release syndrome (crs) with anti-fcrh5/anti-cd3 bispecific antibodies in multiple myeloma therapy |
Family Cites Families (255)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5871996A (en) | 1994-02-04 | 1999-02-16 | Bio Merieux | Retrovirus agents MSRV1 and MSRV2 associated with multiple sclerosis |
| CU22545A1 (en) | 1994-11-18 | 1999-03-31 | Centro Inmunologia Molecular | OBTAINING A CHEMICAL AND HUMANIZED ANTIBODY AGAINST THE RECEPTOR OF THE EPIDERMAL GROWTH FACTOR FOR DIAGNOSTIC AND THERAPEUTIC USE |
| FR2413974A1 (en) | 1978-01-06 | 1979-08-03 | David Bernard | DRYER FOR SCREEN-PRINTED SHEETS |
| US4515893A (en) | 1979-04-26 | 1985-05-07 | Ortho Pharmaceutical Corporation | Hybrid cell line for producing complement-fixing monoclonal antibody to human T cells |
| US4485045A (en) | 1981-07-06 | 1984-11-27 | Research Corporation | Synthetic phosphatidyl cholines useful in forming liposomes |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4544545A (en) | 1983-06-20 | 1985-10-01 | Trustees University Of Massachusetts | Liposomes containing modified cholesterol for organ targeting |
| DE3587657D1 (en) | 1984-01-30 | 1993-12-23 | Imp Cancer Res Tech | IMPROVEMENTS IN GROWTH FACTORS. |
| US4943533A (en) | 1984-03-01 | 1990-07-24 | The Regents Of The University Of California | Hybrid cell lines that produce monoclonal antibodies to epidermal growth factor receptor |
| US5672347A (en) | 1984-07-05 | 1997-09-30 | Genentech, Inc. | Tumor necrosis factor antagonists and their use |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US5091178A (en) | 1986-02-21 | 1992-02-25 | Oncogen | Tumor therapy with biologically active anti-tumor antibodies |
| US5401638A (en) | 1986-06-04 | 1995-03-28 | Oncogene Science, Inc. | Detection and quantification of neu related proteins in the biological fluids of humans |
| US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
| US4968603A (en) | 1986-12-31 | 1990-11-06 | The Regents Of The University Of California | Determination of status in neoplastic disease |
| IL85035A0 (en) | 1987-01-08 | 1988-06-30 | Int Genetic Eng | Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same |
| US5824311A (en) | 1987-11-30 | 1998-10-20 | Trustees Of The University Of Pennsylvania | Treatment of tumors with monoclonal antibodies against oncogene antigens |
| US5091313A (en) | 1988-08-05 | 1992-02-25 | Tanox Biosystems, Inc. | Antigenic epitopes of IgE present on B cell but not basophil surface |
| US5720937A (en) * | 1988-01-12 | 1998-02-24 | Genentech, Inc. | In vivo tumor detection assay |
| WO1989006692A1 (en) * | 1988-01-12 | 1989-07-27 | Genentech, Inc. | Method of treating tumor cells by inhibiting growth factor receptor function |
| JP2749167B2 (en) | 1988-06-21 | 1998-05-13 | ジェネンテク,インコーポレイテッド | Methods and therapeutic compositions for the treatment of myocardial infarction |
| GB8823869D0 (en) | 1988-10-12 | 1988-11-16 | Medical Res Council | Production of antibodies |
| US5175384A (en) | 1988-12-05 | 1992-12-29 | Genpharm International | Transgenic mice depleted in mature t-cells and methods for making transgenic mice |
| WO1990006764A1 (en) * | 1988-12-15 | 1990-06-28 | Invitron Corporation | Use of basic amino acids to solubilize immunoglobulins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| EP0474727B1 (en) | 1989-05-19 | 1997-07-23 | Genentech, Inc. | Her2 extracellular domain |
| DE3920358A1 (en) | 1989-06-22 | 1991-01-17 | Behringwerke Ag | BISPECIFIC AND OLIGO-SPECIFIC, MONO- AND OLIGOVALENT ANTI-BODY CONSTRUCTS, THEIR PRODUCTION AND USE |
| DK0479909T3 (en) | 1989-06-29 | 1997-04-07 | Medarex Inc | Bispecific reagents for AIDS treatment |
| EP0491007B1 (en) | 1989-09-08 | 1996-03-13 | The Johns Hopkins University | Structural alterations of the egf receptor gene in human gliomas |
| DE68926248T2 (en) | 1989-09-29 | 1996-12-19 | Oncogene Science Inc | p100 "new" human protein and the use of this protein for the detection of preneoplasmic or neoplasmic in humans |
| US5013556A (en) | 1989-10-20 | 1991-05-07 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5183884A (en) | 1989-12-01 | 1993-02-02 | United States Of America | Dna segment encoding a gene for a receptor related to the epidermal growth factor receptor |
| US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| EP0586505A1 (en) | 1991-05-14 | 1994-03-16 | Repligen Corporation | Heteroconjugate antibodies for treatment of hiv infection |
| IL101943A0 (en) * | 1991-05-24 | 1992-12-30 | Genentech Inc | Structure,production and use of heregulin |
| WO1994004679A1 (en) * | 1991-06-14 | 1994-03-03 | Genentech, Inc. | Method for making humanized antibodies |
| DE69233254T2 (en) * | 1991-06-14 | 2004-09-16 | Genentech, Inc., South San Francisco | Humanized Heregulin antibody |
| US6800738B1 (en) * | 1991-06-14 | 2004-10-05 | Genentech, Inc. | Method for making humanized antibodies |
| US5264586A (en) | 1991-07-17 | 1993-11-23 | The Scripps Research Institute | Analogs of calicheamicin gamma1I, method of making and using the same |
| DK0602126T3 (en) | 1991-08-14 | 2003-06-16 | Genentech Inc | Immunoglobulin variants for specific FC epsilon receptors |
| JP3951062B2 (en) | 1991-09-19 | 2007-08-01 | ジェネンテック・インコーポレーテッド | Expression of antibody fragments with cysteine present at least as a free thiol in E. coli for the production of bifunctional F (ab ') 2 antibodies |
| ES2136092T3 (en) | 1991-09-23 | 1999-11-16 | Medical Res Council | PROCEDURES FOR THE PRODUCTION OF HUMANIZED ANTIBODIES. |
| FI941572A7 (en) | 1991-10-07 | 1994-05-27 | Oncologix Inc | Combination and method of use of anti-erbB-2 monoclonal antibodies |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| WO1993011161A1 (en) | 1991-11-25 | 1993-06-10 | Enzon, Inc. | Multivalent antigen-binding proteins |
| DE69334351D1 (en) | 1992-02-06 | 2011-05-12 | Novartis Vaccines & Diagnostic | Biosynthetic binding protein for tumor markers |
| EP0626012B1 (en) | 1992-02-11 | 2003-07-09 | Cell Genesys, Inc. | Homogenotization of gene-targeting events |
| US5573905A (en) | 1992-03-30 | 1996-11-12 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| WO1993021319A1 (en) | 1992-04-08 | 1993-10-28 | Cetus Oncology Corporation | HUMANIZED C-erbB-2 SPECIFIC ANTIBODIES |
| ZA932522B (en) | 1992-04-10 | 1993-12-20 | Res Dev Foundation | Immunotoxins directed against c-erbB-2(HER/neu) related surface antigens |
| AU687346B2 (en) | 1992-06-30 | 1998-02-26 | Oncologix, Inc. | A combination of anti-erbB-2 monoclonal antibodies and method of using |
| ATE149570T1 (en) | 1992-08-17 | 1997-03-15 | Genentech Inc | BISPECIFIC IMMUNOADHESINS |
| JPH08500826A (en) | 1992-08-21 | 1996-01-30 | ジェネンテク,インコーポレイテッド | Methods of treating LFA-1 mediated diseases |
| US5736137A (en) | 1992-11-13 | 1998-04-07 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma |
| EP0752248B1 (en) | 1992-11-13 | 2000-09-27 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma |
| CA2103323A1 (en) | 1992-11-24 | 1994-05-25 | Gregory D. Plowman | Her4 human receptor tyrosine kinase |
| AU6527894A (en) | 1993-03-30 | 1994-10-24 | Trustees Of The University Of Pennsylvania, The | Prevention of tumors with monoclonal antibodies against (neu) |
| US5595721A (en) | 1993-09-16 | 1997-01-21 | Coulter Pharmaceutical, Inc. | Radioimmunotherapy of lymphoma using anti-CD20 |
| CA2175893C (en) | 1993-11-23 | 2010-06-22 | Paul J. Godowski | Protein tyrosine kinases named rse |
| ES2108566T3 (en) | 1993-12-10 | 1997-12-16 | Genentech Inc | PROCEDURES TO DIAGNOSE ALLERGIES AND TO SELECT ANTI-ALLERGIC THERAPEUTIC AGENTS. |
| ATE207366T1 (en) | 1993-12-24 | 2001-11-15 | Merck Patent Gmbh | IMMUNOCONJUGATES |
| DE4344824C1 (en) | 1993-12-28 | 1995-08-31 | Immuno Ag | Highly concentrated immunoglobulin preparation and process for its preparation |
| AP660A (en) | 1994-01-18 | 1998-08-18 | Genentech Inc | A method of treatment of parasitic infection using IgE antagonists. |
| JP3780315B2 (en) | 1994-03-03 | 2006-05-31 | ジェネンテク・インコーポレイテッド | Anti-IL-8 monoclonal antibody for the treatment of inflammatory diseases |
| US5773001A (en) | 1994-06-03 | 1998-06-30 | American Cyanamid Company | Conjugates of methyltrithio antitumor agents and intermediates for their synthesis |
| CZ18497A3 (en) | 1994-07-21 | 1997-07-16 | Akzo Nobel Nv | Cyclic ketoneperoxidic compounds |
| US5804396A (en) | 1994-10-12 | 1998-09-08 | Sugen, Inc. | Assay for agents active in proliferative disorders |
| US6214388B1 (en) | 1994-11-09 | 2001-04-10 | The Regents Of The University Of California | Immunoliposomes that optimize internalization into target cells |
| CA2207869A1 (en) | 1994-12-02 | 1996-06-06 | Chiron Corporation | Method of promoting an immune response with a bispecific antibody |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| EP0817775B1 (en) | 1995-03-30 | 2001-09-12 | Pfizer Inc. | Quinazoline derivatives |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| GB9508537D0 (en) | 1995-04-27 | 1995-06-14 | Zeneca Ltd | Quinazoline derivatives |
| GB9508538D0 (en) | 1995-04-27 | 1995-06-14 | Zeneca Ltd | Quinazoline derivatives |
| GB9508565D0 (en) | 1995-04-27 | 1995-06-14 | Zeneca Ltd | Quiazoline derivative |
| US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
| JPH11507535A (en) | 1995-06-07 | 1999-07-06 | イムクローン システムズ インコーポレイテッド | Antibodies and antibody fragments that suppress tumor growth |
| US5837234A (en) | 1995-06-07 | 1998-11-17 | Cytotherapeutics, Inc. | Bioartificial organ containing cells encapsulated in a permselective polyether suflfone membrane |
| US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
| EP0873363B1 (en) | 1995-06-14 | 2010-10-06 | The Regents of The University of California | High affinity human antibodies to tumor antigens |
| EP1666591B1 (en) | 1995-06-29 | 2011-03-23 | Immunex Corporation | Cytokine that induces apoptosis |
| US6284236B1 (en) | 1995-06-29 | 2001-09-04 | Immunex Corporation | Cytokine that induces apoptosis |
| ZA966075B (en) | 1995-07-27 | 1998-01-19 | Genentech Inc | Protein formulation. |
| US20040197326A1 (en) | 1995-07-27 | 2004-10-07 | Genentech, Inc. | Method for treatment of allergic asthma |
| US6267958B1 (en) | 1995-07-27 | 2001-07-31 | Genentech, Inc. | Protein formulation |
| CN102416176A (en) * | 1995-07-27 | 2012-04-18 | 基因技术股份有限公司 | Stabile isotonic lyophilized protein formulation |
| US6685940B2 (en) * | 1995-07-27 | 2004-02-03 | Genentech, Inc. | Protein formulation |
| US5783186A (en) | 1995-12-05 | 1998-07-21 | Amgen Inc. | Antibody-induced apoptosis |
| US6030945A (en) | 1996-01-09 | 2000-02-29 | Genentech, Inc. | Apo-2 ligand |
| US6998116B1 (en) | 1996-01-09 | 2006-02-14 | Genentech, Inc. | Apo-2 ligand |
| CA2242414C (en) | 1996-01-23 | 2012-01-03 | Genentech, Inc. | Anti-cd18 antibodies for use against stroke |
| GB9603256D0 (en) | 1996-02-16 | 1996-04-17 | Wellcome Found | Antibodies |
| PL190489B1 (en) | 1996-04-12 | 2005-12-30 | Warner Lambert Co | Irreversible inhibitors of tyrosine kinases |
| GB9610992D0 (en) * | 1996-05-24 | 1996-07-31 | Glaxo Group Ltd | Concentrated antibody preparation |
| US5922845A (en) | 1996-07-11 | 1999-07-13 | Medarex, Inc. | Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies |
| US7147851B1 (en) | 1996-08-15 | 2006-12-12 | Millennium Pharmaceuticals, Inc. | Humanized immunoglobulin reactive with α4β7 integrin |
| BR9712410A (en) | 1996-10-18 | 1999-10-19 | Genentech Inc | Isolated antibody, composition, nucleic acid, vector, host cell, method for making an anti-erbb2 antibody, method for determining the presence of erbb2, kit, method for inducing cell death and manufactured article |
| US7371376B1 (en) | 1996-10-18 | 2008-05-13 | Genentech, Inc. | Anti-ErbB2 antibodies |
| CA2665133A1 (en) | 1996-10-25 | 1998-05-07 | Human Genome Sciences, Inc. | Neutrokine .alpha. |
| EP0852951A1 (en) | 1996-11-19 | 1998-07-15 | Roche Diagnostics GmbH | Stable lyophilized monoclonal or polyclonal antibodies containing pharmaceuticals |
| ES2293661T3 (en) | 1996-11-27 | 2008-03-16 | Genentech, Inc. | PURIFICATION FOR POLYPEPTIDE AFFINITY IN A PROTEIN MATRIX A. |
| KR100532178B1 (en) | 1996-11-27 | 2005-12-01 | 제넨테크, 인크. | Humanized Anti-CD11a Antibodies |
| ES2144386T5 (en) | 1996-12-23 | 2012-12-07 | Immunex Corporation | Ligand for the NF-kappa b receptor activator, the ligand is a member of the TNF superfamily |
| AU6250098A (en) | 1997-01-28 | 1998-08-18 | Human Genome Sciences, Inc. | Death domain containing receptor 4 (dr4: death receptor 4), member of the tnf-receptor superfamily and binding to trail (ap02-l) |
| US6433147B1 (en) | 1997-01-28 | 2002-08-13 | Human Genome Sciences, Inc. | Death domain containing receptor-4 |
| US6072047A (en) | 1997-02-13 | 2000-06-06 | Immunex Corporation | Receptor that binds trail |
| US20020160446A1 (en) | 2000-11-14 | 2002-10-31 | Holtzman Douglas A. | Novel genes encoding proteins having prognostic diagnostic preventive therapeutic and other uses |
| US6313269B1 (en) * | 1997-03-14 | 2001-11-06 | Smithkline Beecham Corporation | Tumor necrosis factor related receptor, TR6 |
| US20010010924A1 (en) | 1997-03-14 | 2001-08-02 | Keith Charles Deen | Tumor necrosis factor related receptor, tr6 polynecleotides |
| NZ508381A (en) | 1997-03-17 | 2002-09-27 | Human Genome Sciences Inc | Antibodies, antagonists and agonists of the death domain containing receptor 5 (DR5) |
| US6872568B1 (en) | 1997-03-17 | 2005-03-29 | Human Genome Sciences, Inc. | Death domain containing receptor 5 antibodies |
| UA73073C2 (en) | 1997-04-03 | 2005-06-15 | Уайт Холдінгз Корпорейшн | Substituted 3-cyan chinolines |
| US5994071A (en) | 1997-04-04 | 1999-11-30 | Albany Medical College | Assessment of prostate cancer |
| WO1998046643A1 (en) | 1997-04-16 | 1998-10-22 | Millennium Biotherapeutics, Inc. | TUMOR NECROSIS FACTOR RECEPTOR RELATED PROTEINS TANGO-63d AND TANGO-63e |
| ATE363533T1 (en) | 1997-04-16 | 2007-06-15 | Amgen Inc | OSTEOPROTEGERIN BINDING PROTEINS AND RECEPTORS |
| US6235883B1 (en) | 1997-05-05 | 2001-05-22 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| JP2001511653A (en) | 1997-05-15 | 2001-08-14 | ジェネンテク,インコーポレイテッド | Apo-2 receptor |
| US6342369B1 (en) * | 1997-05-15 | 2002-01-29 | Genentech, Inc. | Apo-2-receptor |
| CA2295991A1 (en) | 1997-06-11 | 1998-12-17 | Human Genome Sciences, Inc. | Human tumor necrosis factor receptor tr9 |
| ES2190087T3 (en) | 1997-06-13 | 2003-07-16 | Genentech Inc | STABILIZED FORMULATION OF AN ANTIBODY. |
| US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
| JP2002506353A (en) | 1997-06-24 | 2002-02-26 | ジェネンテック・インコーポレーテッド | Methods and compositions for galactosylated glycoproteins |
| US5994511A (en) | 1997-07-02 | 1999-11-30 | Genentech, Inc. | Anti-IgE antibodies and methods of improving polypeptides |
| AU8400398A (en) | 1997-07-11 | 1999-02-08 | Trustees Of The University Of Pennsylvania, The | Nucleic acid encoding a novel chemotherapy-induced protein, and methods of use |
| ZA986732B (en) | 1997-07-29 | 1999-02-02 | Warner Lambert Co | Irreversible inhibitiors of tyrosine kinases |
| ZA986729B (en) | 1997-07-29 | 1999-02-02 | Warner Lambert Co | Irreversible inhibitors of tyrosine kinases |
| TW436485B (en) | 1997-08-01 | 2001-05-28 | American Cyanamid Co | Substituted quinazoline derivatives |
| AU8784498A (en) | 1997-08-15 | 1999-03-08 | Idun Pharmaceuticals, Inc. | Trail receptors, nucleic acids encoding the same, and methods of use thereof |
| WO1999011791A2 (en) | 1997-09-05 | 1999-03-11 | University Of Washington | Tumor necrosis factor family receptors and ligands, encoding nucleic acids and related binding agents |
| AU9805398A (en) | 1997-10-15 | 1999-05-03 | Children's Medical Center Corporation | Novel human egf receptors and use thereof |
| AU759779B2 (en) | 1997-10-31 | 2003-05-01 | Genentech Inc. | Methods and compositions comprising glycoprotein glycoforms |
| ZA9811162B (en) | 1997-12-12 | 2000-06-07 | Genentech Inc | Treatment with anti-ERBB2 antibodies. |
| WO1999036535A1 (en) | 1998-01-15 | 1999-07-22 | Genentech, Inc. | Apo-2 ligand |
| PT1053256E (en) | 1998-01-26 | 2011-09-28 | Genentech Inc | Antibodies to death receptor 4 (dr4) and uses thereof |
| DE69938923D1 (en) * | 1998-03-27 | 2008-07-31 | Genentech Inc | SYNERGY BETWEEN APO-2 LIGAND AND ANTIBODY AGAINST HER-2 |
| DK1068241T3 (en) | 1998-04-02 | 2008-02-04 | Genentech Inc | Antibody variants and fragments thereof |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US6242195B1 (en) | 1998-04-02 | 2001-06-05 | Genentech, Inc. | Methods for determining binding of an analyte to a receptor |
| US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
| DK2180007T4 (en) | 1998-04-20 | 2017-11-27 | Roche Glycart Ag | Glycosylation technique for antibodies to enhance antibody-dependent cell cytotoxicity |
| KR101036414B1 (en) | 1998-05-06 | 2011-05-23 | 제넨테크, 인크. | Protein purification method by ion exchange chromatography |
| US6252050B1 (en) * | 1998-06-12 | 2001-06-26 | Genentech, Inc. | Method for making monoclonal antibodies and cross-reactive antibodies obtainable by the method |
| US6448631B2 (en) * | 1998-09-23 | 2002-09-10 | Artisan Components, Inc. | Cell architecture with local interconnect and method for making same |
| US6573043B1 (en) | 1998-10-07 | 2003-06-03 | Genentech, Inc. | Tissue analysis and kits therefor |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| MX353234B (en) | 1999-01-15 | 2018-01-08 | Genentech Inc | Polypeptide variants with altered effector function. |
| EP1174148A4 (en) | 1999-04-28 | 2005-05-04 | Yamanouchi Pharma Co Ltd | Parenteral medicinal composition containing humanized monoclonal antibody fragment and method for stabilizing the same |
| WO2000069460A1 (en) * | 1999-05-14 | 2000-11-23 | Genentech, Inc. | TREATMENT WITH ANTI-ErbB2 ANTIBODIES |
| ES2325305T3 (en) | 1999-05-28 | 2009-09-01 | Genentech, Inc. | CHEMICAL DR4 ANTIBODIES AND USES OF THE SAME. |
| US6946129B1 (en) | 1999-06-08 | 2005-09-20 | Seattle Genetics, Inc. | Recombinant anti-CD40 antibody and uses thereof |
| ATE330972T1 (en) | 1999-06-09 | 2006-07-15 | Genentech Inc | APO-2L RECEPTOR AGONIST AND CPT-11 SYNERGY EFFECT |
| US7041292B1 (en) * | 1999-06-25 | 2006-05-09 | Genentech, Inc. | Treating prostate cancer with anti-ErbB2 antibodies |
| KR100754049B1 (en) * | 1999-06-25 | 2007-08-31 | 제넨테크, 인크. | Anti-ErbB2 Antibodies and Compositions Used in the manufacture of a medicament for the treatment of prostate cancer |
| AU784045B2 (en) | 1999-06-25 | 2006-01-19 | Genentech Inc. | Humanized anti-ErbB2 antibodies and treatment with anti-ErbB2 antibodies |
| US20040013667A1 (en) | 1999-06-25 | 2004-01-22 | Genentech, Inc. | Treatment with anti-ErbB2 antibodies |
| US20030086924A1 (en) * | 1999-06-25 | 2003-05-08 | Genentech, Inc. | Treatment with anti-ErbB2 antibodies |
| US6949245B1 (en) * | 1999-06-25 | 2005-09-27 | Genentech, Inc. | Humanized anti-ErbB2 antibodies and treatment with anti-ErbB2 antibodies |
| JP5118796B2 (en) | 1999-06-28 | 2013-01-16 | ジェネンテック, インコーポレイテッド | Method for producing Apo-2 ligand using divalent metal ions |
| JP2003528805A (en) | 1999-07-12 | 2003-09-30 | ジェネンテック・インコーポレーテッド | Blocking an immune response to a heterologous antigen using an antagonist that binds to CD20 |
| KR20090126330A (en) * | 1999-08-27 | 2009-12-08 | 제넨테크, 인크. | Anti-ERR2 Antibody Administration Treatment Methods |
| NZ518477A (en) | 1999-10-29 | 2004-10-29 | Genentech Inc | Isolated anti-prostate stem cell antigen (PSCA) antibodies that internalise upon binding to PSCA on a mammalian cell, including a PSCA-expressing tumour cell, in vivo |
| AU2228901A (en) * | 1999-12-28 | 2001-07-09 | Chugai Seiyaku Kabushiki Kaisha | Stable antibody compositions and injection preparations |
| US7097840B2 (en) * | 2000-03-16 | 2006-08-29 | Genentech, Inc. | Methods of treatment using anti-ErbB antibody-maytansinoid conjugates |
| US6632979B2 (en) | 2000-03-16 | 2003-10-14 | Genentech, Inc. | Rodent HER2 tumor model |
| PL357939A1 (en) | 2000-04-11 | 2004-08-09 | Genentech, Inc. | Multivalent antibodies and uses therefor |
| KR20080038458A (en) * | 2000-05-19 | 2008-05-06 | 제넨테크, 인크. | Genetic detection assays to improve the likelihood of an effective response to cancer therapy with ERW antagonists |
| ATE415978T1 (en) | 2000-07-27 | 2008-12-15 | Genentech Inc | SEQUENTIAL ADMINISTRATION OF CPT-11 AND APO-2L POLYPEPTIDE |
| WO2002013860A1 (en) | 2000-08-11 | 2002-02-21 | Chugai Seiyaku Kabushiki Kaisha | Stabilized antibody-containing preparations |
| US6984494B2 (en) | 2000-08-15 | 2006-01-10 | Genentech, Inc. | Analytical method |
| CA2423227C (en) | 2000-10-12 | 2011-11-29 | Genentech, Inc. | Reduced-viscosity concentrated protein formulations |
| KR100942393B1 (en) | 2001-05-25 | 2010-02-17 | 휴먼 게놈 사이언시즈, 인코포레이티드 | Antibodies that immunospecifically bind to the TRAI receptor |
| GB0113179D0 (en) * | 2001-05-31 | 2001-07-25 | Novartis Ag | Organic compounds |
| US7321026B2 (en) | 2001-06-27 | 2008-01-22 | Skytech Technology Limited | Framework-patched immunoglobulins |
| WO2003066661A2 (en) | 2001-07-03 | 2003-08-14 | Genentech, Inc. | Human dr4 antibodies and uses thereof |
| DE60235013D1 (en) * | 2001-07-25 | 2010-02-25 | Facet Biotech Corp | STABLE LYOPHILIZED PHARMACEUTICAL FORMULATION OF THE IGG ANTIBODY DACLIZUMAB |
| KR20040019105A (en) | 2001-08-03 | 2004-03-04 | 제넨테크, 인크. | TACIs and BR3 Polypeptides and Uses Thereof |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| CA2456521C (en) | 2001-08-09 | 2010-08-03 | Tomoaki Ohya | Heat resistant filter |
| CA2463879C (en) | 2001-10-25 | 2012-12-04 | Genentech, Inc. | Glycoprotein compositions |
| JP4663232B2 (en) | 2001-11-01 | 2011-04-06 | ザ ユーエービー リサーチ ファウンデーション | Combination of antibodies selective for tumor necrosis factor-related apoptosis-inducing ligand receptor and other therapeutic agents |
| ES2357225T3 (en) | 2001-11-01 | 2011-04-20 | Uab Research Foundation | COMBINATIONS OF ANTI-DR5 ANTIBODIES AND ANTI-DR4 ANTIBODIES AND OTHER THERAPEUTIC AGENTS. |
| NZ532896A (en) | 2001-11-08 | 2007-08-31 | Pdl Biopharma Inc | Stable liquid pharmaceutical formulation of IGG antibodies including daclizumab and fontolizumab |
| AU2002352676A1 (en) | 2001-11-14 | 2003-05-26 | Human Genome Sciences, Inc. | Antibodies that immunospecifically bind to trail receptors |
| WO2003049044A2 (en) * | 2001-12-05 | 2003-06-12 | Coinstar, Inc. | Methods and systems for detecting coin fraud in coin-counting machines and other devices |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| KR101080021B1 (en) | 2002-02-14 | 2011-11-04 | 추가이 세이야쿠 가부시키가이샤 | Antibody-containing solution pharmaceuticals |
| WO2003068821A2 (en) | 2002-02-14 | 2003-08-21 | Immunomedics, Inc. | Anti-cd20 antibodies and fusion proteins thereof and methods of use |
| JP2005522514A (en) | 2002-04-10 | 2005-07-28 | ジェネンテック・インコーポレーテッド | Modified anti-HER2 antibody |
| WO2003105891A2 (en) | 2002-06-12 | 2003-12-24 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | Use of hec1 antagonists in the treatment of proliferative disorders and cancer |
| US7132100B2 (en) * | 2002-06-14 | 2006-11-07 | Medimmune, Inc. | Stabilized liquid anti-RSV antibody formulations |
| US7425618B2 (en) * | 2002-06-14 | 2008-09-16 | Medimmune, Inc. | Stabilized anti-respiratory syncytial virus (RSV) antibody formulations |
| US20060182740A1 (en) | 2002-06-21 | 2006-08-17 | Biogen Idec, Inc. | Buffered formulations for concentrating antibodies and methods of use thereof |
| AU2003247686A1 (en) | 2002-07-02 | 2004-01-23 | Smithkline Beecham Corporation | A novel stable formulation |
| HUP0600340A3 (en) | 2002-07-15 | 2011-06-28 | Genentech Inc | Methods for identifying tumors that are responsive to treatment with anti-erbb2 antibodies |
| US20040033228A1 (en) | 2002-08-16 | 2004-02-19 | Hans-Juergen Krause | Formulation of human antibodies for treating TNF-alpha associated disorders |
| WO2004019861A2 (en) | 2002-08-28 | 2004-03-11 | Pharmacia Corporation | Stable ph optimized formulation of a modified antibody |
| WO2004024866A2 (en) | 2002-09-11 | 2004-03-25 | Genentech, Inc. | Protein purification |
| ES2524694T3 (en) | 2002-10-17 | 2014-12-11 | Genmab A/S | Human monoclonal antibodies against CD20 |
| EP1572972A4 (en) | 2002-11-21 | 2007-11-21 | Genentech Inc | THERAPY OF BENIGN DISEASES OR DISORDERS USING ANTI-ERBB2 ANTIBODIES |
| WO2004055164A2 (en) | 2002-12-13 | 2004-07-01 | Abgenix, Inc. | System and method for stabilizing antibodies with histidine |
| RS20100366A (en) | 2002-12-16 | 2011-04-30 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| CA2512174A1 (en) | 2003-01-30 | 2004-08-12 | Christian B. Allan | Anti-integrin .alpha..nu..beta.3 antibody formulations and uses thereof |
| CA2514840C (en) | 2003-02-01 | 2017-11-07 | Tanox, Inc. | High affinity, anti-human ige antibodies |
| JP4728948B2 (en) | 2003-02-10 | 2011-07-20 | エラン ファーマシューティカルズ,インコーポレイテッド | Immunoglobulin preparation and method for its preparation |
| US20040185269A1 (en) | 2003-03-18 | 2004-09-23 | Loper Scott W. | Scratch and mar resistant low VOC coating composition |
| SI2335725T1 (en) | 2003-04-04 | 2017-01-31 | Genentech, Inc. | High concentration antibody and protein formulations |
| LT3095793T (en) | 2003-07-28 | 2020-07-10 | Genentech, Inc. | Reducing protein a leaching during protein a affinity chromatography |
| CA2563341C (en) | 2004-04-08 | 2014-10-21 | David B. Agus | Erbb antagonists for pain therapy |
| BRPI0510883B8 (en) | 2004-06-01 | 2021-05-25 | Genentech Inc | drug-antibody conjugate compound, pharmaceutical composition, method of manufacturing a drug-antibody conjugate compound, and uses of a formulation, a drug-antibody conjugate and a chemotherapeutic agent, and a combination |
| SV2006002143A (en) * | 2004-06-16 | 2006-01-26 | Genentech Inc | USE OF AN ANTIBODY FOR THE TREATMENT OF CANCER RESISTANT TO PLATINUM |
| KR20180004850A (en) * | 2004-07-22 | 2018-01-12 | 제넨테크, 인크. | Her2 antibody composition |
| US20060029551A1 (en) | 2004-08-05 | 2006-02-09 | Kui Liu | Stable particle formulations of erythropoietin receptor agonists |
| TW200621282A (en) | 2004-08-13 | 2006-07-01 | Wyeth Corp | Stabilizing formulations |
| US20060067930A1 (en) | 2004-08-19 | 2006-03-30 | Genentech, Inc. | Polypeptide variants with altered effector function |
| JO3000B1 (en) | 2004-10-20 | 2016-09-05 | Genentech Inc | Antibody Formulations. |
| ZA200704796B (en) | 2004-12-07 | 2008-11-26 | Genentech Inc | Selecting patients for therapy with a HER inhibitor |
| PL1846030T3 (en) | 2005-01-21 | 2019-05-31 | Genentech Inc | Fixed dosing of her antibodies |
| EP3195879A1 (en) | 2005-02-23 | 2017-07-26 | Genentech, Inc. | Extending time to disease progression or survival in cancer patients |
| US20060204505A1 (en) * | 2005-03-08 | 2006-09-14 | Sliwkowski Mark X | Methods for identifying tumors responsive to treatment with HER dimerization inhibitors (HDIs) |
| US20060212956A1 (en) | 2005-03-14 | 2006-09-21 | Genentech, Inc. | Animal model of ligand activated HER2 expressing tumors |
| JP2006316040A (en) | 2005-05-13 | 2006-11-24 | Genentech Inc | HERCEPTIN® adjuvant therapy |
| US20070009976A1 (en) * | 2005-07-06 | 2007-01-11 | Helmut Lenz | Detection of a target antigen irrespective of the presence or absence of a corresponding therapeutic antibody |
| PE20070207A1 (en) | 2005-07-22 | 2007-03-09 | Genentech Inc | COMBINED TREATMENT OF TUMORS THAT EXPRESS HER |
| US7700299B2 (en) * | 2005-08-12 | 2010-04-20 | Hoffmann-La Roche Inc. | Method for predicting the response to a treatment |
| EP1977763A4 (en) | 2005-12-28 | 2010-06-02 | Chugai Pharmaceutical Co Ltd | STABILIZER PREPARATION CONTAINING ANTIBODIES |
| TW200812615A (en) * | 2006-03-22 | 2008-03-16 | Hoffmann La Roche | Tumor therapy with an antibody for vascular endothelial growth factor and an antibody for human epithelial growth factor receptor type 2 |
| WO2007145862A2 (en) * | 2006-06-05 | 2007-12-21 | Genentech, Inc. | Extending survival of cancer patients with elevated levels of egf or tgf-alpha |
| MY150756A (en) | 2006-08-21 | 2014-02-28 | Hoffmann La Roche | Tumor theraphy with an anti-vegf antibody |
| WO2008031531A1 (en) * | 2006-09-15 | 2008-03-20 | F. Hoffmann-La Roche Ag | Tumor therapy with a combination of anti-her2 antibodies |
| WO2008109440A2 (en) | 2007-03-02 | 2008-09-12 | Genentech, Inc. | Predicting response to a her dimerisation inhibitor based on low her3 expression |
| EP1997534A1 (en) | 2007-05-31 | 2008-12-03 | Pierre Fabre Medicament | Cancer treatment combination therapy comprising vinflunine and trastuzumab |
| US8529901B2 (en) | 2007-06-06 | 2013-09-10 | Hoffmann-La Roche, Inc. | Composition of a first non-labeled monoclonal antibody binding to a tumor antigen and a non-cross reactive second monoclonal antibody labeled with a NIR fluorescence label |
| US9551033B2 (en) | 2007-06-08 | 2017-01-24 | Genentech, Inc. | Gene expression markers of tumor resistance to HER2 inhibitor treatment |
| EP2592156B1 (en) | 2007-06-08 | 2016-04-20 | Genentech, Inc. | Gene expression markers of tumor resistance to HER2 inhibitor treatment |
| KR101584823B1 (en) | 2007-09-12 | 2016-01-22 | 제넨테크, 인크. | Combinations of phosphoinositide 3-kinase inhibitor compounds and chemotherapeutic agents, and methods of use |
| PL2840090T3 (en) | 2007-10-30 | 2018-07-31 | Genentech, Inc. | Antibody purification by cation exchange chromatography |
| EP2070896A1 (en) * | 2007-12-12 | 2009-06-17 | BP p.l.c. | A process for the conversion of n-butanol to di-isobutene and propene |
| PE20091174A1 (en) | 2007-12-27 | 2009-08-03 | Chugai Pharmaceutical Co Ltd | LIQUID FORMULATION WITH HIGH CONCENTRATION OF ANTIBODY CONTENT |
| TWI472339B (en) | 2008-01-30 | 2015-02-11 | Genentech Inc | Composition comprising antibody that binds to domain ii of her2 and acidic variants thereof |
| WO2009111707A1 (en) | 2008-03-06 | 2009-09-11 | Genentech, Inc. | Combination therapy with c-met and her antagonists |
| NZ621433A (en) | 2008-03-18 | 2015-10-30 | Genentech Inc | Combinations of an anti-her2 antibody-drug conjugate and chemotherapeutic agents, and methods of use |
| BRPI0812682A2 (en) | 2008-06-16 | 2010-06-22 | Genentech Inc | metastatic breast cancer treatment |
| WO2010136569A1 (en) | 2009-05-29 | 2010-12-02 | F. Hoffmann-La Roche Ag | Modulators for her2 signaling in her2 expressing patients with gastric cancer |
| US9345661B2 (en) | 2009-07-31 | 2016-05-24 | Genentech, Inc. | Subcutaneous anti-HER2 antibody formulations and uses thereof |
| WO2011146568A1 (en) | 2010-05-19 | 2011-11-24 | Genentech, Inc. | Predicting response to a her inhibitor |
| CN103476407A (en) | 2010-12-09 | 2013-12-25 | 霍夫曼-拉罗奇有限公司 | Treatment of HER2-positive cancer with paclitaxel and trastuzumab-MCC-DM1 |
| JP6385060B2 (en) | 2011-03-07 | 2018-09-05 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | In vivo selection of therapeutically active antibodies |
| ES3023516T3 (en) | 2011-10-14 | 2025-06-02 | Hoffmann La Roche | Uses for and article of manufacture including her2 dimerization inhibitor pertuzumab |
| EP2788500A1 (en) | 2011-12-09 | 2014-10-15 | F.Hoffmann-La Roche Ag | Identification of non-responders to her2 inhibitors |
| WO2013096812A1 (en) | 2011-12-23 | 2013-06-27 | Genentech, Inc. | Articles of manufacture and methods for co-administration of antibodies |
| KR101915942B1 (en) | 2012-06-08 | 2018-11-06 | 에프. 호프만-라 로슈 아게 | Mutant selectivity and combinations of a phosphoinositide 3 kinase inhibitor compound and chemotherapeutic agents for the treatment of cancer |
| AR094403A1 (en) | 2013-01-11 | 2015-07-29 | Hoffmann La Roche | ANTI-HER3 ANTIBODY COMBINATION THERAPY |
-
2005
- 2005-10-18 JO JOP/2005/0155A patent/JO3000B1/en active
- 2005-10-19 US US11/254,182 patent/US20060088523A1/en not_active Abandoned
- 2005-10-19 NZ NZ553625A patent/NZ553625A/en not_active IP Right Cessation
- 2005-10-19 SI SI200531606T patent/SI1802344T1/en unknown
- 2005-10-19 RU RU2007118648/15A patent/RU2426554C2/en active Protection Beyond IP Right Term
- 2005-10-19 BR BRPI0516299A patent/BRPI0516299B8/en active IP Right Grant
- 2005-10-19 RS RS20120462A patent/RS52512B/en unknown
- 2005-10-19 CA CA2579861A patent/CA2579861C/en not_active Expired - Lifetime
- 2005-10-19 PL PL05815641T patent/PL1802344T3/en unknown
- 2005-10-19 CN CN2011100424522A patent/CN102319430A/en active Pending
- 2005-10-19 ES ES05815641T patent/ES2389911T3/en not_active Expired - Lifetime
- 2005-10-19 PT PT05815641T patent/PT1802344E/en unknown
- 2005-10-19 JP JP2007537982A patent/JP5025482B2/en not_active Expired - Lifetime
- 2005-10-19 ZA ZA200702521A patent/ZA200702521B/en unknown
- 2005-10-19 KR KR1020077008903A patent/KR101243590B1/en not_active Expired - Lifetime
- 2005-10-19 CN CN2005800434635A patent/CN101084015B/en not_active Expired - Lifetime
- 2005-10-19 HR HRP20120893TT patent/HRP20120893T1/en unknown
- 2005-10-19 EP EP05815641A patent/EP1802344B1/en not_active Expired - Lifetime
- 2005-10-19 GT GT200500298A patent/GT200500298A/en unknown
- 2005-10-19 AU AU2005295394A patent/AU2005295394B2/en active Active
- 2005-10-19 SG SG2014005201A patent/SG196859A1/en unknown
- 2005-10-19 DK DK05815641.5T patent/DK1802344T3/en active
- 2005-10-19 EP EP18173407.0A patent/EP3498294A1/en active Pending
- 2005-10-19 UA UAA200705361A patent/UA89798C2/en unknown
- 2005-10-19 EP EP10176284A patent/EP2371388A3/en not_active Withdrawn
- 2005-10-19 WO PCT/US2005/037471 patent/WO2006044908A2/en not_active Ceased
- 2005-10-20 PA PA20058650001A patent/PA8650001A1/en unknown
- 2005-10-20 TW TW094136752A patent/TWI394582B/en active
- 2005-10-20 PE PE2005001235A patent/PE20061043A1/en active IP Right Grant
- 2005-10-20 MY MYPI20054942A patent/MY146100A/en unknown
- 2005-10-20 SV SV2005002275A patent/SV2006002275A/en unknown
- 2005-10-20 PE PE2009000556A patent/PE20091327A1/en not_active Application Discontinuation
-
2007
- 2007-03-06 IL IL181738A patent/IL181738A/en active IP Right Grant
- 2007-03-08 TN TNP2007000088A patent/TNSN07088A1/en unknown
- 2007-03-09 EC EC2007007308A patent/ECSP077308A/en unknown
- 2007-05-11 MA MA29891A patent/MA29014B1/en unknown
- 2007-05-16 NO NO20072513A patent/NO343683B1/en unknown
- 2007-05-17 CR CR9129A patent/CR9129A/en unknown
-
2009
- 2009-09-04 US US12/554,194 patent/US8372396B2/en active Active
-
2011
- 2011-02-10 RU RU2011104955/15A patent/RU2011104955A/en not_active Application Discontinuation
- 2011-02-24 IL IL211393A patent/IL211393A/en active IP Right Grant
-
2012
- 2012-05-11 JP JP2012109610A patent/JP2012176970A/en active Pending
- 2012-10-25 US US13/660,114 patent/US9017671B2/en not_active Expired - Lifetime
-
2014
- 2014-05-09 JP JP2014097390A patent/JP2014159469A/en active Pending
-
2015
- 2015-03-16 IL IL237756A patent/IL237756A0/en unknown
- 2015-03-30 US US14/672,598 patent/US20150196642A1/en not_active Abandoned
- 2015-11-26 JP JP2015230423A patent/JP2016065091A/en active Pending
-
2018
- 2018-03-26 US US15/936,047 patent/US20180221488A1/en not_active Abandoned
-
2020
- 2020-02-07 US US16/784,467 patent/US20200179515A1/en not_active Abandoned
-
2022
- 2022-06-21 US US17/808,029 patent/US20230263895A1/en not_active Abandoned
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230263895A1 (en) | Antibody formulations | |
| TWI472339B (en) | Composition comprising antibody that binds to domain ii of her2 and acidic variants thereof | |
| KR102048512B1 (en) | Antibody formulations | |
| AU2009316592B2 (en) | Therapeutic protein formulations | |
| AU2011213721A1 (en) | Antibody formulation in histidine-acetate buffer | |
| HK1104483B (en) | Antibody formulation in histidine-acetate buffer | |
| MX2007004732A (en) | Antibody formulation in histidine-acetate buffer | |
| HK1108391B (en) | Antibody formulation in histidine-acetate buffer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| EEER | Examination request |