AU2003247686A1 - A novel stable formulation - Google Patents
A novel stable formulation Download PDFInfo
- Publication number
- AU2003247686A1 AU2003247686A1 AU2003247686A AU2003247686A AU2003247686A1 AU 2003247686 A1 AU2003247686 A1 AU 2003247686A1 AU 2003247686 A AU2003247686 A AU 2003247686A AU 2003247686 A AU2003247686 A AU 2003247686A AU 2003247686 A1 AU2003247686 A1 AU 2003247686A1
- Authority
- AU
- Australia
- Prior art keywords
- formulation
- antibody
- protein
- huc242
- residues
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 239000000203 mixture Substances 0.000 title claims description 33
- 238000009472 formulation Methods 0.000 title claims description 29
- 239000000872 buffer Substances 0.000 claims description 15
- KDYFGRWQOYBRFD-UHFFFAOYSA-N succinic acid Chemical compound OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 claims description 15
- 229950007296 cantuzumab mertansine Drugs 0.000 claims description 14
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 claims description 10
- 229930006000 Sucrose Natural products 0.000 claims description 10
- 239000005720 sucrose Substances 0.000 claims description 10
- 239000001384 succinic acid Substances 0.000 claims description 6
- 238000004108 freeze drying Methods 0.000 claims description 4
- 239000013011 aqueous formulation Substances 0.000 claims description 2
- 102000004169 proteins and genes Human genes 0.000 description 22
- 108090000623 proteins and genes Proteins 0.000 description 22
- 229940127121 immunoconjugate Drugs 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 239000004094 surface-active agent Substances 0.000 description 7
- 108060003951 Immunoglobulin Proteins 0.000 description 6
- 102000018358 immunoglobulin Human genes 0.000 description 6
- 229920005862 polyol Polymers 0.000 description 6
- 150000003077 polyols Chemical class 0.000 description 6
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 5
- 230000004071 biological effect Effects 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 238000003860 storage Methods 0.000 description 5
- 230000002776 aggregation Effects 0.000 description 4
- 238000004220 aggregation Methods 0.000 description 4
- 239000002552 dosage form Substances 0.000 description 4
- 239000008194 pharmaceutical composition Substances 0.000 description 4
- -1 sodium acetate) Chemical compound 0.000 description 4
- 206010028980 Neoplasm Diseases 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 3
- 230000006240 deamidation Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 229920001993 poloxamer 188 Polymers 0.000 description 3
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 2
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 2
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 150000001413 amino acids Chemical class 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000008366 buffered solution Substances 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- HQPMKSGTIOYHJT-UHFFFAOYSA-N ethane-1,2-diol;propane-1,2-diol Chemical compound OCCO.CC(O)CO HQPMKSGTIOYHJT-UHFFFAOYSA-N 0.000 description 2
- 125000000524 functional group Chemical group 0.000 description 2
- 229940050410 gluconate Drugs 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 238000000034 method Methods 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 229920000136 polysorbate Polymers 0.000 description 2
- 229940068965 polysorbates Drugs 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 238000001542 size-exclusion chromatography Methods 0.000 description 2
- 239000001632 sodium acetate Substances 0.000 description 2
- 235000017281 sodium acetate Nutrition 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 229940074404 sodium succinate Drugs 0.000 description 2
- ZDQYSKICYIVCPN-UHFFFAOYSA-L sodium succinate (anhydrous) Chemical compound [Na+].[Na+].[O-]C(=O)CCC([O-])=O ZDQYSKICYIVCPN-UHFFFAOYSA-L 0.000 description 2
- 238000001179 sorption measurement Methods 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 2
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- CTKXFMQHOOWWEB-UHFFFAOYSA-N Ethylene oxide/propylene oxide copolymer Chemical compound CCCOC(C)COCCO CTKXFMQHOOWWEB-UHFFFAOYSA-N 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 238000000149 argon plasma sintering Methods 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 238000007068 beta-elimination reaction Methods 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 238000010504 bond cleavage reaction Methods 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 239000004067 bulking agent Substances 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 230000006652 catabolic pathway Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 230000001351 cycling effect Effects 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000003795 desorption Methods 0.000 description 1
- 125000002228 disulfide group Chemical group 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000013020 final formulation Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 229940051026 immunotoxin Drugs 0.000 description 1
- 230000002637 immunotoxin Effects 0.000 description 1
- 239000002596 immunotoxin Substances 0.000 description 1
- 231100000608 immunotoxin Toxicity 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 238000000050 ionisation spectroscopy Methods 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000000816 matrix-assisted laser desorption--ionisation Methods 0.000 description 1
- 229940127285 new chemical entity Drugs 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229940044519 poloxamer 188 Drugs 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 108090000765 processed proteins & peptides Proteins 0.000 description 1
- 230000004845 protein aggregation Effects 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 230000006340 racemization Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- 229940126622 therapeutic monoclonal antibody Drugs 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 238000001269 time-of-flight mass spectrometry Methods 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68033—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
Landscapes
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Cell Biology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
Description
WO 2004/004639 PCT/US2003/020751 A Novel Stable Formulation FIELD OF THE INVENTION 5 The present invention relates to a stable formulation for huC242-DM1, an antibody conjugated to cytotoxic agent. BACKGROUND OF THE INVENTION 10 In the past ten years, advances in biotechnology have made it possible to produce a variety of proteins for pharmaceutical applications using recombinant DNA techniques. Because proteins are larger and more complex than traditional organic and inorganic drugs (i.e. possessing multiple functional groups in addition to complex three-dimensional structures), the formulation of such proteins poses special problems. 15 For a protein to remain biologically active, a formulation must preserve intact the conformational integrity of at least a core sequence of the protein's amino acids while at the same time protecting the protein's multiple functional groups from degradation. Degradation pathways for proteins can involve chemical instability (i.e. any process which involves modification of the protein by bond formation or cleavage resulting in a 20 new chemical entity) or physical instability (i.e. changes in the higher order structure of the protein). Chemical instability can result from deamidation, racemization, hydrolysis, oxidation, beta elimination or disulfide exchange. Physical instability can result from denaturation, aggregation, precipitation or adsorption, for example. The three most common protein degradation pathways are protein aggregation, 25 deamidation and oxidation. Cleland et al Critical Reviews in Therapeutic Drug Carrier Systems 10(4): 307-377 (1993). Included in the proteins used for pharmaceutical applications are antibodies. An example of an antibody useful for therapy is a murine antibody C242. See. EP 528,527B1. huC242-DM1 is a tumor-activated immunotoxin under development by 30 GlaxoSmithKline plc as a treatment for antigen-expressing tumor types (lead indication pancreatic or PMP cancer). It consists of a humanized antibody of C242, huC242, conjugated to DM1, a new derivative of maytansinoid. There have been many reports on both C242-DM1 and huC242-DM1. See for example, Proc. Natl. Acad. Sci. USA, Vol. 93, pp 8618-8623, 1996; Current Opinion in Molecular Therapeutics 35 3(2):198-203, 2001.
WO 2004/004639 PCT/US2003/020751 SUMMARY OF THE INVENTION Accordingly, the invention provides a stable aqueous pharmaceutical 5 formulation of huC242-DM1 (the immunoconjugate) comprising the immunoconjugate concentration range ~1-20 mg/mL) in a buffer maintaining the pH in the range of -5.8 6.2 (50 mM succinic acid, pH 6.0), and containing sucrose (-5% w/v); this formulation is suitable for subsequent lyophilization to create a stable dosage form. Further provided is a stable frozen formulation for monoclonal antibody 10 C242, comprised of the monoclonal antibody protein (concentration range -1-30 mg/mL) in a buffer maintaining the pH in the range of -5.8-6.5 (50 mM succinic acid, pH 6.0), and containing sucrose (-5% w/v). Further contemplated in the above formulations is the presence of a stabilizing surfactant, in order to confer additional stability to the starting solutions of 15 each product such that they may not then require storage under frozen or freeze-dried conditions. These and further aspects of the invention will be apparent to those skilled in the art. 20 DETAILED DESCRIPTION A "stable" formulation is one in which the antibody or immunoconjugate (both herein referred also simply as protein), as the case may be, therein essentially retains its physical stability and/or chemical stability and/or biological activity upon storage. 25 Various analytical techniques for measuring protein stability are available in the art and are reviewed in Peptide and Protein Drug Delivery, 247-301, Vincent Lee Ed., Marcel Dekker, Inc., New York, N.Y., Pubs. (1991) and Jones, A. Adv. Drug Delivery Rev. 10: 29-90 (1993), for example. Stability can be measured at a selected temperature and other storage conditions for a selected time period. 30 A protein "retains its physical stability" in a pharmaceutical formulation if it shows no signs of aggregation, precipitation and/or denaturation upon visual examination of color and/or clarity, or as measured by UV light scattering or by size exclusion chromatography. A protein "retains its chemical stability" in a pharmaceutical formulation, if 35 the chemical stability at a given time is such that the protein is considered to still 2 WO 2004/004639 PCT/US2003/020751 retain its biological activity as defined below. Chemical stability can be assessed by detecting and quantifying chemically altered forms of the protein. Chemical alteration may involve size modification (e.g. clipping) which can be evaluated using size exclusion chromatography, SDS-PAGE and/or matrix-assisted laser desorption 5 ionization/time-of-flight mass spectrometry (MALDI/TOF MS), for example. Other types of chemical alteration include charge alteration (e.g. occurring as a result of deamidation) which can be evaluated by ion-exchange chromatography, for example. An antibody "retains its biological activity" in a pharmaceutical formulation, if the biological activity of the antibody at a given time is within about 20% (within the 10 errors of the assay) of the biological activity exhibited at the time the pharmaceutical formulation was prepared as determined in an antigen binding assay, for example. "Humanized" forms of non-human (e.g., murine) antibodies are chimeric antibodies which contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient 15 antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity. In some instances, FR residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies may 20 comprise residues which are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions correspond to those of a non-human immunoglobulin and all or substantially 25 all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones et al., Nature 321:522-525 (1986); Riechmann et al, Nature 332:323-329 30 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992); US patent no. 5,639,641. The term "hypervariable region" when used herein refers to the amino acid residues of an antibody which are responsible for antigen-binding. The hypervariable region comprises amino acid residues from a "complementarity determining region" or "CDR" (e.g. principly residues 24-34 (Li), 50-56 (L2) and 89-97 (L3) in the light chain 35 variable domain and 31-35 (H1), 50-65 (H2) and 95-102 (H3) in the heavy chain 3 WO 2004/004639 PCT/US2003/020751 variable domain; Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)) and/or those residues from a "hypervariable loop"(e.g. principly residues 26-32 (Ll), 50-52 (L2) and 91-96 (L3) in the light chain variable domain and 26-32 (H1), 53-55 (H2) and 5 96-101 (H3) in the heavy chain variable domain; Chothia Lesk J. Mol. Biol. 196:901 917 (1987)). "Framework" or "FR" residues are those variable domain residues other than the hypervariable region residues as herein defined. The humanized C242 has variable heavy and light chain amino acid sequences (SEQ ID NO: 1 and 2, respectively) as shown below. 10 SEQ ID NO:I QVQLVQSGAEVKKPGETVKISCKASDYTFTYYGMNWVKQAPGQGLKWMGWIDTTTGE PTYAQKFQGRIAFSLETSASTAYLQIKSLKSEDTATYFCARRGPYNWYFDVWGQGTTVT 15 VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS 20 KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK. SEQ ID NO:2 DIVMTQSPLSVPVTPGEPVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLV SGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCLQHLEYPFTFGPGTKLELKRTVAAPSV 25 FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC. Technologies in making huC242-DM1 are described in US Patent Nos 5,208,020; 5,552,293; 5,639,641; and EP528,527. 30 The antibody which is to be formulated is preferably essentially pure and desirably essentially homogeneous (i.e. free from contaminating proteins etc). "Essentially pure" antibody means a composition comprising at least about 90% by weight of the antibody, based on total weight of the composition, preferably at least about 95% by weight. "Essentially homogeneous" antibody means a composition 35 comprising at least about 99% by weight of antibody, based on total weight of the composition. The symbol "-" means "about". huC242-DM1 to be formulated has not been subjected to prior lyophilization and the formulation of interest herein is an aqueous formulation. An aqueous 40 formulation for huC242-DM1 is prepared comprising -1-30 mg/mL of huC242-DM1 in a pH-buffered solution. The buffer of this invention has a pH in the range from about 4 WO 2004/004639 PCT/US2003/020751 5.8 to about 6.2, preferably about pH 6.0. Examples of buffers that will control the pH within this range include acetate (e.g. sodium acetate), succinate (such as sodium succinate), gluconate, histidine, citrate and other organic acid buffers. The buffer concentration can be from about 1 mM to about 100 mM, preferably from about 50 5 mM. The preferred buffer is succinic acid (about 50 mM), pH 6.0. A polyol, which acts as a tonicifier and may stabilize huC242-DM1, is included in the formulation. In preferred embodiments, the polyol is a nonreducing sugar, such as sucrose or trehalose. Preferred polyol is sucrose in about 5% w/v. 10 A surfactant can also be added to the huC242-DM1 formulation. Exemplary surfactants include nonionic surfactants such as polysorbates (e.g. polysorbates 20, 80 etc) or poloxamers (e.g. poloxamer 188). The amount of surfactant added is such that it reduces aggregation of the formulated immunoconjugate and/or minimizes the formation of particulates in the formulation and/or reduces adsorption. For example, 15 the surfactant may be present in the formulation in an amount from about 0.001% to about 0.5%, preferably from about 0.005% to about 0.2% and most preferably from about 0.01% to about 0.1%. The addition of Pluronic F68, can also be concieved in case where a solution dosage form was desired. The stabilizing formulation for antibody C242 is prepared comprising -1-30 20 mg/mL of C242 in a pH-buffered solution. The buffer of this invention has a pH in the range from about 5.8 to about 6.5, preferably about pH 6.0. Examples of buffers that will control the pH within this range include acetate (e.g. sodium acetate), succinate (such as sodium succinate), gluconate, histidine, citrate and other organic acid buffers. The buffer concentration can be from about 1 mM to about 100 mM, preferably about 25 50 mM, depending, for example, on the buffer. The preferred buffer is succinic acid (about 50 mM), pH 6.0. An polyol, which acts as a tonicifier and may stabilize C242, is included in the formulation. In preferred embodiments, the polyol is a nonreducing sugar, such as sucrose or trehalose. Preferred polyol is sucrose in about 5% w/v. Preferably the formulation will stabilize C242 for 2 years or longer under 30 -70oC frozen storage during the interim between initial antibody manufacture and conjugation to form huC242-DM1. The invention will be more fully understood by reference to the following examples. They should not, however, be construed as limiting the scope of the 5 WO 2004/004639 PCT/US2003/020751 invention. All literature and patent citations are incorporated herein by reference. SPECIFIC EMBODIMENTS 5 A variety of challenging stability problems were encountered during the development of a novel therapeutic monoclonal antibody (mAb) C242 (immunoconjugate) and its immunoconjugate huC242-DM1. These challenges were related primarily to degradation in the form of aggregation (soluble and insoluble) of the protein while in solution, and were resolved via formulation studies and dosage 10 form design. Pre-formulation studies were designed to identify the appropriate pH environment for the stability of the mAb with a minimum of additional formulation excipients. Inclusion of surfactants was examined in order to assess any effects on stability. Sucrose served as a bulking agent, as well as, a cryoproctectant for lyophilization cycle development. Prospective solution formulations were tested in 15 order to determine sensitivities to freeze/thaw cycling, vigorous shaking, stress storage, and light. The protein formulations were subjected to a battery of analyses to assure the potency, purity, and quality of the material, which included, among others pH, appearance, UV/VIS, SDS-PAGE, SEC, ELISA, Bioassay, and chief. A final formulation of 50-mM succinic acid, pH 6.0, containing 5.0% sucrose was shown to 20 confer a sufficiently stable environment for a lyophilized immunoconjugate dosage form. However, it was determined that, the addition of a surfactant, such as Pluronic F68, should be considered in the case where a solution dosage form was desired. 6
Claims (7)
1. A stable aqueous formulation of huC242-DM1 suitable for subsequent lyophilization comprising huC242-DM1 in the concentration range of about 1 5 to 20 mg/mL, in a buffer maintained at pH in the range of about 5.8 to 6.2, and sucrose in about 5% w/v.
2. The formulation of claim 1 in which pH is maintained at 6 with between 1 to 100mM succinic acid. 10
3. The formulation of claim 2 in which the concentration of succinic acid is at 50mM.
4. A stable frozen formulation for monoclonal antibody C242, comprised of C242 15 in the concentration range of about 1 to 30 mg/mL in a buffer maintained at pH in the range of about 5.8 to 6.5, and sucrose in about 5% w/v.
5. The formulation of claim 4 in which pH is maintained at 6 with between 1 to 100mM succinic acid. 20
6. The formulation of claim 5 in which the concentration of succinic acid is at 50mM.
7
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US39318902P | 2002-07-02 | 2002-07-02 | |
US60/393,189 | 2002-07-02 | ||
PCT/US2003/020751 WO2004004639A2 (en) | 2002-07-02 | 2003-07-02 | A novel stable formulation |
Publications (1)
Publication Number | Publication Date |
---|---|
AU2003247686A1 true AU2003247686A1 (en) | 2004-01-23 |
Family
ID=30115555
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2003247686A Abandoned AU2003247686A1 (en) | 2002-07-02 | 2003-07-02 | A novel stable formulation |
Country Status (6)
Country | Link |
---|---|
US (1) | US20060246060A1 (en) |
EP (1) | EP1539239A4 (en) |
JP (1) | JP2005532395A (en) |
AU (1) | AU2003247686A1 (en) |
NZ (1) | NZ537610A (en) |
WO (1) | WO2004004639A2 (en) |
Families Citing this family (15)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
FR2853551B1 (en) | 2003-04-09 | 2006-08-04 | Lab Francais Du Fractionnement | STABILIZING FORMULATION FOR IMMUNOGLOBULIN G COMPOSITIONS IN LIQUID FORM AND LYOPHILIZED FORM |
CA2525553C (en) * | 2003-05-14 | 2011-07-05 | Immunogen, Inc. | Maytansinoid-antibody conjugate compositions |
JO3000B1 (en) | 2004-10-20 | 2016-09-05 | Genentech Inc | Antibody Formulations. |
WO2006125207A2 (en) | 2005-05-19 | 2006-11-23 | Amgen Inc. | Compositions and methods for increasing the stability of antibodies |
NZ599176A (en) | 2005-08-03 | 2014-04-30 | Immunogen Inc | Immunoconjugate formulations |
PE20080857A1 (en) | 2006-10-20 | 2008-08-19 | Amgen Inc | STABLE POLYPEPTIDE-BASED FORMULATIONS |
EP2069379A4 (en) * | 2006-10-31 | 2011-02-16 | Immunogen Inc | Methods for improving antibody production |
ES2666650T3 (en) | 2006-12-29 | 2018-05-07 | OstéoQC Inc. | Methods to alter bone growth by administration of antagonist or agonist of support or wise |
AR076284A1 (en) | 2009-04-29 | 2011-06-01 | Bayer Schering Pharma Ag | IMMUNOCONJUGADOS OF ANTIMESOTELINA AND USES OF THE SAME |
US10617764B2 (en) | 2013-11-21 | 2020-04-14 | Genmab A/S | Lyophilized anti-tissue factor antibody-drug conjugates |
KR20180101479A (en) | 2016-01-13 | 2018-09-12 | 젠맵 에이/에스 | Antibody and preparation for its drug conjugate |
WO2018158716A1 (en) | 2017-03-02 | 2018-09-07 | Cadila Healthcare Limited | Novel protein drug conjugate formulation |
MA49987A (en) | 2017-08-23 | 2020-07-01 | Daiichi Sankyo Co Ltd | ANTIBODY-DRUG CONJUGATE PREPARATION AND ASSOCIATED LYOPHILIZATION |
US11634485B2 (en) | 2019-02-18 | 2023-04-25 | Eli Lilly And Company | Therapeutic antibody formulation |
WO2020234114A1 (en) | 2019-05-21 | 2020-11-26 | Bayer Aktiengesellschaft | A novel stable high concentration formulation for anetumab ravtansine |
Family Cites Families (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
SE9102074D0 (en) * | 1991-07-03 | 1991-07-03 | Kabi Pharmacia Ab | TOMOUR ANTIGEN SPECIFIC ANTIBODY |
EP1516628B1 (en) * | 1995-07-27 | 2013-08-21 | Genentech, Inc. | Stable isotonic lyophilized protein formulation |
US6171586B1 (en) * | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
EP2266607A3 (en) * | 1999-10-01 | 2011-04-20 | Immunogen, Inc. | Immunoconjugates for treating cancer |
-
2003
- 2003-07-02 JP JP2004519737A patent/JP2005532395A/en active Pending
- 2003-07-02 AU AU2003247686A patent/AU2003247686A1/en not_active Abandoned
- 2003-07-02 WO PCT/US2003/020751 patent/WO2004004639A2/en active Application Filing
- 2003-07-02 EP EP03763089A patent/EP1539239A4/en not_active Withdrawn
- 2003-07-02 US US10/519,033 patent/US20060246060A1/en not_active Abandoned
- 2003-07-02 NZ NZ537610A patent/NZ537610A/en unknown
Also Published As
Publication number | Publication date |
---|---|
WO2004004639A2 (en) | 2004-01-15 |
US20060246060A1 (en) | 2006-11-02 |
WO2004004639A3 (en) | 2004-04-01 |
EP1539239A2 (en) | 2005-06-15 |
NZ537610A (en) | 2006-07-28 |
EP1539239A4 (en) | 2005-09-14 |
JP2005532395A (en) | 2005-10-27 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11987623B2 (en) | Stabilized antibody compositions | |
US20240091373A1 (en) | Antibody-drug conjugate lyophilised formulation | |
EP1409018B1 (en) | Stable lyophilized pharmaceutical formulation the igg antibody daclizumab | |
EP3129047B1 (en) | Stable formulations for anti-cd19 antibodies and antibody-drug conjugates | |
JP2881499B2 (en) | Stabilized antibody | |
EP1712240B1 (en) | Stable water-based medicinal preparation containing antibody | |
JP4607010B2 (en) | Protein-containing stabilized preparation | |
US20040091490A1 (en) | Stable pH optimized formulation of a modified antibody | |
US20060246060A1 (en) | Novel stable formulation | |
US20110070225A1 (en) | Beta antibody parenteral formulation | |
KR20040085185A (en) | Antibody-containing solution pharmaceuticals | |
JP2005513110A (en) | Lyophilized preparation containing antibody against EGF receptor | |
CN114632150A (en) | Pharmaceutical composition of anti-PD-L1 humanized monoclonal antibody | |
AU2020239621B2 (en) | Pharmaceutical formulations of Her2 antibody-drug conjugate | |
EP4070817A1 (en) | Liquid preparation containing anti-il-17 antibody | |
JP2010241718A (en) | Stable aqueous solution preparation of antibody | |
KR20180123559A (en) | PEGylated anti-human NGF antibody Fab 'fragments-containing pharmaceutical composition | |
WO2024083074A1 (en) | Formulations containing anti-tigit antibody and methods of use thereof | |
WO2024008032A1 (en) | Formulations for anti-pd-l1/anti-4-1bb bispecific antibodies | |
CN116172947A (en) | Pharmaceutical composition containing bispecific antibody specifically binding VEGF and ANG2 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
MK4 | Application lapsed section 142(2)(d) - no continuation fee paid for the application |