FR2439507B1 - Montage de synchronisation de la frequence d'oscillateur et de la frequence de resonance du circuit d'entree d'un recepteur super-heterodyne - Google Patents

Montage de synchronisation de la frequence d'oscillateur et de la frequence de resonance du circuit d'entree d'un recepteur super-heterodyne

Info

Publication number
FR2439507B1
FR2439507B1 FR7925612A FR7925612A FR2439507B1 FR 2439507 B1 FR2439507 B1 FR 2439507B1 FR 7925612 A FR7925612 A FR 7925612A FR 7925612 A FR7925612 A FR 7925612A FR 2439507 B1 FR2439507 B1 FR 2439507B1
Authority
FR
France
Prior art keywords
super
input circuit
frequency
heterodyne receiver
synchronization assembly
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Expired
Application number
FR7925612A
Other languages
English (en)
Other versions
FR2439507A1 (fr
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Licentia Patent Verwaltungs GmbH
Original Assignee
Licentia Patent Verwaltungs GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from DE19782844938 external-priority patent/DE2844938C2/de
Priority claimed from DE19782845005 external-priority patent/DE2845005A1/de
Priority claimed from DE2856397A external-priority patent/DE2856397C2/de
Application filed by Licentia Patent Verwaltungs GmbH filed Critical Licentia Patent Verwaltungs GmbH
Publication of FR2439507A1 publication Critical patent/FR2439507A1/fr
Application granted granted Critical
Publication of FR2439507B1 publication Critical patent/FR2439507B1/fr
Expired legal-status Critical Current

Links

Classifications

    • H—ELECTRICITY
    • H03—ELECTRONIC CIRCUITRY
    • H03J—TUNING RESONANT CIRCUITS; SELECTING RESONANT CIRCUITS
    • H03J5/00—Discontinuous tuning; Selecting predetermined frequencies; Selecting frequency bands with or without continuous tuning in one or more of the bands, e.g. push-button tuning, turret tuner
    • H03J5/02—Discontinuous tuning; Selecting predetermined frequencies; Selecting frequency bands with or without continuous tuning in one or more of the bands, e.g. push-button tuning, turret tuner with variable tuning element having a number of predetermined settings and adjustable to a desired one of these settings
    • H03J5/0245—Discontinuous tuning using an electrical variable impedance element, e.g. a voltage variable reactive diode, in which no corresponding analogue value either exists or is preset, i.e. the tuning information is only available in a digital form
    • H03J5/0272—Discontinuous tuning using an electrical variable impedance element, e.g. a voltage variable reactive diode, in which no corresponding analogue value either exists or is preset, i.e. the tuning information is only available in a digital form the digital values being used to preset a counter or a frequency divider in a phase locked loop, e.g. frequency synthesizer
    • H03J5/0281—Discontinuous tuning using an electrical variable impedance element, e.g. a voltage variable reactive diode, in which no corresponding analogue value either exists or is preset, i.e. the tuning information is only available in a digital form the digital values being used to preset a counter or a frequency divider in a phase locked loop, e.g. frequency synthesizer the digital values being held in an auxiliary non erasable memory
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01R—MEASURING ELECTRIC VARIABLES; MEASURING MAGNETIC VARIABLES
    • G01R23/00—Arrangements for measuring frequencies; Arrangements for analysing frequency spectra
    • G01R23/005—Circuits for comparing several input signals and for indicating the result of this comparison, e.g. equal, different, greater, smaller (comparing phase or frequency of 2 mutually independent oscillations in demodulators)
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01R—MEASURING ELECTRIC VARIABLES; MEASURING MAGNETIC VARIABLES
    • G01R23/00—Arrangements for measuring frequencies; Arrangements for analysing frequency spectra
    • G01R23/02—Arrangements for measuring frequency, e.g. pulse repetition rate; Arrangements for measuring period of current or voltage
    • G01R23/06—Arrangements for measuring frequency, e.g. pulse repetition rate; Arrangements for measuring period of current or voltage by converting frequency into an amplitude of current or voltage
    • H—ELECTRICITY
    • H03—ELECTRONIC CIRCUITRY
    • H03J—TUNING RESONANT CIRCUITS; SELECTING RESONANT CIRCUITS
    • H03J3/00—Continuous tuning
    • H03J3/28—Continuous tuning of more than one resonant circuit simultaneously, the tuning frequencies of the circuits having a substantially constant difference throughout the tuning range
FR7925612A 1978-10-16 1979-10-15 Montage de synchronisation de la frequence d'oscillateur et de la frequence de resonance du circuit d'entree d'un recepteur super-heterodyne Expired FR2439507B1 (fr)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
DE19782844938 DE2844938C2 (de) 1978-10-16 1978-10-16 Schaltungsanordnung zur Erzielung eines Gleichlaufs zwischen der Oszillatorfrequenz und der Resonanzfrequenz des Eingangskreises eines Überlagerungsempfängers
DE19782845005 DE2845005A1 (de) 1978-10-16 1978-10-16 Schaltungsanordnung zur erzielung eines frequenzabhaengigen signals
DE2856397A DE2856397C2 (de) 1978-12-28 1978-12-28 Schaltungsanordnung zur Erzielung eines Gleichlaufs zwischen der Oszillatorfrequenz und der Resonanzfrequenz des Eingangskreises eines Überlagerungsempfängers.

Publications (2)

Publication Number Publication Date
FR2439507A1 FR2439507A1 (fr) 1980-05-16
FR2439507B1 true FR2439507B1 (fr) 1986-07-04

Family

ID=27187711

Family Applications (1)

Application Number Title Priority Date Filing Date
FR7925612A Expired FR2439507B1 (fr) 1978-10-16 1979-10-15 Montage de synchronisation de la frequence d'oscillateur et de la frequence de resonance du circuit d'entree d'un recepteur super-heterodyne

Country Status (3)

Country Link
FR (1) FR2439507B1 (fr)
GB (1) GB2037512B (fr)
IT (1) IT1165325B (fr)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP3066690B2 (ja) * 1993-09-20 2000-07-17 富士通株式会社 位相同期発振回路

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3617899A (en) * 1969-01-15 1971-11-02 Motorola Inc Tuning control for multiple electronically tuned circuits
US3657654A (en) * 1969-09-11 1972-04-18 Gen Instrument Corp Communications receiver employing varactor controlled tuning stages
US3701949A (en) * 1971-03-22 1972-10-31 Cutler Hammer Inc Wideband frequency scanning radio receiver
US3758865A (en) * 1972-01-18 1973-09-11 Gen Motors Corp Bias voltage generator for the voltage-responsive tuning elements in an electronically tuned radio receiver
FR2175671B1 (fr) * 1972-03-17 1977-04-01 Trt Telecom Radio Electr
JPS5185303A (fr) * 1975-01-23 1976-07-26 Tokyo Shibaura Electric Co

Also Published As

Publication number Publication date
IT1165325B (it) 1987-04-22
GB2037512A (en) 1980-07-09
IT7926513A0 (it) 1979-10-15
FR2439507A1 (fr) 1980-05-16
GB2037512B (en) 1983-09-01

Similar Documents

Publication Publication Date Title
JPS54129898A (en) Method of adjusting resonant frequency of piezooelectric element
DE3167182D1 (en) Frequency/phase locked loop and its use as part of a television or colour-television circuit
JPS55163800A (en) High frequency resonator having two resonance frequencies and cyclotron having resonator
JPS5596711A (en) Method of controlling frequency of resonator and resonator fabricated thereby
JPS5443718A (en) Piezootransducer and method of reducing its resonance frequency
DE3263705D1 (en) Frequency-controlled oscillator comprising a piezo-electric element and having an extended frequency variation range
FI872367A0 (fi) Foerfarande foer framstaellning av vattenhaltiga n-metylmorfolin n-oxidloesningar.
IT1086347B (it) Sistema combinato comprendente un oscillatore controllato e un moltiplicatore di frequenza
IT7869430A0 (it) Ricevitore avente un circuito sintetizzatore di frequenza
FR2472886B1 (fr) Recepteur a synthetiseur de frequence
FR2439507B1 (fr) Montage de synchronisation de la frequence d'oscillateur et de la frequence de resonance du circuit d'entree d'un recepteur super-heterodyne
ES538210A0 (es) Un circuito de entrada de un receptor de television, para separar las componentes de muy alta frecuencia y ultra alta frecuencia de una senal combinada
FR2336830A1 (fr) Circuit de reglage fin automatique de la frequence d'accord d'un recepteur de television
BE858740A (fr) Recepteur de television muni d'un circuit de detection synchrone et d'un circuit de detection de deviations de frequence
GB2120879B (en) Oscillator synchronizing system with dc control of free-running frequency
FR2601145B1 (fr) Telemetre a frequence accordee
JPS53116758A (en) Resonant frequency tuning device
JPS5555617A (en) Circuit device for synchronizing between oscillation frequency of superheterodyne receiver and resonance frequency of input circuit
IT1091582B (it) Stadio di mescolazione con accoppiamento capacitivo della frequenza dell'oscillatore
GB1551008A (en) Determination of the frequency of vibration of an element
ES519310A0 (es) Un circuito de frecuencia intermedia y television.
DK287677A (da) Fjernsynsmodtager med et frekvenssynteseafstemningskredslob
IT8867115A0 (it) Procedimento di sincronizzazione di posti emettitori ricevitori di unarete a salti di frequenza rapidi e posto destinato all'esecuzione ditale procedimento
FR2606886B1 (fr) Dispositif resonateur a frequence variable
JPS5397712A (en) Frequency and phase synchronization search receiver

Legal Events

Date Code Title Description
TP Transmission of property
ST Notification of lapse