AU530083B2 - Loop antennas for electronic security system - Google Patents
Loop antennas for electronic security systemInfo
- Publication number
- AU530083B2 AU530083B2 AU62989/80A AU6298980A AU530083B2 AU 530083 B2 AU530083 B2 AU 530083B2 AU 62989/80 A AU62989/80 A AU 62989/80A AU 6298980 A AU6298980 A AU 6298980A AU 530083 B2 AU530083 B2 AU 530083B2
- Authority
- AU
- Australia
- Prior art keywords
- security system
- loop antennas
- electronic security
- electronic
- antennas
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- G—PHYSICS
- G08—SIGNALLING
- G08B—SIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
- G08B13/00—Burglar, theft or intruder alarms
- G08B13/22—Electrical actuation
- G08B13/24—Electrical actuation by interference with electromagnetic field distribution
- G08B13/2402—Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
- G08B13/2465—Aspects related to the EAS system, e.g. system components other than tags
- G08B13/2468—Antenna in system and the related signal processing
- G08B13/2471—Antenna signal processing by receiver or emitter
-
- G—PHYSICS
- G08—SIGNALLING
- G08B—SIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
- G08B13/00—Burglar, theft or intruder alarms
- G08B13/22—Electrical actuation
- G08B13/24—Electrical actuation by interference with electromagnetic field distribution
- G08B13/2402—Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
- G08B13/2465—Aspects related to the EAS system, e.g. system components other than tags
- G08B13/2468—Antenna in system and the related signal processing
- G08B13/2474—Antenna or antenna activator geometry, arrangement or layout
-
- H—ELECTRICITY
- H01—ELECTRIC ELEMENTS
- H01Q—ANTENNAS, i.e. RADIO AERIALS
- H01Q7/00—Loop antennas with a substantially uniform current distribution around the loop and having a directional radiation pattern in a plane perpendicular to the plane of the loop
- H01Q7/04—Screened antennas
Landscapes
- Engineering & Computer Science (AREA)
- Physics & Mathematics (AREA)
- Signal Processing (AREA)
- Automation & Control Theory (AREA)
- Computer Security & Cryptography (AREA)
- Electromagnetism (AREA)
- General Physics & Mathematics (AREA)
- Burglar Alarm Systems (AREA)
- Variable-Direction Aerials And Aerial Arrays (AREA)
- Details Of Aerials (AREA)
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US094429 | 1979-11-15 | ||
| US06/094,429 US4251808A (en) | 1979-11-15 | 1979-11-15 | Shielded balanced loop antennas for electronic security systems |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| AU6298980A AU6298980A (en) | 1981-06-04 |
| AU530083B2 true AU530083B2 (en) | 1983-06-30 |
Family
ID=22245143
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| AU62989/80A Ceased AU530083B2 (en) | 1979-11-15 | 1980-10-06 | Loop antennas for electronic security system |
Country Status (13)
| Country | Link |
|---|---|
| US (1) | US4251808A (enExample) |
| JP (1) | JPS5683000A (enExample) |
| AU (1) | AU530083B2 (enExample) |
| CA (1) | CA1148630A (enExample) |
| DE (1) | DE3043026A1 (enExample) |
| DK (1) | DK158686C (enExample) |
| ES (2) | ES496218A0 (enExample) |
| FR (1) | FR2470976A1 (enExample) |
| GB (1) | GB2063569B (enExample) |
| IT (1) | IT1129351B (enExample) |
| MX (1) | MX148678A (enExample) |
| SE (1) | SE445498B (enExample) |
| ZA (1) | ZA806639B (enExample) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU608720B2 (en) * | 1988-07-29 | 1991-04-11 | Knogo Corporation | Load isolated article surveillance system and antenna assembly |
| AU640464B2 (en) * | 1990-02-28 | 1993-08-26 | Esselte Meto International Produktions Gmbh | Detection apparatus for security systems |
Families Citing this family (61)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA1138955A (en) * | 1979-09-14 | 1983-01-04 | Edward R. Fearon | Anti-shoplifting system |
| US4373163A (en) * | 1980-07-14 | 1983-02-08 | I.D. Engineering, Inc. | Loop antenna for security systems |
| US4384281A (en) * | 1980-10-31 | 1983-05-17 | Knogo Corporation | Theft detection apparatus using saturable magnetic targets |
| US4342999A (en) * | 1980-11-25 | 1982-08-03 | Rca Corporation | Loop antenna arrangements for inclusion in a television receiver |
| US4394645A (en) * | 1981-09-10 | 1983-07-19 | Sensormatic Electronics Corporation | Electrical surveillance apparatus with moveable antenna elements |
| USRE32627E (en) * | 1981-09-10 | 1988-03-22 | Sensormatic Electronics Corporation | Electrical surveillance apparatus with moveable antenna elements |
| FI843445A7 (fi) * | 1983-01-03 | 1984-09-03 | Shin Myong | Myymälävarkauksien estojärjestelmä. |
| US4509039A (en) * | 1983-07-05 | 1985-04-02 | Minnesota Mining And Manufacturing Company | Shielded, closely spaced transmit-receiver antennas for electronic article surveillance system |
| US4531117A (en) * | 1983-07-05 | 1985-07-23 | Minnesota Mining And Manufacturing Company | Variable frequency RF electronic surveillance system |
| US4609911A (en) * | 1983-07-05 | 1986-09-02 | Minnesota Mining And Manufacturing Company | Variable frequency RF electronic surveillance system |
| US4642613A (en) * | 1984-03-16 | 1987-02-10 | Knogo Corporation | Electronic theft detection apparatus with responder elements on protected articles |
| AU633247B2 (en) * | 1985-01-10 | 1993-01-28 | Checkpoint Systems, Inc. | Antenna system for magnetic and resonant circuit detection |
| US4751516A (en) * | 1985-01-10 | 1988-06-14 | Lichtblau G J | Antenna system for magnetic and resonant circuit detection |
| US4647910A (en) * | 1985-09-17 | 1987-03-03 | Allied Corporation | Selector for AC magnetic inductive field receiver coils |
| US4728938A (en) * | 1986-01-10 | 1988-03-01 | Checkpoint Systems, Inc. | Security tag deactivation system |
| US4769631A (en) * | 1986-06-30 | 1988-09-06 | Sensormatic Electronics Corporation | Method, system and apparatus for magnetic surveillance of articles |
| JPS63236401A (ja) * | 1987-03-25 | 1988-10-03 | Kokusai Electric Co Ltd | 誘導無線装置用ループアンテナ |
| US4779077A (en) * | 1987-04-13 | 1988-10-18 | Lichtblau G J | Continuously armed high reliability pulse train processor |
| US4872018A (en) * | 1987-08-31 | 1989-10-03 | Monarch Marking Systems, Inc. | Multiple loop antenna |
| US4972198A (en) * | 1987-08-31 | 1990-11-20 | Monarch Marking Systems, Inc. | Multiple loop antenna |
| US5103235A (en) * | 1988-12-30 | 1992-04-07 | Checkpoint Systems, Inc. | Antenna structure for an electronic article surveillance system |
| US4999641A (en) * | 1989-09-01 | 1991-03-12 | Monarch Marking Systems, Inc. | Magnetic antenna system having independently controllable electrical field shielding and magnetic field balance |
| US5051726A (en) * | 1990-08-14 | 1991-09-24 | Sensormatic Electronics Corporation | Electronic article surveillance system with antenna array for enhanced field falloff |
| NL9100397A (nl) * | 1991-03-06 | 1992-10-01 | Nedap Nv | Asymmetrische antenne voor winkeldiefstaldetectiesystemen. |
| US5142292A (en) * | 1991-08-05 | 1992-08-25 | Checkpoint Systems, Inc. | Coplanar multiple loop antenna for electronic article surveillance systems |
| US5442334A (en) * | 1992-07-20 | 1995-08-15 | Stoplift Corporation | Security system having deactivatable security tag |
| US5404147A (en) * | 1992-10-28 | 1995-04-04 | Sensormatic Electronics Corporation | EAS system loop antenna having three loops of different area |
| US5373301A (en) * | 1993-01-04 | 1994-12-13 | Checkpoint Systems, Inc. | Transmit and receive antenna having angled crossover elements |
| DE59406653D1 (de) * | 1993-07-13 | 1998-09-17 | Actron Entwicklungs Ag | Antennenvorrichtung |
| US5694139A (en) * | 1994-06-28 | 1997-12-02 | Sony Corporation | Short-distance communication antenna and methods of manufacturing and using the short-distance communication antenna |
| EP0703637A1 (de) | 1994-09-23 | 1996-03-27 | Actron Entwicklungs AG | Antenne für ein elektronisches Sicherungssystem |
| AU702622B2 (en) * | 1995-05-30 | 1999-02-25 | Sensormatic Electronics Corporation | EAS system antenna configuration for providing improved interrogation field distribution |
| US5602556A (en) * | 1995-06-07 | 1997-02-11 | Check Point Systems, Inc. | Transmit and receive loop antenna |
| US5825335A (en) * | 1995-10-23 | 1998-10-20 | Kubota Corporation | Sheet antenna apparatus |
| US5653192A (en) * | 1996-03-06 | 1997-08-05 | Alfa Laval Agri Inc. | Livestock identification apparatus |
| EP0892969A4 (en) * | 1996-04-10 | 2000-12-06 | Sentry Technology Corp | ELECTRONIC GOODS MONITORING SYSTEM |
| US5914692A (en) * | 1997-01-14 | 1999-06-22 | Checkpoint Systems, Inc. | Multiple loop antenna with crossover element having a pair of spaced, parallel conductors for electrically connecting the multiple loops |
| DE19732254A1 (de) * | 1997-07-26 | 1999-02-11 | Kaba Benzing Gmbh | Vorrichtung zur Übermittlung magnetischer Signale mittels einer Leiterplatte |
| JP3389464B2 (ja) | 1997-08-07 | 2003-03-24 | 三洋電機株式会社 | 盗難防止ゲート |
| US6611783B2 (en) | 2000-01-07 | 2003-08-26 | Nocwatch, Inc. | Attitude indicator and activity monitoring device |
| EP1158601A1 (de) * | 2000-05-15 | 2001-11-28 | Häni Prolectron Ag | Trägerelement für eine Antenne mit geringer Handempfindlichkeit |
| US6900727B2 (en) | 2002-07-16 | 2005-05-31 | Bert Taeho Lee | Weapon detector system |
| US7030750B2 (en) | 2002-07-16 | 2006-04-18 | Bert Taeho Lee | Detachable entrance and exit gate with a combined commodity burglarproofing and small arms detecting system |
| KR200298223Y1 (ko) * | 2002-09-11 | 2002-12-16 | 태호 리 버트 | 총기류 탐지 겸용 상품도난 방지장치의 출입게이트 구조 |
| US20040102870A1 (en) * | 2002-11-26 | 2004-05-27 | Andersen Scott Paul | RFID enabled paper rolls and system and method for tracking inventory |
| WO2005083649A1 (en) * | 2004-02-19 | 2005-09-09 | Koninklijke Philips Electronics, N.V. | Method and apparatus for communicating the existence of an emergency situation without uniquely identifying the source of the communication |
| US7591415B2 (en) * | 2004-09-28 | 2009-09-22 | 3M Innovative Properties Company | Passport reader for processing a passport having an RFID element |
| US20070252001A1 (en) * | 2006-04-25 | 2007-11-01 | Kail Kevin J | Access control system with RFID and biometric facial recognition |
| EP2327230B1 (en) | 2008-09-04 | 2013-03-27 | Allflex Usa, Inc. | Combination full-duplex and half-duplex electronic identification tag |
| US8811542B2 (en) * | 2009-10-09 | 2014-08-19 | Aleis Pty Ltd. | HDX demodulator |
| CA2780323C (en) * | 2009-10-09 | 2018-06-12 | Aleis Pty Ltd | Radio frequency identification reader antenna having a dynamically adjustable q-factor |
| AU2010315240B2 (en) * | 2009-11-04 | 2016-05-05 | Allflex USA LLC | Signal cancelling transmit/receive multi-loop antenna for a radio frequency identification reader |
| US20120139730A1 (en) * | 2010-12-03 | 2012-06-07 | Metrologic Instruments, Inc. | Electronic article surveillance system |
| US9004164B2 (en) | 2011-04-25 | 2015-04-14 | Conocophillips Company | In situ radio frequency catalytic upgrading |
| US9671478B2 (en) * | 2011-07-22 | 2017-06-06 | Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. | Antenna and antenna arrangement for magnetic resonance applications |
| CA3166020C (en) * | 2011-10-11 | 2024-01-09 | Senseonics, Incorporated | Electrodynamic field strength triggering system |
| US9577349B2 (en) | 2015-06-29 | 2017-02-21 | Near Field Magnetics, Inc. | Near-field magnetic communication antenna |
| DE102017105649A1 (de) * | 2017-03-16 | 2018-09-20 | Bundesdruckerei Gmbh | RFID-Lesegerät und Verfahren zu seiner Herstellung |
| US11283296B2 (en) | 2017-05-26 | 2022-03-22 | Nucurrent, Inc. | Crossover inductor coil and assembly for wireless transmission |
| US11283303B2 (en) | 2020-07-24 | 2022-03-22 | Nucurrent, Inc. | Area-apportioned wireless power antenna for maximized charging volume |
| US11695302B2 (en) | 2021-02-01 | 2023-07-04 | Nucurrent, Inc. | Segmented shielding for wide area wireless power transmitter |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB419783A (en) * | 1933-02-02 | 1934-11-19 | Marconi Wireless Telegraph Co | Improvements in and relating to wireless receiving apparatus |
| US2391026A (en) * | 1943-11-15 | 1945-12-18 | Standard Telephones Cables Ltd | Shielded loop antenna |
| JPS4327094Y1 (enExample) * | 1964-02-25 | 1968-11-09 | ||
| US3863244A (en) * | 1972-06-14 | 1975-01-28 | Lichtblau G J | Electronic security system having improved noise discrimination |
| US3810147A (en) * | 1971-12-30 | 1974-05-07 | G Lichtblau | Electronic security system |
| US3967161A (en) * | 1972-06-14 | 1976-06-29 | Lichtblau G J | A multi-frequency resonant tag circuit for use with an electronic security system having improved noise discrimination |
| US3973263A (en) * | 1973-04-20 | 1976-08-03 | The United States Of America As Represented By The Secretary Of The Navy | Sensitivity improvement of spaced-loop antenna by capacitive gap loading |
| JPS5046062A (enExample) * | 1973-08-28 | 1975-04-24 | ||
| JPS5226879A (en) * | 1975-08-26 | 1977-02-28 | Nippon Telegr & Teleph Corp <Ntt> | Method of measuring phase constants in waveguides |
| US4243980A (en) * | 1978-02-17 | 1981-01-06 | Lichtblau G J | Antenna system for electronic security installations |
| US4260990A (en) * | 1979-11-08 | 1981-04-07 | Lichtblau G J | Asymmetrical antennas for use in electronic security systems |
-
1979
- 1979-11-15 US US06/094,429 patent/US4251808A/en not_active Expired - Lifetime
-
1980
- 1980-10-06 AU AU62989/80A patent/AU530083B2/en not_active Ceased
- 1980-10-10 CA CA000362129A patent/CA1148630A/en not_active Expired
- 1980-10-23 ES ES496218A patent/ES496218A0/es active Granted
- 1980-10-29 ZA ZA00806639A patent/ZA806639B/xx unknown
- 1980-10-30 IT IT68658/80A patent/IT1129351B/it active
- 1980-11-11 MX MX184713A patent/MX148678A/es unknown
- 1980-11-12 JP JP15834080A patent/JPS5683000A/ja active Granted
- 1980-11-14 GB GB8036676A patent/GB2063569B/en not_active Expired
- 1980-11-14 DK DK489380A patent/DK158686C/da active
- 1980-11-14 DE DE19803043026 patent/DE3043026A1/de active Granted
- 1980-11-14 FR FR8024264A patent/FR2470976A1/fr active Granted
- 1980-11-14 SE SE8007986A patent/SE445498B/sv not_active IP Right Cessation
-
1981
- 1981-11-16 ES ES507188A patent/ES507188A0/es active Granted
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU608720B2 (en) * | 1988-07-29 | 1991-04-11 | Knogo Corporation | Load isolated article surveillance system and antenna assembly |
| AU640464B2 (en) * | 1990-02-28 | 1993-08-26 | Esselte Meto International Produktions Gmbh | Detection apparatus for security systems |
Also Published As
| Publication number | Publication date |
|---|---|
| ES8202958A1 (es) | 1982-02-16 |
| MX148678A (es) | 1983-05-27 |
| JPS5683000A (en) | 1981-07-07 |
| ES8302369A1 (es) | 1982-12-16 |
| US4251808A (en) | 1981-02-17 |
| ZA806639B (en) | 1981-11-25 |
| DK158686C (da) | 1991-02-25 |
| DK158686B (da) | 1990-07-02 |
| FR2470976A1 (fr) | 1981-06-12 |
| ES496218A0 (es) | 1982-02-16 |
| CA1148630A (en) | 1983-06-21 |
| FR2470976B1 (enExample) | 1984-11-23 |
| JPH0230553B2 (enExample) | 1990-07-06 |
| DE3043026A1 (de) | 1981-05-21 |
| AU6298980A (en) | 1981-06-04 |
| IT1129351B (it) | 1986-06-04 |
| DE3043026C2 (enExample) | 1990-02-22 |
| DK489380A (da) | 1981-05-16 |
| GB2063569B (en) | 1983-06-22 |
| SE445498B (sv) | 1986-06-23 |
| SE8007986L (sv) | 1981-05-16 |
| ES507188A0 (es) | 1982-12-16 |
| IT8068658A0 (it) | 1980-10-30 |
| GB2063569A (en) | 1981-06-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU530083B2 (en) | Loop antennas for electronic security system | |
| GB2062969B (en) | Antenna systems for electronic security systems | |
| JPS54115099A (en) | Antenna system for electronic security system | |
| GB2051442B (en) | Security system | |
| DE3070243D1 (en) | System for electronic audio communication | |
| GB2080040B (en) | Passive stabilisation system for tracking antennas | |
| AU514190B2 (en) | Microwave surveillance system | |
| AU561298B2 (en) | Shielded loop for electronic surveillance system | |
| DE3071131D1 (en) | Communication system tracking arrangement | |
| EP0022656A3 (en) | Directivity-controllable antenna system | |
| AU532289B2 (en) | Segmented loop antenna system | |
| GB2039683B (en) | Security system | |
| AU536696B2 (en) | Antenna | |
| AU496857B1 (en) | Feed system for microwave antenna | |
| AU7760881A (en) | Receiver loop antenna | |
| AU531930B2 (en) | Antenna locking mount | |
| DE3070377D1 (en) | Combined antenna system | |
| AU5714280A (en) | Electromagnetic devices | |
| JPS55165382A (en) | Lock system | |
| AU6060580A (en) | Key loop | |
| GB2051445B (en) | Surveillance system | |
| IL57521A0 (en) | An electronic security system | |
| AU525443B2 (en) | Security system | |
| AU526820B2 (en) | Security system | |
| AU536803B2 (en) | Security system |