BE858740A - Recepteur de television muni d'un circuit de detection synchrone et d'un circuit de detection de deviations de frequence - Google Patents
Recepteur de television muni d'un circuit de detection synchrone et d'un circuit de detection de deviations de frequenceInfo
- Publication number
- BE858740A BE858740A BE180945A BE180945A BE858740A BE 858740 A BE858740 A BE 858740A BE 180945 A BE180945 A BE 180945A BE 180945 A BE180945 A BE 180945A BE 858740 A BE858740 A BE 858740A
- Authority
- BE
- Belgium
- Prior art keywords
- detection circuit
- television receiver
- frequency deviation
- receiver equipped
- synchronous detection
- Prior art date
Links
- 238000001514 detection method Methods 0.000 title 2
- 230000001360 synchronised effect Effects 0.000 title 1
Classifications
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04N—PICTORIAL COMMUNICATION, e.g. TELEVISION
- H04N5/00—Details of television systems
- H04N5/44—Receiver circuitry for the reception of television signals according to analogue transmission standards
- H04N5/50—Tuning indicators; Automatic tuning control
-
- H—ELECTRICITY
- H03—ELECTRONIC CIRCUITRY
- H03G—CONTROL OF AMPLIFICATION
- H03G3/00—Gain control in amplifiers or frequency changers
- H03G3/20—Automatic control
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04N—PICTORIAL COMMUNICATION, e.g. TELEVISION
- H04N5/00—Details of television systems
- H04N5/44—Receiver circuitry for the reception of television signals according to analogue transmission standards
- H04N5/455—Demodulation-circuits
Landscapes
- Engineering & Computer Science (AREA)
- Multimedia (AREA)
- Signal Processing (AREA)
- Television Receiver Circuits (AREA)
- Circuits Of Receivers In General (AREA)
- Superheterodyne Receivers (AREA)
- Processing Of Color Television Signals (AREA)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| NLAANVRAGE7610354,A NL183428B (nl) | 1976-09-17 | 1976-09-17 | Televisieontvanger met een synchrone detectieschakeling en een frequentieafwijkings-detectieschakeling. |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| BE858740A true BE858740A (fr) | 1978-03-15 |
Family
ID=19826919
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| BE180945A BE858740A (fr) | 1976-09-17 | 1977-09-15 | Recepteur de television muni d'un circuit de detection synchrone et d'un circuit de detection de deviations de frequence |
Country Status (15)
| Country | Link |
|---|---|
| US (1) | US4157569A (OSRAM) |
| JP (1) | JPS5338220A (OSRAM) |
| AU (1) | AU510811B2 (OSRAM) |
| BE (1) | BE858740A (OSRAM) |
| CA (1) | CA1091340A (OSRAM) |
| DE (1) | DE2740623C3 (OSRAM) |
| ES (1) | ES462376A1 (OSRAM) |
| FI (1) | FI63144C (OSRAM) |
| FR (1) | FR2365257A1 (OSRAM) |
| GB (1) | GB1537799A (OSRAM) |
| HK (1) | HK66179A (OSRAM) |
| IT (1) | IT1085396B (OSRAM) |
| NL (1) | NL183428B (OSRAM) |
| NZ (1) | NZ185176A (OSRAM) |
| ZA (1) | ZA774892B (OSRAM) |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4253118A (en) * | 1979-07-02 | 1981-02-24 | Zenith Radio Corporation | Synchronous detection system |
| US4323924A (en) * | 1980-10-06 | 1982-04-06 | Zenith Radio Corporation | Automatic phase adjusting circuit for a synchronous detector |
| US4388649A (en) * | 1981-06-01 | 1983-06-14 | Rca Corporation | AFT Lockout prevention system |
| NL8200374A (nl) * | 1982-02-02 | 1983-09-01 | Philips Nv | Televisie-ontvanger met een videosignaaldetektor van een met behulp van een referentiesignaal detekterend type. |
| NL8301179A (nl) * | 1983-04-01 | 1984-11-01 | Philips Nv | Ontvanger voor hf-signalen voorzien van een paar parallelle signaalwegen. |
| NL8800555A (nl) * | 1988-03-07 | 1989-10-02 | Philips Nv | Synchrone demodulatieschakeling voor een op een draaggolf gemoduleerd televisiesignaal. |
| DE10158357A1 (de) * | 2001-11-28 | 2003-06-12 | Philips Intellectual Property | Kompensationsschaltung für Frequenzfilter |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2573248A (en) * | 1949-06-18 | 1951-10-30 | Zenith Radio Corp | Television receiver |
| NL6609958A (OSRAM) * | 1966-07-15 | 1968-01-16 | ||
| US3812289A (en) * | 1972-11-06 | 1974-05-21 | Rca Corp | Television receiver using synchronous video detection |
| US3858000A (en) * | 1972-12-04 | 1974-12-31 | Warwick Electronics Inc | Extended range afc system |
| GB1440342A (en) * | 1973-04-10 | 1976-06-23 | Thorn Electrical Ind Ltd | Television receiver circuits |
| NL7306381A (OSRAM) * | 1973-05-08 | 1974-11-12 | ||
| JPS51100632A (OSRAM) * | 1975-03-03 | 1976-09-06 | Matsushita Electric Industrial Co Ltd | |
| US4091410A (en) * | 1976-11-08 | 1978-05-23 | Zenith Radio Corporation | Frequency and phase lock loop synchronous detecting system having a pair of phase lock conditions |
-
1976
- 1976-09-17 NL NLAANVRAGE7610354,A patent/NL183428B/xx not_active Application Discontinuation
-
1977
- 1977-08-12 ZA ZA00774892A patent/ZA774892B/xx unknown
- 1977-08-18 US US05/825,575 patent/US4157569A/en not_active Expired - Lifetime
- 1977-09-09 DE DE2740623A patent/DE2740623C3/de not_active Expired
- 1977-09-13 CA CA286,585A patent/CA1091340A/en not_active Expired
- 1977-09-14 GB GB38362/77A patent/GB1537799A/en not_active Expired
- 1977-09-14 IT IT27538/77A patent/IT1085396B/it active
- 1977-09-14 FI FI772706A patent/FI63144C/fi not_active IP Right Cessation
- 1977-09-14 NZ NZ185176A patent/NZ185176A/xx unknown
- 1977-09-15 BE BE180945A patent/BE858740A/xx not_active IP Right Cessation
- 1977-09-15 ES ES462376A patent/ES462376A1/es not_active Expired
- 1977-09-16 JP JP11062977A patent/JPS5338220A/ja active Granted
- 1977-09-16 FR FR7728006A patent/FR2365257A1/fr active Granted
- 1977-09-19 AU AU28912/77A patent/AU510811B2/en not_active Expired
-
1979
- 1979-09-13 HK HK661/79A patent/HK66179A/xx unknown
Also Published As
| Publication number | Publication date |
|---|---|
| FR2365257B1 (OSRAM) | 1982-05-14 |
| JPS6216067B2 (OSRAM) | 1987-04-10 |
| CA1091340A (en) | 1980-12-09 |
| FI772706A7 (fi) | 1978-03-18 |
| DE2740623B2 (de) | 1979-07-05 |
| AU510811B2 (en) | 1980-07-17 |
| GB1537799A (en) | 1979-01-04 |
| NZ185176A (en) | 1980-08-26 |
| ES462376A1 (es) | 1978-06-01 |
| DE2740623A1 (de) | 1978-03-23 |
| HK66179A (en) | 1979-09-21 |
| NL183428B (nl) | 1988-05-16 |
| JPS5338220A (en) | 1978-04-08 |
| NL7610354A (nl) | 1978-03-21 |
| FI63144C (fi) | 1983-04-11 |
| FR2365257A1 (fr) | 1978-04-14 |
| DE2740623C3 (de) | 1980-03-20 |
| AU2891277A (en) | 1979-03-29 |
| FI63144B (fi) | 1982-12-31 |
| IT1085396B (it) | 1985-05-28 |
| ZA774892B (en) | 1979-03-28 |
| US4157569A (en) | 1979-06-05 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JPS52116106A (en) | Television signal synchronizer | |
| FR2497432B1 (fr) | Recepteur de television a circuit de doublage de la frequence de balayage d'une ligne | |
| NL7703927A (nl) | Televisie-synchronisatiesignaalgenerator. | |
| SE412828B (sv) | Mottagare innefattande en avstemningskrets med en sendarsokningsanordning | |
| SE7812891L (sv) | Televisionsmottagare innefattande en linjesynkroniseringskrets | |
| SE7810993L (sv) | Mottagare med en frekvenssynteskrets | |
| JPS5321517A (en) | Synchronizing signal selection circuit | |
| FR2391616B1 (fr) | Recepteur de television a ecran orientable | |
| NO801292L (no) | Fjernsynsmottaker med en synkroniseringsinnretning | |
| BR8000201A (pt) | Receptor tendo um circuito de sintonizacao de busca | |
| IT1085396B (it) | Ricevitore televisivo dotato di un circuito di rivelazione sincrono e di un circuito di reivelazione delle deviazioni di frequenza | |
| FR2336830A1 (fr) | Circuit de reglage fin automatique de la frequence d'accord d'un recepteur de television | |
| GB1540523A (en) | Method of deriving a signal indicating the time position of the vertical component in a television synchronising signal | |
| JPS5310997A (en) | Hf invader sensor receiver circuit disposition | |
| MY8000166A (en) | A receiver for detecting components at different frequencies in a received signal | |
| YU33477A (en) | Holding assembly in a receiver for the detection of two frequency in amultifrequency tone signal | |
| IT8024016A0 (it) | Circuito per inibire le interferenze a radiofrequenza in un ricevitore televisivo. | |
| IT1087137B (it) | Ricevitore televisivo con temoporizzatore incorporato | |
| DK287677A (da) | Fjernsynsmodtager med et frekvenssynteseafstemningskredslob | |
| IT1055763B (it) | Ricevitore comprendente un circuito cerca stazione | |
| SE422133B (sv) | Avstemningsanordning for en radio- eller televisionsmottagare | |
| SE7705512L (sv) | Avlenkningsanordning for en ferg-tv-mottagare | |
| JPS5338957A (en) | Free running oscillator synchronizer | |
| JPS5317013A (en) | Television signal generator | |
| FR2439507B1 (fr) | Montage de synchronisation de la frequence d'oscillateur et de la frequence de resonance du circuit d'entree d'un recepteur super-heterodyne |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| RE | Patent lapsed |
Owner name: N.V. PHILIPS GLOEILAMPENFABRIEKEN Effective date: 19880930 |