WO2023178357A1 - Bispecific antibody fusion molecules and methods of use thereof - Google Patents
Bispecific antibody fusion molecules and methods of use thereof Download PDFInfo
- Publication number
- WO2023178357A1 WO2023178357A1 PCT/US2023/064728 US2023064728W WO2023178357A1 WO 2023178357 A1 WO2023178357 A1 WO 2023178357A1 US 2023064728 W US2023064728 W US 2023064728W WO 2023178357 A1 WO2023178357 A1 WO 2023178357A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- numbering
- seq
- antibody
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/10—Dispersions; Emulsions
- A61K9/127—Synthetic bilayered vehicles, e.g. liposomes or liposomes with cholesterol as the only non-phosphatidyl surfactant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5418—IL-7
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70528—CD58
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/522—CH1 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- compositions and methods for the efficient production of antibodies or antigen binding fragments thereof are described herein incorporated by reference in its entirety.
- Antibodies may be capable of specifically binding to more than one target molecule or different epitopes on a single target molecule.
- the compositions and methods improve antibody assembly and production resulting in higher efficiency and yield compared to conventional methods.
- Monoclonal antibodies of the IgG type contain two identical antigen-binding arms and a constant domain (Fc). Antibodies with a differing specificity in their binding arms usually do not occur in nature and, therefore, have to be crafted with the help of chemical engineering (e.g., chemical cross-linking, etc.), recombinant DNA and/or cell-fusion technology.
- Bispecific antibodies can bind simultaneously two different antigens. This property enables the development of therapeutic strategies that are not possible with conventional monoclonal antibodies.
- Another class of multispecific molecules is recombinant fusion proteins. Recombinant fusion proteins consisting of the extracellular domain of immunoregulatory proteins and the constant (Fc) domain of immunoglobulin (Ig) represent a growing class of human therapeutics.
- Cell-fusion technology e.g., hybrid hybridomas
- the desired heteromultimeric antibodies are only a small fraction of the antibodies thus produced. Purification of the desired heteromultimeric proteins dramatically reduces production yields and increases manufacturing costs.
- oxidized heterodimer typically only make up 70-80% of the protein after this step as indicated by BioAnalyzer and MS-TOF analysis of intact mass species following oxidation. The remaining 20-30% of antibody is dimeric and lacks a covalent linkage (SEC-MALS). This can be removed but significantly impacts overall yields.
- SEC-MALS covalent linkage
- the disclosure provides an antibody comprising the following structure: a. a first heavy chain polypeptide (H1) comprising a variable region (VH1), and a constant region (CH1) having a constant region 1 domain (CH1 H1 ), a hinge region (H1H), a constant region 2 domain (CH1 H2 ) and a constant region 3 domain (CH1 H3 ); and a first light chain polypeptide (L1) comprising a variable region (VL1) and a constant region (CL1), b.
- H2 a second heavy chain polypeptide (H2) comprising a variable region (VH2), and a constant region (CH2) having a constant region 1 domain (CH2 H1 ), a hinge region (H2H), a constant region 2 domain (CH2 H2 ) and a constant region 3 domain (CH2 H3 ); and second light chain polypeptide (L2) comprising a variable region (VL2) and a constant region (CL2), wherein i.
- the amino acid at positions 39 (Kabat numbering) of the VH1 and VH2 are charged or polar amino acid residues and the amino acid at positions 38 (Kabat numbering) of the VL1 and VL2 are an oppositely charged or polar amino acid residue compared to the amino acids at positions 39 of the VH1 and the VH2; or the amino acid at positions 100 of the VH1 and VH2 (Kabat numbering) are charged or polar amino acid residues and the amino acid at positions 44 (Kabat numbering) of the VL1 and VL2 are an oppositely charged or polar amino acid residue compared to the amino acids at positions 100 of the VH1 and the VH2 (Kabat numbering); ii.
- the amino acid at positions 147 of the CH1 H1 and the CH1 H2 are charged or polar amino acid residues and one of the amino acids at positions 131, 179 or 180 of the CL1 or CL2 (EU numbering) is an oppositely charged or polar amino acid residue compared to the amino acids at positions 147 of the CH1 H1 and the CH1 H2 (EU numbering); iii.
- the amino acid at positions 185 of the CH1 H1 and the CH1 H2 are charged or polar amino acid residues and the amino acid at positions 137 of the CL1 and CL2 (EU numbering) are an oppositely charged or polar amino acid residue compared to the amino acids at positions 185 of the CH1 H1 and the CH1 H2 (EU numbering); or the amino acid at positions 187 of theCH1 H1 and the CH1 H2 (EU numbering) are charged or polar amino acid residues and one of the amino acids at positions 137 or 138 of the CL1 and CL2 (EU numbering) is an oppositely charged or polar amino acid residue compared to the amino acids at positions 187 of the CH1 H1 and the CH1 H2 (EU numbering); and iv.
- the amino acid at positions 145 of the CH1 H1 and the CH1 H2 are charged or polar amino acid residues and the amino acids at position 131 of the CL1 and CL2 (EU numbering) are oppositely charged or polar amino acid residues compared to the amino acids at positions 145 of the CH1 H1 and the CH1 H2 . (EU numbering).
- the charged amino acid residue is a naturally occurring amino acid or a non-naturally occurring amino acid.
- the naturally occurring charged amino acid residue is an arginine, a lysine, a histidine, a glutamic acid or an aspartic acid.
- the H1 amino acids at position 39, 100, 147, 185, 187 or 145 are positively charged and the L1 amino acids at positions 38, 44, 131, 179, 180, 137 or 138 are negatively charged; and the H2 amino acids at position 39, 100, 147, 185, 187 or 145 are negatively charged and the L2 amino acids at positions 38, 44, 131, 179, 180, 137 or 138 are positively charged.
- the H1 amino acids at position 39, 100, 147, 185, 187 and 145 are negatively charged and the L1 amino acids at positions 38, 44, 131, 179, 180, 137 or 138 are positively charged; and the H2 amino acids at position 39, 100, 147, 185, 187 or 145 are positively charged and the L2 amino acids at positions 38, 44, 131, 179, 180, 137 or 138 are negatively charged.
- L1 and L2 are lambda or kappa light chains. In some embodiments, L1 is a lambda light chain and L2 is a kappa light chain.
- L1 is a kappa light chain and L2 is a lambda light chain.
- the antibody has an IgG 1 , an IgG 2 , or an IgG 4 isotype.
- the antibody is a chimeric antibody, a human antibody, or a humanized antibody. In some embodiments, the antibody is a bispecific antibody.
- the bispecific antibody comprises: i) a first antigen binding domain that binds to a cell surface antigen, wherein the cell surface antigen is expressed on a T-cell, a NK cell, a neutrophil, a B cell or a dendritic cell engager; and ii) a second antigen binding domain that binds to a disease associated antigen (DAA).
- DAA disease associated antigen
- the cell surface antigen is expressed on a T-cell.
- the cell surface antigen expressed on a T-cell is a CD3.
- the cell surface antigen expressed on a T-cell is a CD3 ⁇ .
- the DAA is a UL16 Binding Protein 2 (ULBP2). In some embodiments, the DAA is a UL16 Binding Protein 5 (ULBP5) In some embodiments, the DAA is a UL16 Binding Protein 6 (ULBP6).
- a polypeptide is fused to the N-terminus or the C-terminus of H1 and/or H2. In some embodiments a polypeptide is fused to the N-terminus of the H1. In some embodiments a polypeptide is fused to the N-terminus of the H2. In some embodiments a polypeptide is fused to the C-terminus of the H1.
- a polypeptide is fused to the C-terminus of the H2.
- the polypeptide is a CD58, a IL-7 or a fragment thereof.
- the polypeptide is a CD58 extracellular domain (CD58-ECD).
- the polypeptide is a CD58- variable domain (CD58v*).
- the polypeptide is fused via a linker peptide.
- the linker peptide is at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19 or at least 20 amino acid residues in length.
- the linker peptide comprises the amino acid sequence of SEQ ID NOS: 52-54.
- the antibody comprises: i) the amino acid at position 87 (Kabat numbering) of the VH1 and/or VH2 is a G; and ii) the amino acid at position 45 (Kabat numbering) of the VL1 and/or VL2 is a W.
- the antibody comprises i) the CH1 H3 has a C at position 349, an S at position 366, an A at position 368 and a V at position 407 (EU numbering); and the CH2 H3 has a C at position 354 and a W at position 366 (EU numbering); ii) the CH2 H3 has a C at position 349, an S at position 366, an A at position 368 and a V at position 407 (EU numbering); and the CH1 H3 has a C at position 354 and a W at position 366 (EU numbering); iii) the CH1 H3 has a C at position 354, an S at position 366, an A at position 368 and a V at position 407 (EU numbering); and the CH2 H3 has a C at position 349 and a W at position 366 (EU numbering); or iv) the CH2 H3 has a C at position 354, an S at position 366, an A at position 368 and a V at position 407
- the amino acid at position 447 (EU numbering) of the CH1 H3 and/or of the CH2 H3 is deleted.
- the H1H and/or the H2H has an A at positions 234 and 235 (EU numbering); ii) the H1H and/or the H2H has an A at positions 234, 235 and 237 (EU numbering); or iii) the H1H and/or the H2H has an A at positions 234 and 235 and G at position 329 (EU numbering).
- the antibody comprises i) the CH1 H3 and/or the CH2 H3 has an A at position 297 (EU numbering); ii) the CH1 H3 and/or the CH2 H3 has a G at position 297 (EU numbering); or iii) the CH1 H3 and/or the CH2 H3 has a S at position 297 (EU numbering). In some embodiments, the CH1 H3 and/or the CH2 H3 has an S at position 331 (EU numbering).
- the antibody comprises i) the CH1 H2 and/or the CH2 H2 has an C at position 370 (Kabat numbering); and ii) the CH1 H2 and/or the CH2 H2 has an C at position 375 (Kabat numbering).
- a) the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii.
- the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; iii. the amino acid at position 128 (EU numbering) of the CH1 H1 is a C and the amino acid at position 118 (EU numbering) of the CL1 is a C; and iv. the amino acid at position 220 (EU numbering) in the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is a S; and b) the H2 and the L2 comprise the following: i.
- the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; and ii. the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R.
- a) the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; and ii.
- the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii. the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; iii.
- the amino acid at position 134 (EU numbering) of the CH2 H1 is a C and the amino acid at position 116 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- a) the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; and ii.
- the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii. the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; iii.
- the amino acid at position 136 (EU numbering) of the CH2 H1 is a C and the amino acid at position 114 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- a) the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii.
- the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; iii. the amino acid at position 173 (EU numbering) of the CH1 H1 is a C and the amino acid at position 162 (EU numbering) of the CL1 is a C; iv. the amino acid at position 220 (EU numbering) in the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is an S; and b) the H2 and the L2 comprise the following: i.
- the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; and ii. the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R.
- a) the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii.
- the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; iii. the amino acid at position 173 (EU numbering) of the CH1 H1 is a C and the amino acid at position 162 (EU numbering) CL1 is a C; and iv. the amino acid at position 220 (EU numbering) in the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is a S; and b) the H2 and the L2 comprise the following: i.
- the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; and ii. the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R.
- a) the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; and ii.
- the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) CL1 is a D; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii. the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; iii.
- the amino acid at position 131 (EU numbering) of the CH2 H1 is a C and the amino acid at position 114 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- a) the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; and ii.
- the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii. the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; iii.
- the amino acid at position 170 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- a) the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii.
- the amino acid at position 185 (EU numbering) of the CH1 H1 is a E
- the amino acid at position 137 (EU numbering) of the CL1 is a K
- iii. the amino acid at position 179 (EU numbering) of the CL1 is a E
- the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii. the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; iii.
- the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- a) the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; and ii.
- the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii. the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; iii.
- the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- a) the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii.
- the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137(EU numbering) of the CL1 is a K; and iii. the amino acid at position 179 (EU numbering) of the CL1 is a E; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii. the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; iii.
- the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- a) the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; and ii.
- the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii. the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; iii.
- the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- the H1 and the L1 comprise the following: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL
- the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; and ii. the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; ii.
- the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; iii. the amino acid at position 136 (EU numbering) of the CH2 H1 is a C and the amino acid at position 114 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- a) the H1 and the L1 comprise the following: i.
- the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; and ii. the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; ii.
- the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; iii. the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- a) the H1 and the L1 comprise the following: i.
- the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; and ii. the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; ii.
- the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; iii. the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is an S.
- a) the H1 and the L1 comprise the following: i.
- the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; ii. the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; iii. the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; and iv.
- the amino acid at position 145 (EU numbering) of the CH1 H1 is a S and the amino acid at position 180 (EU numbering) of the CL1 is a E; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; ii. the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; iii.
- the amino acid at position 170 (EU numbering) of the VH2 is a C and the amino acid at position 162 (EU numbering) of the VL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- a) the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii.
- the amino acid at position 147 (EU numbering) of the CH1 H1 is a D and the amino acid at position 131 (EU numbering) of the CL1 is a K; and iii. the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii.
- the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 137 (EU numbering) of the CL2 is a K; iii. the amino acid at position 138 (EU numbering) of the CL2 is a R; iv. the amino acid at position 170 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; and v. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- a) the H1 and the L1 comprise the following: i.
- the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii. the amino acid at position 147 (EU numbering) of the CH1 H1 is a D and the amino acid at position 131 (EU numbering) of the CL1 is a K; and iii. the amino acid at position 145 (EU numbering) of the CH1 H1 is a S; and b) the H2 and the L2 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii.
- the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; iii. the amino acid at position 170 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- a) the H1 and the L1 comprise the following: i.
- the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; ii. the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; and iii. the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; and b) the H2 and the L2 comprise the following: i.
- the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; ii. the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; iii. the amino acid at position 136 (EU numbering) of the CH2 H1 is a C and the amino acid at position 114 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is an S.
- the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a E; ii. the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; and iii. the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; and b) the H2 and the L2 comprise the following: i.
- the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii. the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; iii. the amino acid at position 136 (EU numbering) of the CH2 H1 is a C and the amino acid at position 114 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- the H1 and the L1 comprise the following: i. the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii. the amino acid at position 147 (EU numbering) of the CH1 H1 is a D and the amino acid at position 131 (EU numbering) of the CL1 is a K; and iii. the amino acid at position 185 (EU numbering) of the CH1 H1 is a D and the amino acid at position 137 (EU numbering) of the CL1 is a K; and b) the H2 and the L2 comprise the following: i.
- the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii. the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; iii. the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; and iv. the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S.
- the amino acid at position 87 (Kabat numbering) of the VH1 and/or VH2 is a G; and ii) the amino acid at position 45 (Kabat numbering) of the VL1 and/or VL2 is a W.
- the CH1 H3 has a C at position 349, an S at position 366, an A at position 368 and a V at position 407 (EU numbering); and the CH2 H3 has a C at position 354 and a W at position 366 (EU numbering); ii) the CH2 H3 has a C at position 349, an S at position 366, an A at position 368 and a V at position 407 (EU numbering); and the CH1 H3 has a C at position 354 and a W at position 366 (EU numbering); iii) the CH1 H3 has a C at position 354, an S at position 366, an A at position 368 and a V at position 407 (EU numbering); and the CH2 H3 has a C at position 349 and a W at position 366 (EU numbering); or iv) the CH2 H3 has a C at position 354, an S at position 366, an A at position 368 and a V at position 407 (EU numbering); and
- the amino acid at position 447 (EU numbering) of the CH1 H3 and/or of the CH2 H3 is deleted.
- the H1H and/or the H2H has an A at positions 234 and 235 (EU numbering); ii) the H1H and/or the H2H has an A at positions 234, 235 and 237 (EU numbering); or iii) the H1H and/or the H2H has an A at positions 234 and 235 and G at position 329 (EU numbering).
- the CH1 H3 and/or the CH2 H3 has an A at position 297 (EU numbering); ii) the CH1 H3 and/or the CH2 H3 has a G at position 297 (EU numbering); or iii) the CH1 H3 and/or the CH2 H3 has a S at position 297 (EU numbering). In some embodiments, the CH1 H3 and/or the CH2 H3 has an S at position 331 (EU numbering).
- the antibody comprises i) the CH1 H2 and/or the CH2 H2 has an C at position 370 (Kabat numbering); and ii) the CH1 H2 and/or the CH2 H2 has an C at position 375 (Kabat numbering).
- a) the VH1 comprises the amino acid sequence of SEQ ID NO: 13; and b) the VL1 comprises the amino acid sequence of SEQ ID NO: 22.
- the VH1 comprises the amino acid sequence of EVQLLESGGGLVQPGGSLKLSCAASGFTFNX 1 YAMX 2 WVRX 3 APGKGLEWVAX 4 IR SKYNNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGX 5 FGN X 6 X 7 YVSWFAYWGQGTLVTVSS (SEQ ID NO: 440), wherein X1 of SEQ ID NO: 440 is D or T, wherein X2 of SEQ ID NO: 440 is D or N, wherein X3 of SEQ ID NO: 440 is D or K, wherein X4 of SEQ ID NO: 440 is K or R, wherein X5 of SEQ ID NO: 440 is N or T, wherein X6 of SEQ ID NO: 440 is D or N, and wherein X7 of SEQ ID NO: 440 is D or S; and b) the amino acid sequence of EVQLLESGGGL
- the VH2 comprises: a complementarity determining region 1 (VH2 CDR1 ) comprising the amino acid sequence of SEQ ID NO: 428; a complementarity determining region 2 (VH2 CDR2 ) comprising the amino acid sequence of SEQ ID NO: 430; and a complementarity determining region 3 (VH2 CDR3 ) comprising the amino acid sequence of SEQ ID NO: 432; and b) the VL2 comprises: a complementarity determining region 1 (VL2 CDR1 ) comprising the amino acid sequence of SEQ ID NO: 433; a complementarity determining region 2 (VL2 CDR2 ) comprising the amino acid sequence of SEQ ID NO: 434; and a complementarity determining region 3 (VL2 CDR3 ) comprising the amino acid sequence of SEQ ID NO: 435.
- VH2 CDR1 complementarity determining region 1
- VH2 CDR2 complementarity determining region 2
- VH2 CDR3
- the VH2 comprises: a complementarity determining region 1 (VH2 CDR1 ) comprising the amino acid sequence of SEQ ID NO: 5; a complementarity determining region 2 (VH2 CDR2 ) comprising the amino acid sequence of SEQ ID NO: 7; and a complementarity determining region 3 (VH2 CDR3 ) comprising the amino acid sequence of SEQ ID NO: 9; and b) the VL2 comprises: a complementarity determining region 1 (VL2 CDR1 ) comprising the amino acid sequence of SEQ ID NO: 10; a complementarity determining region 2 (VL2 CDR2 ) comprising the amino acid sequence of SEQ ID NO: 11; and a complementarity determining region 3 (VL2 CDR3 ) comprising the amino acid sequence of SEQ ID NO: 12.
- the CD58 comprises the amino acid sequence of SEQ ID NO: 49-50.
- the IL-7 comprises the amino acid sequence of SEQ ID NO: 51.
- the disclosure provides a polynucleotide comprising a nucleic acid sequence encoding any one of the antibodies disclosed herein.
- the disclosure also provides a vector comprising the polynucleotide of the disclosure.
- the disclosure also provides a pharmaceutical composition comprising any one of the antibodies, the polynucleotides, or the vectors of the disclosure and a pharmaceutically acceptable carrier.
- the pharmaceutical composition is packaged in a liposome or a lipid nanoparticle.
- the disclosure provides a method of treating cancer in a subject in need thereof comprising administering a therapeutically effective amount of any one of the pharmaceutical compositions of the disclosure.
- the disclosure also provides a method of T- cell re-targeting in a subject in need thereof comprising administering a therapeutically effective amount of any one of the pharmaceutical compositions of the disclosure.
- the disclosure also provides a method of T-cell activation in a subject in need thereof comprising administering a therapeutically effective amount of any one of the pharmaceutical compositions of the disclosure.
- the subject has a cancer.
- the cancer is a ULBP2 positive cancer.
- the cancer is a primary tumor, a metastatic cancer, a multiply resistant cancer, a progressive tumor or recurrent cancer. In some embodiments, the cancer is a solid tumor. In some embodiments, the cancer is a urothelial cancer, a lung cancer, a brain cancer, a head and neck cancer, a breast cancer, a skin cancer, a melanoma, a liver cancer, a pancreatic cancer, a stomach cancer, a colon cancer, a rectal cancer, a uterine cancer, a cervical cancer, an ovarian cancer, a prostate cancer, a testicular cancer, a skin cancer or an esophageal cancer.
- the method further comprises administering a therapeutically effective amount of a ligand or a cytokine or an agnostic antibody that binds to the receptors of the ligands and the cytokines.
- the ligand is CD48, CD58, CD86, TNFSF9, OX40L, 4-1BBL, GITL, CD70, CD80, MR1, TNFSF4, ICOSL, ICOSLG, MICA, MICB, ULBP1, ULBP2, ULBP3, RAET1G and RAET1L.
- the cytokine is a IL-2, IL-7, IL-10, IL-12, IL-15, IL-18 or IL-21.
- FIG.1A-D depicts schematic diagrams of antibodies with charged pair mutations, disulfide bond repositioning and knob into hole mutations.
- Grey shaded domains represent a first heavy chain polypeptide (H1) having a heavy chain variable region (VH1), having a constant region 1 domain (CH1 H1 ), a hinge region (H1H), a constant region 2 domain (CH1 H2 ) and a constant region 3 domain (CH1 H3 ); and a first light chain polypeptide (L1) comprising a variable region (VL1) and a constant region (CL1).
- White shaded domains represent a second heavy chain polypeptide (H2) comprising a variable region (VH2), and a constant region (CH2) having a constant region 1 domain (CH2 H1 ), a hinge region (H2H), a constant region 2 domain (CH2 H2 ) and a constant region 3 domain (CH2 H3 ); and second light chain polypeptide (L2) comprising a variable region (VL2) and a constant region (CL2).
- Lines between the CH1 H1 and CL1 domain and CH2 H1 and CL2 domain represent disulfide bonds , where a solid line represent s an endogenous disulfide bond and a dashed line represents a repositioned disulfide bond.
- the protrusion and dent between the CH1 H3 and CH2 H3 domain represent knob into hole mutations. Charged pair mutations, disulfide bond repositioning and knob into hole mutations provide increased heavy chain and light chain heterodimerization, which is advantageous for production and purification of bispecific antibodies of the disclosure.
- FIGS.2A-2B are two graphs depicting biophysical characterization of light chain pairing bispecific antibodies EIP0187 (light chain pairing C), EIP0205 (light chain pairing D), EIP0356 (light chain pairing O) and EIP0377 (light chain pairing P) compared to EIP0112 Crossmab control antibody.
- FIG.2A is a size exclusion chromatogram obtained from a protein A and size exclusion chromatography tandem purification of light chain pairing bispecific antibodies.
- FIG.2B depicts differential scanning calorimetry analysis of light chain pairing bispecific antibodies.
- FIG.3A-3B are NuPAGE gel analyses of representative variants of light chain pairing bispecific antibodies depicted in FIGS.2A-2B.
- FIG.3A is a non-reduced NuPAGE analysis.
- FIG.3B is a reduced NuPAGE analysis, together showing an intact bispecific antibody with expected protein masses of the heavy chain and light chain.
- FIG.4A-4B are a series of line graphs showing antigen binding of light chain pairing bispecific antibodies depicted in FIGS.2A-2B compared to isotype and bispecific antibody controls.
- FIG.4A is a line graph depicting antigen binding of light chain pairing bispecific antibody variants via sandwich ELISA where antibodies were captured on the plate coated with CD3 ⁇ .
- FIG.4B is a line graph depicting antigen binding of light chain pairing bispecific antibody variants via sandwich ELISA where antibodies were captured on the plate coated with recombinant ULBP2.
- FIG.5A is mass spectrometry analysis of EIP0205 showing intact mass after PNGase F deglycosylation in non-reduced condition and chromatographic separation using reverse phase C4 column
- FIG.5B is mass spectrometry analysis of EIP0205 showing reduced mass of heavy chains after Rapid PNGase F deglycosylation in reduced condition and chromatographic separation using reverse phase C4 column.
- FIG.5C is mass spectrometry analysis of EIP0205 showing reduced mass of light chains after Rapid PNGase F deglycosylation in reduced condition and chromatographic separation using reverse phase C4 column.
- FIG.5D is mass spectrometry analysis of EIP0187 showing intact mass after PNGase F deglycosylation in non-reduced condition and chromatographic separation using reverse phase C4 column.
- FIG.5E is mass spectrometry analysis of EIP0187 showing reduced mass of heavy chains after Rapid PNGase F deglycosylation in reduced condition and chromatographic separation using reverse phase C4 column.
- FIG.5F is mass spectrometry analysis of EIP0187 showing reduced mass of light chains after Rapid PNGase F deglycosylation in reduced condition and chromatographic separation using reverse phase C4 column.
- FIG.6 is a line graph depicting functional evaluation (cytotoxicity) light chain pairing bispecific antibodies depicted in FIGS.2A-2Bin a tumor cell and T cell co-culture assay compared to bispecific control antibody (EIP0112)
- FIG.7A are chromatograms of bispecific antibody variants obtained from tandem purification.
- FIG.7B is a non-reduced NuPAGE analysis showing protein mass of intact bispecific antibody variants.
- FIG.7C is a reduced NuPAGE analysis showing protein mass of bispecific antibody variant heavy and light chains.
- FIG.7D is a line graph depicting antigen binding of light chain pairing bispecific antibodies via sandwich ELISA, where antibodies were captured on a plate coated with CD3 ⁇ .
- FIG.7E is a line graph depicting antigen binding of light chain pairing bispecific antibodies via sandwich ELISA, where antibodies were captured on the plate coated with antigen.
- FIG.8A is a line graph depicting binding of ⁇ ULBP2- ⁇ CD3 bispecific antibody variants to human CD3 epsilon by ELISA.
- FIG.8B is a line graph depicting binding of ⁇ ULBP2- ⁇ CD3 bispecific variants to cynomolgus CD3 epsilon by ELISA.
- FIGS.9A-9B are a series of line graphs depicting luciferase activity in co-cultures of tumor cells and Jurkat NFAT luciferase reporter cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific antibody variants.
- FIG.9A depicts co-cultures of SiHa tumor cells.
- FIG.9B depicts co-culture of HCT116 tumor cells.
- FIGS.10A-10C are a series of line graphs depicting T-cell mediated cytotoxicity of three tumor cell lines in the presence of ⁇ ULBP2- ⁇ CD3 bispecific antibody variants of FIGS.9A-9B.
- FIG.10A depicts cytotoxicity of HCT116 tumor cells .
- FIG.10B depicts cytotoxicity of MDA-MB-231 GFP tumor cells .
- FIG.10C depicts cytotoxicity of SiHa tumor cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific antibody variants.
- FIGS.11A-11C are a series of line graphs depicting secretion of cytokines from from activated T cells in co-culture with SiHa tumor cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific affinity variants of FIGS.9A-9B.
- FIG.11A depicts secretion of IFN ⁇ .
- FIG.11B depicts secretion of IL-2.
- FIG.11C depicts secretion of TNF ⁇ .
- FIG.12A depicts a bispecific antibody variant with no CD58 fusion.
- FIG.12B depicts a bispecific antibody variant with a CD58 fusion to the carboxyl terminal of CH1 H3 .
- FIG.12C depicts a bispecific antibody variant with a CD58 fusion to the carboxyl terminal of CH2 H3 .
- FIG.12D depicts a bispecific antibody variant with a CD58 fusion to the carboxyl terminal of CH1 H3 and a CD58 fusion to the carboxyl terminal of CH2 H3 .
- FIG.12E depicts a bispecific antibody variant with an amino terminal fusion to CD58 on VL2.
- FIG.12F depicts a bispecific antibody variant with an amino terminal fusion to CD58 on VH2.
- FIG.12G depicts a bispecific antibody variant with an amino terminal fusion to CD58 on VL1.
- FIG.12H depicts a bispecific antibody variant with an amino terminal fusion to CD58 on VH1.
- FIG.12L depicts a bispecific antibody variant with a CD58 fusion to the carboxyl terminal of CL2 [0100]
- FIG.12J depicts a bispecific antibody variant with a CD58 fusion to the carboxyl terminal of CL1 [0101]
- FIG.12K depicts a bispecific antibody variant with a CD58 fusion to the carboxyl terminal of CL1 and CL2 [0102]
- FIG.13 are chromatograms obtained from tandem purification of costimulatory ligand or cytokine fusion bispecific variants engineered with light chain pairing technology (EIP0205, EIP0359, EIP0360, EIP0363).
- FIG.14 depicts differential scanning calorimetry analysis of costimulatory ligand or cytokine fusion ⁇ ULBP2- ⁇ CD3 bispecific variants (EIP0205, EIP0359, EIP0363).
- FIG.15A is a line graph depicting antigen binding of costimulatory ligand or cytokine fusion bispecific antibody variants to a plate coated with recombinant CD3 ⁇ via sandwich ELISA.
- FIG.15B is a line graph depicting antigen binding of costimulatory ligand or cytokine fusion bispecific antibody variants to a plate coated with recombinant ULBP2 protein via sandwich ELISA.
- FIG.16A depicts cytolysis of MDA-MB-231 GFP tumor cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific variants after 7-day incubation with na ⁇ ve T cells.
- FIG.16B shows brightfield and fluorescent microscopy representative images of na ⁇ ve T cell activation and MDA-MB-231 cell death
- FIG.16C depicts cytolysis of ULBP2-deficient MDA-MB-231 GFP tumor cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific antibody variants after 7-day incubation with na ⁇ ve T cells.
- FIGS.17A-17B are a series of line graphs depicting secretion of IFN ⁇ from na ⁇ ve T cells after 24 hour incubation with MDA-MB-231 GFP tumor cells and ULBP2-deficient MDA-MB-231 GFP tumor cells in the presence of bispecific antibody variants of FIGS. 16A-16C.
- FIG.17A depicts MDA-MB-231 GFP tumor cells.
- FIG.17B depicts ULBP2-deficient MDA-MB-231 GFP tumor cells.
- FIGS.18A-18B are a series of line graphs depicting secretion of IL-2 from na ⁇ ve T cells after 24 hour incubation with MDA-MB-231 GFP tumor cells and ULBP2-deficient MDA-MB-231 GFP tumor cells in the presence of bispecific antibody variants of FIGS. 16A-16C.
- FIG.18A depicts MDA-MB-231 GFP tumor cells.
- FIG.18B depicts ULBP2-deficient MDA-MB-231 GFP tumor cells.
- FIGS.19A-19B are a series of line graphs depicting secretion of IFN ⁇ from na ⁇ ve T cells after 24 hour incubation with MDA-MB-231 GFP tumor cells and ULBP2-deficient MDA-MB-231 GFP tumor cells in the presence of bispecific antibody variants of FIGS. 16A-16C.
- FIG.19A depicts MDA-MB-231 GFP tumor cells.
- FIG.19B depicts ULBP2-deficient MDA-MB-231 GFP tumor cells.
- FIG.20A depicts cytolysis of SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific variants after 48 hour incubation with activated T cells.
- FIG.20B depicts cytolysis of SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific variants after 48 hour incubation with activated T cells.
- FIG.21A depicts cytolysis of SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific variants after 48 hour incubation with activated T cells.
- FIG.21B depicts cytolysis of SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific variants after 48 hour incubation with activated T cells.
- FIG.22A is a line graph depicting secretion of IFN ⁇ after 48 hours of activated T cells in co-culture with SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific antibody variants.
- FIG.22B is a line graph depicting secretion of IFN ⁇ after 48 hours of activated T cells in co-culture with SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific antibody variants.
- FIG.23A is a line graph depicting secretion of IFN ⁇ after 48 hours of activated T cells in co-culture with SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific antibody variants.
- FIG.23B is a line graph depicting secretion of IFN ⁇ after 48 hours of activated T cells in co-culture with SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific antibody variants.
- FIG.24A is a line graph depicting secretion of IL-2 after 48 hours of activated T cells in co-culture with SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific antibody variants.
- FIG.24B is a line graph depicting secretion of IL-2 after 48 hours of activated T cells in co-culture with SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific antibody variants.
- FIG.25A is a line graph depicting secretion of IL-2 after 48 hours of activated T cells in co-culture with SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific antibody variants.
- FIG.25B is a line graph depicting secretion of IL-2 after 48 hours of activated T cells in co-culture with SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific antibody variants.
- FIG.26A is a line graph depicting secretion of TNF ⁇ after 48 hours of activated T cells in co-culture with SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific antibody variants.
- FIG.26B is a line graph depicting secretion of TNF ⁇ after 48 hours of activated T cells in co-culture with SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific antibody variants.
- FIG.27A is a line graph depicting secretion of TNF ⁇ after 48 hours of activated T cells in co-culture with SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific antibody variants.
- FIG.27B is a line graph depicting secretion of TNF ⁇ after 48 hours of activated T cells in co-culture with SiHa cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific antibody variants.
- FIG.28 is a line graph depicting cytolysis of MDA-MB-231 GFP cells after 7 day incubation with PBMCs in the presence of ⁇ ULBP2- ⁇ CD3, ⁇ ULBP2- ⁇ CD3-CD58 bispecific ⁇ ULBP2- ⁇ CD3-CD58 variable domain fusion bispecific antibody variants.
- FIG.29A is a line graph depicting cytolysis of MDA-MB-231 cells in the presence of bispecific antibody variants.
- FIG.29B is a line graph depicting secretion of IFN ⁇ from MDA-MB-231 cells in the presence of bispecific antibody variants.
- FIG.30 are representative microscopy images of cytolysis of MDA-MB-231-GFP cells following 48 hour incubation with na ⁇ ve T cells, round 3 and round 5 exhausted T cells in the presence of bispecific antibody variants.
- FIG.31 is a radar plot depicting normalized levels of the T-cell markers IL2, IFN ⁇ , CD25, CD69, GZMB, CD2, PD-1, CD38 and TIM3 present after 72 hour incubation of PBMCs with MDA-MB-231 cells in the presence of bispecific antibody variants.
- FIGS.32A-32D are a series of graphs depicting improved tumor growth inhibition, pharmacokinetics and survival of humanized mice following treatment with bispecific antibody variants.
- FIG.32A is a line graph depicting growth inhibition of SiHa tumors over time after adoptive transfer of human T cells and dosing with bispecific antibody variants EIP0542, EIP0205 and EIP0359.
- FIG.32B is a survival curve after adoptive transfer of human T cells and dosing with bispecific antibody variants of FIG.32A.
- FIG.32C is a line graph depicting pharmacokinetics of bispecific antibody variants of FIG.32A.
- FIG.32D is a graph depicting pharmacokinetics of EIP0561 following administration of a 10mg/kg dosage to humanized mice.
- FIGS.33A-33C are a series of histograms from flow cytometry analysis of tumor infiltrating lymphocytes in SiHa tumors 3 days post-engraftment and treated with bispecific antibody variants
- FIG.33A is analysis of Granzyme B showing increased tumor cytolysis by bispecific antibody variants.
- FIG.33B is analysis of CD25 showing increased T cell activation by bispecific antibody variants.
- FIG.33C is analysis of CD38 showing decreased T cell exhaustion by bispecific antibody variants.
- FIGS.34A-34C are a series of structural renderings modeling A06 and E12 binding to ULBP2.
- FIG.34A is a homology model of the ULBP2-NKG2D complex.
- FIG.34B is a docked model of ULBP2 and A06 antibody.
- FIG.34C is a docked model of ULBP2 and E12 antibody. Residue R106 is shown in stick model in all the panels.
- ULBP2 is shown in dark gray while NKG2D, A06 and E12 are shown in light gray.
- FIG.35 is a line graph depicting growth inhibition of CORL-105 tumors over time after co-engraftment of human T cells and dosing with bispecifics and bispecific CD58 fusions with various CD3 affinities.
- FIGS.36A-36F are a series of graphs depicting cytolysis of tumor cells in the presence of bispecific CD58 fusions after 48 hour incubation with activated T cells.
- FIG. 36A shows cytolysis of HCT116 cells.
- FIG.36B shows cytolysis of U266B1 cells.
- FIG. 36C shows cytolysis of JeKo-1 cells.
- FIG.36D shows cytolysis of PSMA-low LNCAP prostate cancer cells (LNCAP-vL).
- FIG.36E shows cytolysis of MM1s cells.
- FIG.36F shows cytolysis of Raji cells.
- FIG.37 is a graph depicting a chromatogram obtained from tandem purification of an exemplary antibody with and without exemplary disulfide stabilization mutations.
- FIGS.38A-38D are two graphs and microscopy images depicting cytolysis of MDA-MB-231 GFP tumor cells and ULBP2-deficient MDA-MB-231 GFP tumor cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific antibody variants after 5-day incubation at a ratio of 1:10 with na ⁇ ve T cells.
- FIG.38A shows tumor cells incubated with EIP0205 at various concentrations.
- FIG.38B shows brightfield and fluorescent microscopy representative images of na ⁇ ve T cell activation and MDA-MB-231 cell death with EIP0205.
- FIG.38C shows tumor cells incubated with EIP0359 at various concentrations.
- FIG.38D shows brightfield and fluorescent microscopy representative images of na ⁇ ve T cell activation and MDA-MB-231 cell death with EIP0359.
- FIG.39 is a graph depicting cytolysis of MDA-MB-231 GFP tumor cells in the presence of ⁇ ULBP2- ⁇ CD3 bispecific antibody variants after 5-day incubation at a ratio of 1:10 with na ⁇ ve T cells.
- FIGS.40A-40C are a series of line graphs depicting cytolysis of tumor cells and cytokine secretion in the presence of ⁇ ULBP2- ⁇ CD3 bispecific and ⁇ ULBP2- ⁇ CD3-CD58 bispecific variants after 5 day incubation at an E:T ratio of 10:1 with na ⁇ ve T cells.
- FIG. 40A depicts cytolysis of tumor cells.
- FIG.40B depicts secretion of IFN ⁇ after 48 hours of activated T cells in co-culture with tumor cells.
- FIG.40C depicts secretion of IL-2 after 48 hours of activated T cells in co-culture with tumor cells.
- FIG.41 is a graph depicting killing of MDA-MB-231 tumor cells in the presence of activated T cells T cells in the presence of ⁇ ULBP2- ⁇ CD3-CD58 bispecific variants after 48 hour incubation at an E:T ratio of 5:1 with activated T cells.
- FIGS.42A-42F are a series of graphs depicting cytolysis of tumor cells in the presence of activated T cells in the presence of ⁇ CD3 bispecific antibody variants comprising light chain pairing of the present disclosure after 2 days compared to controls.
- FIG.42A shows JeKo-1 tumor cells at an effector to target cell (E:T) ratio of 5:1.
- FIG.42B shows Ramos cells at an effector to target cell (E:T) ratio of 10:1.
- FIG.42C shows Raji cells at an effector to target cell (E:T) ratio of 10:1.
- FIG.42D shows SUDHL10 cells at an effector to target cell (E:T) ratio of 10:1.
- FIG.42E shows MV411 cells at an effector to target cell (E:T) ratio of 5:1.
- FIG.42F shows OCI-AML2 cells at an effector to target cell (E:T) ratio of 5:1.
- FIGS.43A-43B are a series of graphs depicting lysis of tumor cells in the presence of naive T cells at an effector to target cell (E:T) ratio of 7.5:1 in the presence of ⁇ CD3 bispecific antibody variants comprising light chain pairing with and without CD58 fusion molecules of the present disclosure after 3 days compared to controls.
- FIG.43A shows tumor lysis of JeKo-1 cells.
- FIG.43B shows tumor lysis of MV411 cells.
- FIGS.44A-44B are a series of graphs depicting cytolysis of tumor cells in the presence of activated T cells in the presence of ⁇ BCMA- ⁇ CD3 and ⁇ BCMA- ⁇ CD3-CD58 bispecific variants after 48 hour incubation compared to no antibody control.
- FIG.43A shows NCI929 tumor cells at an effector to target cell (E:T) ratio of 2:1.
- FIG.43B shows U266B1 cells at an effector to target (E:T) cell ratio of 1.6:1.
- E:T effector to target
- DETAILED DESCRIPTION [0149] Production of heteromultimeric antibodies (e.g. bispecific antibodies) using conventional techniques provides challenges including the production of a mis-paired antibodies, reduced yield and decreased/elimination of effector function among others.
- compositions and efficient production processes/methods for economical production of heteromultimeric antibodies e.g., bispecific antibodies
- disulfide bond repositioning mutations or knob in hole mutations are disclosed herein.
- T cell retargeting (or T cell redirecting) bispecific antibodies is a novel class of therapeutics, capable of recruiting T cells to tumor cells and inducing tumor-specific (but MHC-independent) activation of T cell effector activities.
- T cell retargeting bispecific antibodies contain an antigen binding domain that targets CD3 portion of the T cell receptor for T cell recruitment, and an antigen binding domain that targets a disease- associated antigen (DAA).
- DAA disease- associated antigen
- This targeting design promotes the recruitment of T cell and positions it in close contact with a target tumor cell, resulting in the formation of an immunological synapse, local T cell activation and the subsequent destruction of the target cell by perforin and granzyme released from T cell cytotoxic granules.
- the present invention also relates to the generation of a panel of antibodies that bind to human CD3 and that are cross reactive with cynomolgus CD3. Cross-reactivity with cynomolgus CD3 is an important feature in order to facilitate preclinical development of T cell retargeting bispecific antibodies that incorporate the anti- CD3 ⁇ antibodies described herein.
- bispecific antibodies disclosed herein may have a cytokine or costimulatory molecule fusion peptide that acts as antagonist to inhibit or block deleterious interactions or as an agonist to mimic or enhance physiological responses.
- Physiological responses include but are not limited to T-cell activation, T-cell proliferation and prevention of T-cell exhaustion.
- cytokine and/or costimulatory fusion peptides are advantageous for enhancing the therapeutic potential of bispecific antibodies.
- T-cell retargeting bispecific antibodies are advantageous over other existing therapies (e.g. CAR-T therapies) because it provides an off-the-shelf product with a high safety profile (e.g. mitigation of cytokine release syndrome and reduced levels of tonic signaling leading to T- cell dysfunction) and the possibility of dose titration and escalation.
- CAR-T therapies e.g. CAR-T therapies
- ANTIBODY COMPOSITIONS AND STRUCTURES [0156]
- the present disclosure provides an antibody comprising the following domain structure: a) a first heavy chain polypeptide (H1) comprising a variable region (VH1), and a constant region (CH1) having a constant region 1 domain (CH1 H1 ), a hinge region (H1H), a constant region 2 domain (CH1 H2 ) and a constant region 3 domain (CH1 H3 ); and a first light chain polypeptide (L1) comprising a variable region (VL1) and a constant region (CL1), and b) a second heavy chain polypeptide (H2) comprising a variable region (VH2), and a constant region (CH2) having a constant region 1 domain (CH2 H1 ), a hinge region (H2H), a constant region 2 domain (CH2 H2 ) and a constant region 3 domain (CH2 H3 ); and second light chain polypeptide (L2) comprising a variable region (VL2) and
- FIGS. 1A-1D A schematic diagram of the antibody structure of the disclosure is shown in FIGS. 1A-1D.
- the term “antibody” refers to an immunoglobulin (Ig) molecule and immunologically active portions of an immunoglobulin molecule, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
- immunoglobulin immunoglobulin
- immunologically active portions of an immunoglobulin molecule i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
- specifically bind” or “immunoreacts with” “or directed against” is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react with other polypeptides or binds at much lower affinity (K d > 10 -6 ).
- Antibodies include, but are not limited to, polyclonal antibodies, monoclonal antibodies, chimeric antibodies.
- the antibody may be from recombinant sources and/or produced in transgenic animals.
- the basic antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa).
- the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function.
- antibody molecules obtained from humans relate to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses as well, such as IgG1, IgG2, IgG4 and others. Furthermore, in humans, the light chain may be a kappa chain or a lambda chain. Accordingly, in one embodiment, the antibody disclosed herein is an IgG antibody. [0160] Antibodies may be purified by well-known techniques, such as affinity chromatography using protein A or protein G, which provide primarily the IgG fraction of immune serum.
- the specific antigen which is the target of the immunoglobulin sought, or an epitope thereof may be immobilized on a column to purify the immune specific antibody by immunoaffinity chromatography. Purification of immunoglobulins is discussed, for example, by D. Wilkinson (The Engineer, published by The Engineer, Inc., Philadelphia PA, Vol.14, No.8 (April 17, 2000), pp.25-28).
- antibody fragment as used herein is intended to include without limitation, Fv, Fab, Fab', F(ab')2, scFv, dsFv, ds-scFv, dimers, minibodies, diabodies, and multimers thereof, multispecific antibody fragments and Domain Antibodies.
- Antibodies can be fragmented using conventional techniques. For example, F(ab')2 fragments can be generated by treating the antibody with pepsin. The resulting F(ab')2 fragment can be treated to reduce disulfide bridges to produce Fab' fragments. Papain digestion can lead to the formation of Fab fragments.
- Fab, Fab' and F(ab')2, scFv, dsFv, ds-scFv, dimers, minibodies, diabodies, bispecific antibody fragments and other fragments can also be synthesized by recombinant techniques.
- Techniques can be adapted for the production of single-chain antibodies specific to an antigenic protein of the disclosure (see e.g., U.S. Patent No.4,946,778).
- epitopes refers to the site on an antigen that is recognized by the antibodies and fragments disclosed herein.
- epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three-dimensional structural characteristics, as well as specific charge characteristics.
- Bispecific antibodies are antibodies that have binding specificities for at least two different antigens.
- the present disclosure provides a bispecific antibody having a first antigen binding region that binds to a first antigen (e.g. CD3) and a second antigen binding region that binds to a second antigen (e.g. disease associated antigen )
- a first antigen e.g. CD3
- a second antigen binding region that binds to a second antigen (e.g. disease associated antigen )
- Antibodies with more than two valencies are also contemplated. For example, trispecific antibodies can be prepared. Tutt et al., J.
- amino acid sequence variants of the antibodies provided herein are contemplated. For example, it may be desirable to improve the heavy chain heterodimerization, light chain heterodimerization, binding affinity, and/or other biological properties of the antibody.
- Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody.
- Amino acids may be grouped according to common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; (3) acidic (negatively charged): Asp, Glu; (4) basic (positively charged): His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe.
- Functional variants of the antibody or antigen-binding fragments described herein are also encompassed by the present disclosure.
- the term "functional variant” as used herein includes modifications or chemical equivalents of the amino acid and nucleic acid sequences disclosed herein that perform substantially the same function as the polypeptides or nucleic acid molecules disclosed herein in substantially the same way.
- functional variants of polypeptides disclosed herein include, without limitation, conservative amino acid substitutions.
- a "conservative amino acid substitution” as used herein, is one in which one amino acid residue is replaced with another amino acid residue that change an amino acid to a different amino acid with similar biochemical properties (e.g. charge, hydrophobicity and size).
- Variants of polypeptides also include additions and deletions to the polypeptide sequences disclosed herein.
- variant nucleotide sequences include analogs and derivatives thereof.
- a variant of the binding proteins disclosed herein include proteins that bind to the same antigen or epitope as the binding proteins.
- the charged amino acid residue is a naturally occurring amino acid or a non-naturally occurring amino acid.
- the naturally occurring charged amino acid residue is an arginine, a lysine, a histidine, a glutamic acid or an aspartic acid.
- the first heavy chain polypeptide (H1) has a strong preference for binding with the first light chain polypeptide (L1) relative to the second light chain polypeptide (L2); and the second heavy chain polypeptide (H2) has a strong preference for binding with the second light chain polypeptide (L2) relative to first light chain polypeptide (L1).
- first heavy chain polypeptide (H1) and the second heavy chain polypeptide (H2) have a stronger preference for heterodimerization than homodimerization (i.e. heavy chain heterodimerization).
- Antibody variants having one or more amino acid substitutions are provided herein. Exemplary substitutional mutagenesis sites include the charged substitution pairs shown in Tables 1.1-1.3 and 2-6.
- Exemplary Fab heterodimerization strategies include but are not limited to those shown in Table 1.1 and Table 1.2.
- Antibodies domains as listed in Tables 1.1 and Table 1.2 correspond to domains of the present disclosure as depicted in FIG.1.
- antibody variants comprise the following substitutions: i) the amino acid at positions 39 (Kabat numbering) of the VH1 and VH2 are charged or polar amino acid residues and the amino acid at positions 38 (Kabat numbering) of the VL1 and VL2 are an oppositely charged or polar amino acid residue compared to the amino acids at positions 39 of the VH1 and the VH2; or the amino acid at positions 100 of the VH1 and VH2 (Kabat numbering) are charged or polar amino acid residues and the amino acid at positions 44 (Kabat numbering) of the VL1 and VL2 are an oppositely charged or polar amino acid residue compared to the amino acids at positions 100 of the VH1 and the VH2; ii) the amino acid at positions 147 of the CH1 H1 and the CH1 H2 (EU numbering) are charged or polar amino acid residues and one
- antibody variants comprise the following substitutions: the H1 amino acids at position 39, 100, 147, 185, 187 or 145 are positively charged and the L1 amino acids at positions 38, 44, 131, 179, 180, 137 or 138 are negatively charged; and the H2 amino acids at position 39, 100, 147, 185, 187 or 145 are negatively charged and the L2 amino acids at positions 38, 44, 131, 179, 180, 137 or 138 are positively charged.
- antibody variants comprise the following substitutions: the H1 amino acids at position 39, 100, 147, 185, 187 and 145 are negatively charged and the L1 amino acids at positions 38, 44, 131, 179, 180, 137 or 138 are positively charged; and the H2 amino acids at position 39, 100, 147, 185, 187 or 145 are positively charged and the L2 amino acids at positions 38, 44, 131, 179, 180, 137 or 138 are negatively charged.
- the antibody variant comprises the “light chain pairing mutation set A” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; iii) the amino acid at position 128 (EU numbering) of the CH1 H1 is a C and the amino acid at position 118 (EU numbering) of the CL1 is a C; and iv) the amino acid at position 220 (EU numbering) in the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is a S; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (K
- the antibody variant comprises the “light chain pairing mutation set B” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; and ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii) the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; ii
- the antibody variant comprises the “light chain pairing mutation set C” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; and ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii) the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; ii
- the antibody variant comprises the “light chain pairing mutation set D” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii) the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; iii) the amino acid at position 173 (EU numbering) of the CH1 H1 is a C and the amino acid at position 162 (EU numbering) of the CL1 is a C; iv) the amino acid at position 220 (EU numbering) in the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is a S; and b) the H2 and the L2 comprise the following: i)the
- the antibody variant comprises the “light chain pairing mutation set E” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; iii) the amino acid at position 173 (EU numbering) of the CH1 H1 is a C and the amino acid at position 162 (EU numbering) CL1 is a C; and iv) the amino acid at position 220 (EU numbering) in the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is a S; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat
- the antibody variant comprises the “light chain pairing mutation set F” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; and ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) CL1 is a D; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii) the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; iii)
- the antibody variant comprises the “light chain pairing mutation set G” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; and ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii) the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; i
- the antibody variant comprises the “light chain pairing mutation set H” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a E, the amino acid at position 137 (EU numbering) of the CL1 is a K; and iii) the amino acid at position 179 (EU numbering) of the CL1 is a E; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii) the amino acid at position 187 (EU numbering) of the CH2 H1 is
- the antibody variant comprises the “light chain pairing mutation set I” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; and ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii) the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; i
- the antibody variant comprises the “light chain pairing mutation set J” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137(EU numbering) of the CL1 is a K; and iii) the amino acid at position 179 (EU numbering) of the CL1 is a E; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii) the amino acid at position 147 (EU numbering) of the CH2 H1 is
- the antibody variant comprises the “light chain pairing mutation set K” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; and ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii) the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; ii
- the antibody variant comprises the “light chain pairing mutation set L” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii) the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; iii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; i
- the antibody variant comprises the “light chain pairing mutation set 0340” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; and ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; ii) the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K;
- the antibody variant comprises the “light chain pairing mutation set M” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; and ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; ii) the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; i
- the antibody variant comprises the “light chain pairing mutation set N” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; and ii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; ii) the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; i
- the antibody variant comprises the “light chain pairing mutation set O” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; ii) the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; iii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; and iv) the amino acid at position 145 (EU numbering) of the CH1 H1 is a S and the amino acid at position 180 (EU numbering) of the CL1 is a E; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (K
- the antibody variant comprises the “light chain pairing mutation set 367” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii) the amino acid at position 147 (EU numbering) of the CH1 H1 is a D and the amino acid at position 131 (EU numbering) of the CL1 is a K; and iii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a D; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K;
- the antibody variant comprises the “light chain pairing mutation set P” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii) the amino acid at position 147 (EU numbering) of the CH1 H1 is a D and the amino acid at position 131 (EU numbering) of the CL1 is a K; and iii) the amino acid at position 145 (EU numbering) of the CH1 H1 is a S; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; ii) the amino acid at position 187 (EU numbering) of the CH2 H1
- the antibody variant comprises the “light chain pairing mutation set 404” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; ii) the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; and iii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D;
- the antibody variant comprises the “light chain pairing mutation set 406” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a E; ii) the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; and iii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K;
- the antibody variant comprises the “light chain pairing mutation set 473” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii) the amino acid at position 147 (EU numbering) of the CH1 H1 is a D and the amino acid at position 131 (EU numbering) of the CL1 is a K; and iii) the amino acid at position 185 (EU numbering) of the CH1 H1 is a D and the amino acid at position 137 (EU numbering) of the CL1 is a K; and b) the H2 and the L2 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K;
- the antibody variant comprises the “light chain pairing mutation set Q” comprising the following substitutions: a) the H1 and the L1 comprise the following: i) the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; ii) the amino acid at position 170 (EU numbering) of the CH1 H1 is a S and the amino acid at position 131 (EU numbering) of the CL1 is a D; iii) the amino acid at position 173 (EU numbering) of the CH1 H1 is a C and the amino acid at position 162 (EU numbering) of the CL1 is a C; iv) the amino acid at position 220 (EU numbering) in the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is a S; and b) the H2 and the L2 comprise the following: i)the
- an antibody disclosed herein with respect to effector function, so as to enhance, e.g., the effectiveness of the antibody in treating diseases and disorders.
- cysteine residue(s) can be introduced into the Fc region, thereby allowing interchain disulfide bond formation in this region.
- the homodimeric antibody thus generated can have improved internalization capability and/or increased complement- mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC).
- ADCC complement- mediated cell killing and antibody-dependent cellular cytotoxicity
- an antibody can be engineered that has dual Fc regions and can thereby have enhanced complement lysis and ADCC capabilities.
- Certain antibody variants with improved or diminished binding to FcRs are described. (See, e.g., U.S. Patent No.6.737,056; WO 2004/056312, and Shields et al., J. Biol.
- an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
- alterations are made in the Fc region that result in altered (i.e., either improved or diminished) C1q binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in US Patent No.6,194,551, WO 99/51642, and Idusogie et al. J. Immunol.164: 4178-4184 (2000).
- Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (US Patent No.7,371 ,826). See also Duncan & Winter, Nature 322:738-40 (1988); U.S. Patent No.5,648,260; U.S. Patent No. 5,624,821; and WO 94/29351 concerning other examples of Fc region variants.
- antibodies may comprise a substitution mutation in the Fc region that reduces effector function.
- the substitution mutation is an aglycosylation site mutation.
- the aglycosylation site mutation is at amino acid residue 297 and amino acid substitutions at residues 234, 235, 265 and 331 (EU numbering) to disrupt the Fc receptor binding interface.
- the aglycosylation site mutation reduces effector function of the antibody.
- the CH1 H3 and/or the CH2 H3 has an A at position 297 (EU numbering)
- ii) the CH1 H3 and/or the CH2 H3 has a G at position 297 (EU numbering); or
- iii) the CH1 H3 and/or the CH2 H3 has a S at position 297 (EU numbering).
- the CH1 H3 and/or the CH2 H3 has an S at position 331 (EU numbering).
- the antibodies may comprise as substitution mutation in the Fc region that can improve expression titers and increased homogeneity of the antibody post-purification.
- the antibody comprises a variant human IgG4 Fc domain.
- the CH1 H2 and/or the CH2 H2 has an C at position 370 (Kabat numbering); and ii) the CH1 H2 and/or the CH2 H2 has an C at position 375 (Kabat numbering).
- the use of knobs into holes as a method of producing multispecific antibodies is well known in the art. See U.S. Pat. No.5,731,168 granted 24 Mar.1998 assigned to Genentech, PCT Pub. No. WO2009089004 published 16 Jul.2009 and assigned to Amgen, and US Pat. Pub. No.20090182127 published 16 Jul.2009 and assigned to Novo Nordisk A/S.
- a “protuberance” refers to at least one amino acid side chain which projects from the interface of a first polypeptide and is therefore positionable in a compensatory cavity in the adjacent interface (i.e. the interface of a second polypeptide) so as to stabilize the heteromultimeric antibody, and thereby favor heteromultimeric antibody formation over homomultimeric antibody formation, for example.
- the protuberance may exist in the original interface or may be introduced synthetically (e.g. by altering nucleic acid encoding the interface).
- nucleic acid encoding the interface of the first polypeptide is altered to encode the protuberance.
- nucleic acid encoding at least one “original” amino acid residue in the interface of the first polypeptide is replaced with nucleic acid encoding at least one “import” amino acid residue which has a larger side chain volume than the original amino acid residue. It will be appreciated that there can be more than one original and corresponding import residue.
- the upper limit for the number of original residues which are replaced is the total number of residues in the interface of the first polypeptide.
- the preferred import residues for the formation of a protuberance are generally naturally occurring amino acid residues and are preferably selected from arginine (R), phenylalanine (F), tyrosine (Y) and tryptophan (W). Most preferred are tryptophan and tyrosine.
- the original residue for the formation of the protuberance has a small side chain volume, such as alanine, asparagine, aspartic acid, glycine, serine, threonine or valine.
- Exemplary amino acid substitutions in the CH1 H3 or CH2 H3 domain for forming the protuberance include without limitation the T366W substitution.
- a “cavity” refers to at least one amino acid side chain which is recessed from the interface of a second polypeptide and therefore accommodates a corresponding protuberance on the adjacent interface of a first polypeptide.
- the cavity may exist in the original interface or may be introduced synthetically (e.g. by altering nucleic acid encoding the interface). Normally, nucleic acid encoding the interface of the second polypeptide is altered to encode the cavity. To achieve this, the nucleic acid encoding at least one “original” amino acid residue in the interface of the second polypeptide is replaced with DNA encoding at least one “import” amino acid residue which has a smaller side chain volume than the original amino acid residue.
- the upper limit for the number of original residues which are replaced is the total number of residues in the interface of the second polypeptide.
- the side chain volumes of the various amino residues are shown in Table 3 above.
- the preferred import residues for the formation of a cavity are usually naturally occurring amino acid residues and are preferably selected from alanine (A), serine (S), threonine (T) and valine (V). Most preferred are serine, alanine or threonine.
- the original residue for the formation of the cavity has a large side chain volume, such as tyrosine, arginine, phenylalanine or tryptophan.
- Exemplary amino acid substitutions in the CH1 H3 or CH2 H3 domain for generating the cavity include without limitation the T366S, L368A, Y407A, Y407T and Y407V substitutions.
- the knob half-antibody comprises T366W substitution
- the hole half- antibody comprises the T366S/L368A/Y407V substitutions.
- the antibody variant comprises the following substitutions: the CH1 H3 has a C at position 349, an S at position 366, an A at position 368 and a V at position 407 (EU numbering); and the CH2 H3 has a C at position 354 and a W at position 366 (EU numbering).
- the antibody variant comprises the following substitutions: the CH2 H3 has a C at position 349, an S at position 366, an A at position 368 and a V at position 407 (EU numbering); and the CH1 H3 has a C at position 354 and a W at position 366 (EU numbering).
- the antibody variant comprises the following substitutions: the CH1 H3 has a C at position 354, an S at position 366, an A at position 368 and a V at position 407 (EU numbering); and the CH2 H3 has a C at position 349 and a W at position 366 (EU numbering); [0225] In certain embodiments, the antibody variant comprises the following substitutions: the CH2 H3 has a C at position 354, an S at position 366, an A at position 368 and a V at position 407 (EU numbering); and the CH1 H3 has a C at position 349 and a W at position 366 (EU numbering).
- T-CELL SURFACE ANTIGENS [0227] The present disclosure provides an antibody comprising a first antigen binding domain that binds to a cell surface antigen expressed on a T-cell, a NK cell, a neutrophil, a B cell or a dendritic cell engager cell, and a second antigen binding domain that binds to a disease associated antigen (DAA).
- DAA disease associated antigen
- the cell surface antigen is expressed on a T-cell.
- Exemplary T-cell surface antigens include but are not limited to CD3.
- the T-cell surface antigen is CD3.
- the T-cell surface antigen is CD3 ⁇ .
- the invention is based, in part, on anti-CD3 antibodies.
- the anti-CD3 antibodies are multispecific (e.g., bispecific) and bind, in addition to CD3 or a fragment thereof, a second biological molecule (e.g., a cell surface antigen, e.g., a disease associated antigen ).
- a second biological molecule e.g., a cell surface antigen, e.g., a disease associated antigen.
- Antibodies of the invention are useful, for example, for treating or delaying the progression of a cell proliferative disorder (e.g., cancer) or an autoimmune disorder, or for enhancing immune function in a subject having such a disorder.
- CD3 cluster of differentiation 3
- mammals such as primates (e.g. humans, cynomolgus monkey) and rodents (e.g., mice and rats), unless otherwise indicated, including, for example, CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , and CD3 ⁇ chains.
- CD3 is a cell surface complex expressed on T cells in association with the T cell receptor. The CD3 complex is required for the activation of CD8+ and CD4+ T lymphocytes.
- CD3 gamma chain one CD3 delta chain
- CD3 epsilon chains which associate with each other to form a CD3 epsilon/gamma heterodimer, and a CD3 epsilon/delta heterodimer.
- the two CD3 heterodimers, together with the T cell receptor (TCR) and the signal-transducing zeta chain homodimer form the T cell receptor complex.
- TCR T cell receptor
- the term encompasses “full-length” unprocessed CD3 (e.g., unprocessed or unmodified CD3 ⁇ or CD3 ⁇ ), as well as any form of CD3 that results from processing in the cell.
- CD3 includes, for example, human CD3 ⁇ protein (NCBI RefSeq No. NP_000724), which is 207 amino acids in length.
- the invention provides isolated antibodies that bind to CD3.
- the invention provides antibodies that bind to CD3 ⁇ .
- the anti-CD3 ⁇ antibody binds to a human CD3 ⁇ polypeptide or a cynomolgus monkey (cyno) CD3 ⁇ polypeptide.
- the human CD3 polypeptide or the cyno CD3 polypeptide is a human CD3 ⁇ polypeptide (SEQ ID NO: 419) or a cyno CD3 ⁇ polypeptide (SEQ ID NO: 420), respectively.
- the anti- CD3 antibody binds to an epitope within a fragment of CD3 ⁇ (e.g., human CD3 ⁇ ) consisting of amino acid residues 1-26 or amino acid residues 1-27 of human CD3 ⁇ (SEQ ID NO: 419).
- a useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called “alanine scanning mutagenesis” as described by Cunningham and Wells (1989) Science, 244:1081-1085.
- a residue or group of target residues e.g., charged residues such as Arg, Asp, His, Lys, and Glu
- a neutral or negatively charged amino acid e.g., alanine or polyalanine
- a crystal structure of an antigen-antibody complex is used to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
- Anti-CD3 ⁇ Antibodies Provided herein are anti-CD3 ⁇ antibodies. In some embodiments, alanine scanning mutagenesis was performed on the “SP34” anti-CD3 ⁇ antibody to produce affinity modulated anti-CD3 ⁇ antibodies of the invention. [0236] In some embodiments, a anti-CD3 ⁇ antibody of the disclosure comprises any one of the VH and VL sequences listed in Table 7.
- a anti-CD3 antibody of the disclosure comprises: a) a heavy chain variable region (VH) comprising a VH complementarity determining region 1 (VH CDR1 ), a VH complementarity determining region 2 (VH CDR2 ) and a VH complementarity determining region 3 (VH CDR3 ); and b) a light chain variable region (VL) comprising a VL complementarity determining region 1 (VL CDR1 ), a VL complementarity determining region 2 (VL CDR2 ) and a VL complementarity determining region 3 (VL CDR3 ).
- Tables 8 and 9 provide exemplary of CDR sequences of the anti-CD3 antibodies provided herein.
- the disclosure provides an antibody (e.g. including antibody fragments, such as single chain variable fragments (scFvs) which specifically bind to CD3 ⁇ , wherein the antibody comprises a) a heavy chain variable region (VH) comprising a i) a VH complementarity determining region 1 (VH CDR1 ) comprising the amino acid sequence of SEQ ID NO: 29, 30, 31, 32 or 33, ii) a VH complementarity determining region 2 (VH CDR2 ) comprising the amino acid sequence of SEQ ID NO: 34, 35 or 36, iii) a VH complementarity determining region 3 (VH CDR3 ) comprising the amino acid sequence of SEQ ID NO: 37, 38, 39, 40 or 41; and b) a light chain variable region (VL) comprising a i) i) a VL
- Exemplary anti-CD3 antibodies of the invention include CD3-A1, CD3-A2, CD3- A3, CD3-A4, CD3-A5, CD3-A6, CD3-A7, CD3-A8, CD3-A9, CD3-A10, CD3-A11, CD3- A12 and CD3-A13.
- the anti-CD3 antibody CD3-A1 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 34, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 37; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 46.
- the anti-CD3 antibody CD3-A1 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 13 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 25.
- the anti-CD3 antibody CD3-A2 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 34, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 37; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 44, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 45.
- the anti-CD3 antibody CD3-A2 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 13 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 27.
- the anti-CD3 antibody CD3-A3 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 34, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 37; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 45.
- the anti-CD3 antibody CD3-A3 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 14 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 23.
- the anti-CD3 antibody CD3-A4 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 34, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 38; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 47.
- the anti-CD3 antibody CD3-A4 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 15 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 26.
- the anti-CD3 antibody CD3-A5 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 34, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 39; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 47.
- the anti-CD3 antibody CD3-A5 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 16 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 26.
- the anti-CD3 antibody CD3-A6 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 30, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 34, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 37; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 45.
- the anti-CD3 antibody CD3-A6 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 17 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 22.
- the anti-CD3 antibody CD3-A7 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 35, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 38; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 45.
- the anti-CD3 antibody CD3-A7 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 18 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 22.
- the anti-CD3 antibody CD3-A8 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 35, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 38; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 47.
- the anti-CD3 antibody CD3-A8 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 18 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 26.
- the anti-CD3 antibody CD3-A9 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 34, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 40; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 47.
- the anti-CD3 antibody CD3-A9 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 19 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 26.
- the anti-CD3 antibody CD3-A10 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 34, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 41; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 47.
- the anti-CD3 antibody CD3-A10 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 20 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 26.
- the anti-CD3 antibody CD3-A11 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 31, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 34, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 37; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 45.
- the anti-CD3 antibody CD3-A11 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 21 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 22.
- the anti-CD3 antibody CD3-A12 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 34, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 37; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 45.
- the anti-CD3 antibody CD3-A12 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 13 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 24.
- the anti-CD3 antibody CD3-A13 comprises a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 34, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 39; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 42, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 48.
- the anti-CD3 antibody CD3-A13 comprises a VH region comprising the amino acid sequence shown in SEQ ID NO: 16 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 28.
- Bispecific Anti-CD3 ⁇ Antibodies Provided herein are bispecific antibodies comprising a first antigen binding domain that binds a first antigen (e.g. CD3 ⁇ ) and a second antigen binding domain that binds to a second antigen (e.g. disease associated antigen).
- the bispecific antibody has the following structure: a first heavy chain polypeptide (H1) comprising a variable region (VH1), and a constant region (CH1) having a constant region 1 domain (CH1 H1 ), a hinge region (H1H), a constant region 2 domain (CH1 H2 ) and a constant region 3 domain (CH1 H3 ); and a first light chain polypeptide (L1) comprising a variable region (VL1) and a constant region (CL1), and a second heavy chain polypeptide (H2) comprising a variable region (VH2), and a constant region (CH2) having a constant region 1 domain (CH2 H1 ), a hinge region (H2H), a constant region 2 domain (CH2 H2 ) and a constant region 3 domain (CH2 H3 ); and second light chain polypeptide (L2) comprising a variable region (VL2) and a constant region (CL2).
- the bispecific antibody of the disclosure comprises a first antigen binding domain (e.g. binding to CD3) comprising any one of the VH1 and VL1 sequences listed in Table 7.
- the underlined sequences are CDR sequence according to Kabat and the bolded sequences are CDR sequences according to Chothia.
- the bispecific antibody of the disclosure comprises a first antigen binding domain (e.g.
- binding to CD3 ⁇ comprising: a) a heavy chain variable region (VH1) comprising a VH complementarity determining region 1 (VH1 CDR1 ), a VH complementarity determining region 2 (VH1 CDR2 ) and a VH complementarity determining region 3 (VH1 CDR3 ); and b) a light chain variable region (VL) comprising a VL complementarity determining region 1 (VL1 CDR1 ), a VL complementarity determining region 2 (VL1 CDR2 ) and a VL complementarity determining region 3 (VL1 CDR3 ).
- Tables 8 and 9 provide exemplary of CDR sequences of the anti-CD3 antibodies provided herein.
- the bispecific antibody comprises any one of the anti-CD3 antibodies of the disclosure.
- Exemplary anti-CD3 antibodies of the invention include CD3- A1, CD3-A2, CD3-A3, CD3-A4, CD3-A5, CD3-A6, CD3-A7, CD3-A8, CD3-A9, CD3- A10, CD3-A11, CD3-A12 and CD3-A13.
- the disclosure provides an isolated antibody (e.g. monospecific antibody or bispecific antibody) which specifically binds to CD3 ⁇ and competes with any of the foregoing antibodies.
- the present invention provides an antibody (e.g.
- the invention also provides CDR portions of antibodies to CD3 ⁇ antibodies based on CDR contact regions.
- CDR contact regions are regions of an antibody that imbue specificity to the antibody for an antigen.
- CDR contact regions include the residue positions in the CDRs and Vernier zones which are constrained in order to maintain proper loop structure for the antibody to bind a specific antigen. See, e.g., Makabe et al., J. Biol. Chem., 283:1156-1166, 2007. Determination of CDR contact regions is well within the skill of the art.
- the binding affinity (KD) of the anti-CD3 ⁇ antibodies of the invention e.g. monospecific antibody or bispecific antibody
- human CD3 ⁇ such as human CD3 ⁇ (e.g., (SEQ ID NO: 419)
- KD binding affinity
- the binding affinity is about any of 5000 nM, 4500 nM, 4000 nM, 3500 nM, 3000 nM, 2500 nM, 2000 nM, 1789 nM, 1583 nM, 1540 nM, 1500 nM, 1490 nM, 1064 nM, 1000 nM, 933 nM, 894 nM, 750 nM, 705 nM, 678 nM, 532 nM, 500 nM, 494 nM, 400 nM, 349 nM, 340 nM, 353 nM, 300 nM, 250 nM, 244 nM, 231 nM, 225 nM, 207 nM, 200 nM, 186 nM, 172 nM, 136 nM, 113 nM, 104 nM, 101 nM, 100 nM, 90 nM, 83 nM, 1064 nM,
- the binding affinity is less than about any of 5000 nM, 4000 nM, 3000 nM, 2000 nM, 1000 nM, 900 nM, 800 nM, 250 nM, 200 nM, 100 nM, 50 nM, 30 nM, 20 nM, 10 nM, 7.5 nM, 7 nM, 6.5 nM, 6 nM, 5 nM, 4.5 nM, 4 nM, 3.5 nM, 3 nM, 2.5 nM, 2 nM, 1.5 nM, 1 nM, or 0.5 nM.
- the binding affinity (KD) of the anti- CD3 ⁇ antibodies of the invention e.g. monospecific antibody or bispecific antibody
- cynomolgus CD3 ⁇ such as cynomolgus CD3 ⁇ (e.g., (SEQ ID NO: 422)
- KD binding affinity
- the binding affinity is about any of 5000 nM, 4500 nM, 4000 nM, 3500 nM, 3000 nM, 2500 nM, 2000 nM, 1789 nM, 1583 nM, 1540 nM, 1500 nM, 1490 nM, 1064 nM, 1000 nM, 933 nM, 894 nM, 750 nM, 705 nM, 678 nM, 532 nM, 500 nM, 494 nM, 400 nM, 349 nM, 340 nM, 353 nM, 300 nM, 250 nM, 244 nM, 231 nM, 225 nM, 207 nM, 200 nM, 186 nM, 172 nM, 136 nM, 113 nM, 104 nM, 101 nM, 100 nM, 90 nM, 83 nM,
- the binding affinity is less than about any of 5000 nM, 4000 nM, 3000 nM, 2000 nM, 1000 nM, 900 nM, 800 nM, 250 nM, 200 nM, 100 nM, 50 nM, 30 nM, 20 nM, 10 nM, 7.5 nM, 7 nM, 6.5 nM, 6 nM, 5 nM, 4.5 nM, 4 nM, 3.5 nM, 3 nM, 2.5 nM, 2 nM, 1.5 nM, 1 nM, or 0.5 nM.
- the disclosure provides a nucleic acid encoding any of the foregoing isolated anti-CD3 ⁇ antibodies (e.g. monospecific antibody or bispecific antibody).
- the disclosure provides a vector comprising such a nucleic acid.
- the disclosure provides a host cell comprising such a nucleic acid.
- DISEASE ASSOCIATED ANTIGENS Provided herein are bispecific antibodies that have a first antigen binding domain that binds a first antigen (e.g. CD3 ⁇ ) and a second antigen binding domain that binds to a second antigen (e.g. a cell surface antigen, or DAA).
- the second biological molecule is a cell surface antigen.
- the second biological molecule is a disease associated antigen.
- Disease associated antigens include but are not limited to ACVR1, ADAM21, AGL10, ALPPL2, APCDD1, ASPRV1, BCMA, BMPR1B, CD151, CD19, CD22, CD274, CD276, CD33, CD38, CD47, CD6, CD70, CD74, CD84, CD180, CDCP1, CDH17 , CDH3, CDHR2,CDHR5, CEACAM5, CEACAM6 , CEACAM7, CELSR1, CLCA2, CLDN1, CLDN18, CLDN6, CNGB1, CNGB3, COL11A1, COL17A1, CRB1, CPSG4, CTAG2, CTAGE4, CXADR, CXCR4, DCBLD2, DCST1, DLL3, DLL4, DPCR1, DSG3, DSG4, DUOX2, EBI3, EFNA4, EGFR, ENTPD1, ENTPD2,
- Exemplary disease associated antigens include but are not limited to those shown in Table 22. [0289] Table 22. Exemplary Disease Associated Antigens [0290] Multispecific antibodies are antibodies (e.g., monoclonal antibodies) that have binding specificities for at least two different sites.
- the anti-CD3 CD3 ⁇ antibody provided herein is a multispecific antibody (e.g. a bispecific antibody).
- bispecific antibodies may bind to two different epitopes of CD3 (e.g., CD3 ⁇ or CD3 ⁇ ).
- one of the binding specificities is for CD3 (e.g., CD3 ⁇ or CD3 ⁇ ) and the other is for any other antigen (e.g., a second biological molecule, e.g., a cell surface antigen, e.g., a disease associated antigen).
- a bispecific anti- CD3 antibody may have binding specificities for CD3 and a second biological molecule, such as a second biological molecule (e.g., a disease associated antigen) listed in Table 22 and described in U.S. Pub. No.2010/0111856 and PCT Publication No. WO2016204966 A1, each of which are incorporated by reference herein in their entirety.
- the cell surface antigen (e.g. disease associated antigen) may be expressed in low copy number on the target cell (e.g. tumor cell).
- the cell surface antigen is expressed or present at less than 35,000 copies per target cell.
- the low copy number cell surface antigen is present between 100 and 35,000 copies per target cell; between 100 and 30,000 copies per target cell; between 100 and 25,000 copies per target cell; between 100 and 20,000 copies per target cell; between 100 and 15,000 copies per target cell; between 100 and 10,000 copies per target cell; between 100 and 5,000 copies per target cell; between 100 and 2,000 copies per target cell; between 100 and 1,000 copies per target cell; or between 100 and 500 copies per target cell.
- UL16 BINDING PROTEINS [0293] Exemplary UL16 binding proteins include but are not limited to ULBP1, ULBP2, ULBP3, RAET1E (ULBP4), RAET1G (ULBP5) and RAET1L (ULBP6). Defects in the regulation of ULBP1-6 are associated with diseases ranging from autoimmunity to cancer.
- UL16 Binding Protein 2 (ULBP2) is a major histocompatibility complex (MHC) class I-related molecule that binds to the NKG2D receptor on natural killer (NK) cells to trigger release of multiple cytokines and chemokines that in turn contribute to the recruitment and activation of NK cells.
- MHC major histocompatibility complex
- the encoded protein undergoes further processing to generate the mature protein that is either anchored to membrane via a glycosyl- phosphatidylinositol moiety, or secreted. Many malignant cells secrete the encoded protein to evade immunosurveillance by NK cells.
- ULBP2 is broadly and differentially expressed in multiple solid tumor indications.
- Senescence is a stress-induced cellular state that limits tumorigenesis by preventing cell proliferation and promoting immune-mediated clearance of damaged cells through the induction of senescence-associated secretory phenotype (SASP) (Rodier, F. et al. Persistent DNA damage signalling triggers senescence-associated inflammatory cytokine secretion. Nat. Cell Biol. 11, 973–979 (2009)).
- SASP senescence-associated secretory phenotype
- Senescence is also implicated in age-related tissue pathologies where the accumulation of SASP-positive cells can induce tissue inflammation resulting in tissue dysfunction that manifests in aged patients as arthritis, autoimmunity, diabetes, fibrosis, and delayed wound healing (Childs, B. G. et al. Senescent cells: an emerging target for diseases of ageing. Nat. Rev. Drug Discov.16, 718–735 (2017)).
- SASP- positive cells express a complex assortment of both secreted and cell surface proteins including immune-activating cytokines, tissue remodeling matrix metalloprotease, and cell surface proteins that include MHCI-like NKG2D ligands that mediate the recognition and activation of NK and T cell effectors through NKG2D costimulatory receptors.
- Therapeutic strategies to eliminate SASP-positive cells provide an opportunity to supplement senescent immunosurveillance and alleviate an underlying etiology of many age-related diseases and lasting side effects of chemotherapy.
- the clearance of senescent cells cannot only reduce age-related disease, but these senolytic drugs also have the potential to extend life span (Baker, D. J. et al. Naturally occurring p16Ink4a-positive cells shorten healthy lifespan. Nature 530, 184–189 (2016); Baker, D. J. et al. Clearance of p16Ink4a-positive senescent cells delays ageing-associated disorders. Nature 479, 232–236 (2011)).
- ULBP2 an MHCI-like ligand
- SASP-positive fibroblasts and cancer cells Sagiv, A. et al. NKG2D ligands mediate immunosurveillance of senescent cells. Aging 8, 328–344 (2016); Ruscetti, M. et al. NK cell-mediated cytotoxicity contributes to tumor control by a cytostatic drug combination. Science 362, 1416–1422 (2018); Mu ⁇ oz, D. P. et al. Targetable mechanisms driving immunoevasion of persistent senescent cells link chemotherapy-resistant cancer to aging. JCI Insight 5, e124716, 124716 (2019)).
- ULBP2 or ULBP2/5/6 targeted drugs in addition to eradicating cancer cells, have the potential to eliminate SASP-positive cells from tissues with the potential to improve tissue function which can prevent age-related disease and extend life span.
- ULBP2 encompasses naturally occurring variants of ULBP2, including, for example, splice variants or allelic variants.
- ULBP2 includes, for example, human ULBP2 protein (UniProt ID: Q9BZM5), which is 246 amino acids in length.
- the invention provides isolated antibodies that bind to ULBP2.
- the anti-ULBP2 antibody binds to a human ULBP2 polypeptide or a portion thereof.
- the human ULBP2 polypeptide comprises the amino acid sequence of SEQ ID NO: 421.
- ULBP5 encompasses naturally occurring variants of ULBP5, including, for example, splice variants or allelic variants.
- ULBP5 includes, for example, human ULBP5 protein (UniProt ID: Q6H3X3), which is 334 amino acids in length.
- the invention provides isolated antibodies that bind to ULBP5 (RAET1G). In some instances the anti-ULBP5 antibody binds to a human ULBP5 polypeptide or a portion thereof.
- the human ULBP5 polypeptide comprises the amino acid sequence of SEQ ID NO: 422.
- ULBP6 encompasses naturally occurring variants of ULBP6, including, for example, splice variants or allelic variants.
- ULBP6 includes, for example, human ULBP6 protein (UniProt ID: Q5VY80), which is 246 amino acids in length.
- the invention provides isolated antibodies that bind to ULBP6 (RAET1L).
- the anti-ULBP6 antibody binds to a human ULBP6 polypeptide or a portion thereof.
- the human ULBP6 polypeptide comprises the amino acid sequence of SEQ ID NO: 423.
- Anti-ULBP2/5/6 Antibodies [0303] Provided herein are antibodies that bind to anti-ULBP2/5/6. In some embodiments, alanine scanning mutagenesis may be performed on the “E12” anti-ULBP2/5/6 antibody to produce affinity modulated anti-ULBP2/5/6 antibodies. Also provided herein are antibodies that bind to anti-ULBP2. In some embodiments, alanine scanning mutagenesis may be performed on the “A06” anti-ULBP2 antibody to produce affinity modulated anti-ULBP2 antibodies. [0304] In some embodiments, a anti-ULBP2/5/6 antibody of the disclosure comprises any one of the VH and VL sequences listed in Table 10.
- a anti-ULBP2 antibody of the disclosure comprises: a) a heavy chain variable region (VH) comprising a VH complementarity determining region 1 (VH CDR1 ), a VH complementarity determining region 2 (VH CDR2 ) and a VH complementarity determining region 3 (VH CDR3 ); and b) a light chain variable region (VL) comprising a VL complementarity determining region 1 (VL CDR1 ), a VL complementarity determining region 2 (VL CDR2 ) and a VL complementarity determining region 3 (VL CDR3 ).
- VH heavy chain variable region
- VH CDR1 VH complementarity determining region 1
- VH CDR2 VH complementarity determining region 2
- VH CDR3 VH complementarity determining region 3
- Tables 11 and 12 provide exemplary of CDR sequences of the anti-ULBP2 antibodies provided herein.
- Table 10. Anti-ULBP2/5/6 Variable Heavy Chain and Variable Light Chain Domains [0307] Table 11.
- Anti-ULBP2/5/6 Heavy Chain CDRs [0308] Table 12.
- Anti-ULBP2/5/6 Light Chain CDRs [0309] In some embodiments, the disclosure provides an antibody (e.g.
- antibody fragments such as single chain variable fragments (scFvs) which specifically bind to ULBP2, wherein the antibody comprises a) a heavy chain variable region (VH) comprising a i) a VH complementarity determining region 1 (VH CDR1 ) comprising the amino acid sequence of SEQ ID NO: 5 or 6, ii) a VH complementarity determining region 2 (VH CDR2 ) comprising the amino acid sequence of SEQ ID NO: 7 or 8, iii) a VH complementarity determining region 3 (VH CDR3 ) comprising the amino acid sequence of SEQ ID NO: 9; and b) a light chain variable region (VL) comprising a i) a VL complementarity determining region 1 (VL CDR1 ) comprising the amino acid sequence of SEQ ID NO: 10, ii) a VL complementarity determining region 2 (VL CDR2 ) comprising the amino acid sequence of SEQ ID NO: 11, ii
- anti-ULBP2 antibodies of the invention include ULBP2-01, ULBP2-02, E12, A06.
- the anti-ULBP2 antibody ULBP2-01 has a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 5, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 7, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 9; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 10, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 12.
- the anti-ULBP2 antibody ULBP2-01 has a VH region comprising the amino acid sequence shown in SEQ ID NO: 2 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 1.
- the anti-ULBP2 antibody ULBP2 -02 has VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 5, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 7, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 9; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 10, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 12.
- the anti-ULBP2 antibody ULBP2-02 has a VH region comprising the amino acid sequence shown in SEQ ID NO: 4 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 3.
- the anti-ULBP2 antibody E12 has a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 5, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 7, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 9; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 10, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 12.
- the anti-ULBP2 antibody E12 has a VH region comprising the amino acid sequence shown in SEQ ID NO: 425 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 424.
- the anti-ULBP2 antibody A06 has a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 428, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 430, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 432; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 433, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 434, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 435.
- the anti-ULBP2 antibody A06 has a VH region comprising the amino acid sequence shown in SEQ ID NO: 427 and a VL region comprising the amino acid sequence shown in SEQ ID NO: 426.
- Bispecific Anti-ULBP2/5/6 Antibodies Provided herein are bispecific antibodies comprising a first antigen binding domain that binds a first antigen (e.g. cell surface antigen, CD3 ⁇ ) and a second antigen binding domain that binds to a second antigen (e.g. ULBP2/5/6).
- the bispecific antibody has the following structure: a first heavy chain polypeptide (H1) comprising a variable region (VH1), and a constant region (CH1) having a constant region 1 domain (CH1 H1 ), a hinge region (H1H), a constant region 2 domain (CH1 H2 ) and a constant region 3 domain (CH1 H3 ); and a first light chain polypeptide (L1) comprising a variable region (VL1) and a constant region (CL1), and a second heavy chain polypeptide (H2) comprising a variable region (VH2), and a constant region (CH2) having a constant region 1 domain (CH2 H1 ), a hinge region (H2H), a constant region 2 domain (CH2 H2 ) and a constant region 3 domain (CH2 H3 ); and second light chain polypeptide (L2) comprising a variable region (VL2) and a constant region (CL2).
- the bispecific antibody of the disclosure comprises a second antigen binding domain (e.g. binding to ULBP2/5/6) comprising any one of the VH2 and VL2 sequences listed in Table 10.
- the underlined sequences are CDR sequence according to Kabat and the bolded sequences are CDR sequences according to Chothia.
- the bispecific antibody of the disclosure comprises a second antigen binding domain (e.g.
- binding to ULBP2 comprising: a) a heavy chain variable region (VH2) comprising a VH complementarity determining region 1 (VH2 CDR1 ), a VH complementarity determining region 2 (VH2 CDR2 ) and a VH2 complementarity determining region 3 (VH2 CDR3 ); and b) a light chain variable region (VL2) comprising a VL complementarity determining region 1 (VL2 CDR1 ), a VL complementarity determining region 2 (VL2 CDR2 ) and a VL complementarity determining region 3 (VL2 CDR3 ).
- Tables 11 and 12 provide exemplary of CDR sequences of the anti-ULBP2 antibodies provided herein.
- the bispecific antibody comprises any one of the anti- ULBP2/5/6 antibodies of the disclosure.
- Exemplary anti-ULBP2/5/6 antibodies of the invention include ULBP2-01, ULBP2-02 and E12.
- the bispecific antibody comprises any one of the anti-ULBP2 antibodies of the disclosure.
- Exemplary anti-ULBP2 antibodies of the invention include A06.
- the disclosure provides an isolated antibody (e.g. monospecific antibody or bispecific antibody) which specifically binds to ULPB2/5/6 and competes with any of the foregoing antibodies.
- the present invention provides an antibody (e.g.
- the invention also provides CDR portions of antibodies to ULBP2/5/6 antibodies based on CDR contact regions.
- CDR contact regions are regions of an antibody that imbue specificity to the antibody for an antigen.
- CDR contact regions include the residue positions in the CDRs and Vernier zones which are constrained in order to maintain proper loop structure for the antibody to bind a specific antigen. See, e.g., Makabe et al., J. Biol. Chem., 283:1156-1166, 2007.
- the binding affinity (K D ) of the ULBP2/5/6 antibody e.g. monospecific antibody or bispecific antibody
- ULBP2/5/6 such as human ULBP2 (e.g., (SEQ ID NO: 421), ULBP5 (SEQ ID NO: 422), ULBP6 (SEQ ID NO: 423))
- K D binding affinity of the ULBP2/5/6 antibody
- human ULBP2 e.g., (SEQ ID NO: 421), ULBP5 (SEQ ID NO: 422), ULBP6 (SEQ ID NO: 423)
- the binding affinity is about any of 5000 nM, 4500 nM, 4000 nM, 3500 nM, 3000 nM, 2500 nM, 2000 nM, 1789 nM, 1583 nM, 1540 nM, 1500 nM, 1490 nM, 1064 nM, 1000 nM, 933 nM, 894 nM, 750 nM, 705 nM, 678 nM, 532 nM, 500 nM, 494 nM, 400 nM, 349 nM, 340 nM, 353 nM, 300 nM, 250 nM, 244 nM, 231 nM, 225 nM, 207 nM, 200 nM, 186 nM, 172 nM, 136 nM, 113 nM, 104 nM, 101 nM, 100 nM, 90 nM, 83 nM, 1064 nM,
- the binding affinity is less than about any of 5000 nM, 4000 nM, 3000 nM, 2000 nM, 1000 nM, 900 nM, 800 nM, 250 nM, 200 nM, 100 nM, 50 nM, 30 nM, 20 nM, 10 nM, 7.5 nM, 7 nM, 6.5 nM, 6 nM, 5 nM, 4.5 nM, 4 nM, 3.5 nM, 3 nM, 2.5 nM, 2 nM, 1.5 nM, 1 nM, or 0.5 nM.
- the disclosure provides a nucleic acid encoding any of the foregoing isolated anti-ULBP2/5/6 antibodies (e.g. monospecific antibody or bispecific antibody).
- the disclosure provides a vector comprising such a nucleic acid.
- the disclosure provides a host cell comprising such a nucleic acid.
- EXEMPLARY BISPECIFIC ANTIBODIES THAT BIND TO CD3 ⁇ AND ULBP2/5/6 [0333] Provided herein are bispecific antibodies comprising a first antigen binding domain that binds a first antigen (e.g. CD3 ⁇ ) and a second antigen binding domain that binds to a second antigen (e.g.
- the bispecific antibody has the following structure: a first heavy chain polypeptide (H1) comprising a variable region (VH1), and a constant region (CH1) having a constant region 1 domain (CH1 H1 ), a hinge region (H1H), a constant region 2 domain (CH1 H2 ) and a constant region 3 domain (CH1 H3 ); and a first light chain polypeptide (L1) comprising a variable region (VL1) and a constant region (CL1), and a second heavy chain polypeptide (H2) comprising a variable region (VH2), and a constant region (CH2) having a constant region 1 domain (CH2 H1 ), a hinge region (H2H), a constant region 2 domain (CH2 H2 ) and a constant region 3 domain (CH2 H3 ); and second light chain polypeptide (L2) comprising a variable region (VL2) and a constant region (CL2).
- the bispecific antibody of the disclosure comprises a first antigen binding domain (e.g. binding to CD3 ⁇ ) comprising: a) a heavy chain variable region (VH1) comprising a VH complementarity determining region 1 (VH1 CDR1 ), a VH complementarity determining region 2 (VH1 CDR2 ) and a VH complementarity determining region 3 (VH1 CDR3 ); and b) a light chain variable region (VL) comprising a VL complementarity determining region 1 (VL1 CDR1 ), a VL complementarity determining region 2 (VL1 CDR2 ) and a VL complementarity determining region 3 (VL1 CDR3 ); and a second antigen binding domain (e.g. binding to CD3 ⁇ ) comprising: a) a heavy chain variable region (VH1) comprising a VH complementarity determining region 1 (VH1 CDR1 ), a VH complementarity determining region 2 (VH1
- binding to ULBP2/5/6) comprising: a) a heavy chain variable region (VH2) comprising a VH complementarity determining region 1 (VH2 CDR1 ), a VH complementarity determining region 2 (VH2 CDR2 ) and a VH2 complementarity determining region 3 (VH2 CDR3 ); and b) a light chain variable region (VL2) comprising a VL complementarity determining region 1 (VL2 CDR1 ), a VL complementarity determining region 2 (VL2 CDR2 ) and a VL complementarity determining region 3 (VL2 CDR3 ).
- Tables 8 and 9 provide exemplary of CDR sequences of the anti-CD3 ⁇ antibodies provided herein.
- the bispecific antibody of the disclosure comprises a first antigen binding domain (e.g. binding to CD3 ⁇ ) comprising any one of the VH1 and VL1 sequences listed in Table 7 and a second antigen binding domain (e.g. binding to ULBP2/5/6) comprising any one of the VH2 and VL2 sequences listed in Table 10.
- a first antigen binding domain e.g. binding to CD3 ⁇
- a second antigen binding domain e.g. binding to ULBP2/5/6 comprising any one of the VH2 and VL2 sequences listed in Table 10.
- the bispecific antibody of the disclosure comprises a first heavy chain polypeptide (H1) and a first light chain polypeptide (L1); and a second heavy chain polypeptide (H2) and a second light chain polypeptide (L2) comprising any one of the sequences listed in Table 13 and Table 14.
- the italicized sequences are the heavy chain variable regions and the light chain variable regions.
- the underlined sequences are CDRs according to Kabat and the bolded sequences are CDRs according to Chothia.
- the bispecific antibody of the disclosure provided herein comprises a H1 that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or at least 100% identical to the amino acid sequence of the sequences listed in Table 13 and Table 14.
- the bispecific antibody of the disclosure provided herein comprises a L1 that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or at least 100% identical to the amino acid sequence of the sequences listed in Table 13 and Table 14.
- the bispecific antibody of the disclosure provided herein comprises a H2 that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or at least 100% identical to the amino acid sequence of the sequences listed in Table 13 and Table 14.
- the bispecific antibody of the disclosure provided herein comprises a L2 that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or at least 100% identical to the amino acid sequence of the sequences listed in Table 13 and Table 14.
- the H1 amino acid sequence is numbered in accordance with SEQ ID NO: 439. In some embodiments the L1 amino acid sequence is numbered in accordance with SEQ ID NO: 438. In some embodiments, the H2 amino acid sequence is numbered in accordance with SEQ ID NO: 437. In some embodiments, the L2 amino acid sequence is numbered in accordance with SEQ ID NO: 436. [0343] Table 13.
- Exemplary Bispecific Antibodies that bind CD3 ⁇ and ULBP2/5/6 CSVMHEALHNHYTQKSLSLSP [0344] Exemplary, CD3 ⁇ x ULBP2/5/6 bispecific antibodies of the invention include EIP0174, EIP0175, EIP0187, EIP0205, EIP0206, EIP0207, EIP0208, EIP0294, EIP0295, EIP0306, EIP0307, EIP0318, EIP0340, EIP0342, EIP0354, EIP0356, EIP0367, EIP0377, EIP0404, EIP0406, EIP0473, and EIP0598.
- Bispecific antibodies comprise a first antigen binding domain that binds CD3 ⁇ which comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 37; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43
- Bispecific antibodies comprise a second antigen binding domain that binds ULBP2/5/6 comprising a VH2, comprising VH2 CDR1 having the amino acid sequence of SEQ ID NO: 5; a VH2 CDR2 having the amino acid sequence of SEQ ID NO: 7; and a VH2 CDR3 having the amino acid sequence of SEQ ID NO: 9; and a VL2, having VL2 CDR1 having the amino acid sequence of SEQ ID NO: 10; a VL2 CDR2 having the amino acid sequence of SEQ ID NO: 11; and
- the bispecific antibody EIP0174 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; the amino acid at position 128 (EU numbering) of the CH1 H1 is a C and the amino acid at position 118 (EU numbering) of the CL1 is a C; the amino acid at position 220 (EU numbering) of the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is an S; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU
- the bispecific antibody EIP0174 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (EU numbering) of the CH2 H3 is a C; the amino acid at position 366 (EU numbering) of the CH2 H3 is a W; and the amino acid at position 447 (EU numbering) of the CH2 H3 is deleted, when numbered in accordance with H2 amino acid sequence of SEQ NO: 437 and L2 amino acid sequence of SEQ
- the bispecific antibody EIP0174 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0174 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 58, a L1 comprising the amino acid sequence of SEQ ID NO: 57, a H2 comprising the amino acid sequence of SEQ ID NO: 56, and a L2 comprising the amino acid sequence of SEQ ID NO: 55.
- the bispecific antibody EIP0175 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position 368 (EU numbering) of the CH1 H3 is a A; the amino acid at position 407 (EU numbering) of CH1 H3 is a V; and the amino acid
- the bispecific antibody EIP0175 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; the amino acid at position 134 (EU numbering) of the CH2 H1 is a C and the amino acid at position 116 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (EU
- the bispecific antibody EIP0175 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0175 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 62, a H2 comprising the amino acid sequence of SEQ ID NO: 60, a L1 comprising the amino acid sequence of SEQ ID NO: 61, and a L2 comprising the amino acid sequence of SEQ ID NO: 59.
- the bispecific antibody EIP0187 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position 368 (EU numbering) of the CH1 H3 is a A; the amino acid at position 407 (EU numbering) of CH1 H3 is a V; and the amino acid
- the bispecific antibody EIP0187 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; the amino acid at position 136 (EU numbering) of the CH2 H1 is a C and the amino acid at position 114 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (EU
- the bispecific antibody EIP0187 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0187 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 66, a H2 comprising the amino acid sequence of SEQ ID NO: 64, a L1 comprising the amino acid sequence of SEQ ID NO: 65, and a L2 comprising the amino acid sequence of SEQ ID NO: 63.
- the bispecific antibody EIP0205 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; the amino acid at position 173 (EU numbering) of the CH1 H1 is a C and the amino acid at position 162 (EU numbering) of the CL1 is a C; the amino acid at position 220 (EU numbering) of the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (Kabat numbering) of the VH1 is a K and the amino acid
- the bispecific antibody EIP0205 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (EU numbering) of the CH2 H3 is a C; the amino acid at position 366 (EU numbering) of the CH2 H3 is a W; and the amino acid at position 447 (EU numbering) of the CH2 H3 is deleted, when numbered in accordance with H2 amino acid sequence of SEQ NO: 437 and L2 amino acid sequence of SEQ
- the bispecific antibody EIP0205 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0205 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 70, a H2 comprising the amino acid sequence of SEQ ID NO: 68, a L1 comprising the amino acid sequence of SEQ ID NO: 69, and a L2 comprising the amino acid sequence of SEQ ID NO: 67.
- the bispecific antibody EIP0206 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; the amino acid at position 173 (EU numbering) of the CH1 H1 is a C and the amino acid at position 162 (EU numbering) of the CL1 is a C; the amino acid at position 220 (EU numbering) in the H1H is a S and the amino acid at position 214 in CL1 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the
- the bispecific antibody EIP0206 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; the amino acid at position 134 (EU numbering) of the CH2 H1 is a C and the amino acid at position 116 (EU numbering) of the CL2 is a C; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (EU numbering) of the CH2 H3 is a C; the amino acid at position 366 (EU numbering) of the CH2 H3 is a W; and the amino acid at position
- the bispecific antibody EIP0206 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0206 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 74, a H2 comprising the amino acid sequence of SEQ ID NO: 72, a L1 comprising the amino acid sequence of SEQ ID NO: 73, and a L2 comprising the amino acid sequence of SEQ ID NO: 71.
- the bispecific antibody EIP0207 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position 368 (EU numbering) of the CH1 H3 is a A; the amino acid at position 407 (EU numbering) of CH1 H3 is a V; and the amino acid
- the bispecific antibody EIP0207 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; the amino acid at position 131 (EU numbering) of the CH2 H1 is a C and the amino acid at position 114 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (EU
- the bispecific antibody EIP0207 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0207 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 78, a H2 comprising the amino acid sequence of SEQ ID NO: 76, a L1 comprising the amino acid sequence of SEQ ID NO: 77, and a L2 comprising the amino acid sequence of SEQ ID NO: 75.
- the bispecific antibody EIP0208 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position 368 (EU numbering) of the CH1 H3 is a A; the amino acid at position 407 (EU numbering) of CH1 H3 is a V; and the amino acid
- the bispecific antibody EIP0208 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; the amino acid at position 170 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (
- the bispecific antibody EIP0208 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0208 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 82, a H2 comprising the amino acid sequence of SEQ ID NO: 80, a L1 comprising the amino acid sequence of SEQ ID NO: 81, and a L2 comprising the amino acid sequence of SEQ ID NO: 79.
- the bispecific antibody EIP0294 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K and the amino acid at position 179 (EU numbering) of the CL1 is a E; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position 368 (EU numbering) of the CH1 H3 is a A; the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the
- the bispecific antibody EIP0294 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (
- the bispecific antibody EIP0294 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0294 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 86, a H2 comprising the amino acid sequence of SEQ ID NO: 84, a L1 comprising the amino acid sequence of SEQ ID NO: 85, and a L2 comprising the amino acid sequence of SEQ ID NO: 83.
- the bispecific antibody EIP0295 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position 368 (EU numbering) of the CH1 H3 is a A; the amino acid at position 407 (EU numbering) of CH1 H3 is a V; and the amino acid
- the bispecific antibody EIP0295 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (
- the bispecific antibody EIP0295 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0295 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 90, a H2 comprising the amino acid sequence of SEQ ID NO: 88, a L1 comprising the amino acid sequence of SEQ ID NO: 89, and a L2 comprising the amino acid sequence of SEQ ID NO: 87.
- the bispecific antibody EIP0306 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K and the amino acid at position 179 (EU numbering) of the CL1 is a E; the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 179 (EU numbering) of the CL1 is a E; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366
- the bispecific antibody EIP0306 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (EU
- the bispecific antibody EIP0306 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0306 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 94, a H2 comprising the amino acid sequence of SEQ ID NO: 92, a L1 comprising the amino acid sequence of SEQ ID NO: 93, and a L2 comprising the amino acid sequence of SEQ ID NO: 91.
- the bispecific antibody EIP0307 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position 368 (EU numbering) of the CH1 H3 is a A; the amino acid at position 407 (EU numbering) of CH1 H3 is a V; and the amino acid
- the bispecific antibody EIP0307 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (EU
- the bispecific antibody EIP0307 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0307 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 98, a H2 comprising the amino acid sequence of SEQ ID NO: 96, a L1 comprising the amino acid sequence of SEQ ID NO: 97, and a L2 comprising the amino acid sequence of SEQ ID NO: 95.
- the bispecific antibody EIP0318 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position
- the bispecific antibody EIP0318 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (EU
- the bispecific antibody EIP0318 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0318 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 102, a H2 comprising the amino acid sequence of SEQ ID NO: 100, a L1 comprising the amino acid sequence of SEQ ID NO: 101, and a L2 comprising the amino acid sequence of SEQ ID NO: 99.
- the bispecific antibody EIP0340 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position 368 (EU numbering) of the CH1 H3 is a A; the amino acid at position 407 (EU numbering) of CH1 H3 is a V; and the amino acid
- the bispecific antibody EIP0340 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; the amino acid at position 136 (EU numbering) of the CH2 H1 is a C and the amino acid at position 114 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (
- the bispecific antibody EIP0340 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 14, a VH2 comprising the amino acid sequence of SEQ ID NO: 4, a VL1 comprising the amino acid sequence of SEQ ID NO: 23, and a VL2 comprising the amino acid sequence of SEQ ID NO: 3.
- the bispecific antibody EIP0340 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 106, a H2 comprising the amino acid sequence of SEQ ID NO: 104, a L1 comprising the amino acid sequence of SEQ ID NO: 105, and a L2 comprising the amino acid sequence of SEQ ID NO: 103.
- the bispecific antibody EIP0342 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position 368 (EU numbering) of the CH1 H3 is a A; the amino acid at position 407 (EU numbering) of CH1 H3 is a V; and the amino acid
- the bispecific antibody EIP0342 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (
- the bispecific antibody EIP0342 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 14, a VH2 comprising the amino acid sequence of SEQ ID NO: 4, a VL1 comprising the amino acid sequence of SEQ ID NO: 23, and a VL2 comprising the amino acid sequence of SEQ ID NO: 3.
- the bispecific antibody EIP0342 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 110, a H2 comprising the amino acid sequence of SEQ ID NO: 108, a L1 comprising the amino acid sequence of SEQ ID NO: 109, and a L2 comprising the amino acid sequence of SEQ ID NO: 107.
- the bispecific antibody EIP0354 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; the amino acid at position 185 (EU numbering) of the CH1 H1 is a K and the amino acid at position 137 (EU numbering) of the CL1 is a D; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position 368 (EU numbering) of the CH1 H3 is a A; the amino acid at position 407 (EU numbering) of CH1 H3 is a V; and the amino acid at
- the bispecific antibody EIP0354 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (
- the bispecific antibody EIP0354 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 14, a VH2 comprising the amino acid sequence of SEQ ID NO: 4, a VL1 comprising the amino acid sequence of SEQ ID NO: 23, and a VL2 comprising the amino acid sequence of SEQ ID NO: 3.
- the bispecific antibody EIP0354 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 114, a H2 comprising the amino acid sequence of SEQ ID NO: 112, a L1 comprising the amino acid sequence of SEQ ID NO: 113, and a L2 comprising the amino acid sequence of SEQ ID NO: 111.
- the bispecific antibody EIP0356 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; the amino acid at position 145 (EU numbering) of the CH1 H1 is a S and the amino acid at position 180 (EU numbering) of the CL1 is a E; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (Kabat numbering) of the VH1 is a D and the amino acid
- the bispecific antibody EIP0356 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; the amino acid at position 170 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (
- the bispecific antibody EIP0356 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 14, a VH2 comprising the amino acid sequence of SEQ ID NO: 4, a VL1 comprising the amino acid sequence of SEQ ID NO: 23, and a VL2 comprising the amino acid sequence of SEQ ID NO: 3.
- the bispecific antibody EIP0356 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 118, a H2 comprising the amino acid sequence of SEQ ID NO: 116, a L1 comprising the amino acid sequence of SEQ ID NO: 117, and a L2 comprising the amino acid sequence of SEQ ID NO: 115.
- the bispecific antibody EIP0367 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 147 (EU numbering) of the CH1 H1 is a D and the amino acid at position 131 (EU numbering) of the CL1 is a K; the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a D; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position
- the bispecific antibody EIP0367 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 137 (EU numbering) of the CL2 is a K and the amino acid at position 138 (EU numbering) of the CL2 is a R; the amino acid at position 170 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (
- the bispecific antibody EIP0367 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0367 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 122, a H2 comprising the amino acid sequence of SEQ ID NO: 120, a L1 comprising the amino acid sequence of SEQ ID NO: 121, and a L2 comprising the amino acid sequence of SEQ ID NO: 119.
- the bispecific antibody EIP0377 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 147 (EU numbering) of the CH1 H1 is a D and the amino acid at position 145 (EU numbering) of the CH1 H1 is a S and the amino acid at position 131 (EU numbering) of the CL1 is a K; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position 368 (EU numbering) of the CH1 H3 is a A; the amino acid
- the bispecific antibody EIP0377 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; the amino acid at position 170 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (
- the bispecific antibody EIP0377 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0377 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 126, a H2 comprising the amino acid sequence of SEQ ID NO: 124, a L1 comprising the amino acid sequence of SEQ ID NO: 125, and a L2 comprising the amino acid sequence of SEQ ID NO: 123.
- the bispecific antibody EIP0404 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a D and the amino acid at position 38 (Kabat numbering) of the VL1 is a K; the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position
- the bispecific antibody EIP0404 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a K and the amino acid at position 38 (Kabat numbering) of the VL2 is a D; the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; the amino acid at position 136 (EU numbering) of the CH2 H1 is a C and the amino acid at position 114 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (EU
- the bispecific antibody EIP0404 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 24, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0404 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 130, a H2 comprising the amino acid sequence of SEQ ID NO: 128, a L1 comprising the amino acid sequence of SEQ ID NO: 129, and a L2 comprising the amino acid sequence of SEQ ID NO: 127.
- the bispecific antibody EIP0406 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a E; the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; the amino acid at position 185 (EU numbering) of the CH1 H1 is a E and the amino acid at position 137 (EU numbering) of the CL1 is a K; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position
- the bispecific antibody EIP0406 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; the amino acid at position 136 (EU numbering) of the CH2 H1 is a C and the amino acid at position 114 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (
- the bispecific antibody EIP0406 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 24, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0406 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 134, a H2 comprising the amino acid sequence of SEQ ID NO: 132, a L1 comprising the amino acid sequence of SEQ ID NO: 133, and a L2 comprising the amino acid sequence of SEQ ID NO: 131.
- the bispecific antibody EIP0473 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 147 (EU numbering) of the CH1 H1 is a D and the amino acid at position 131 (EU numbering) of the CL1 is a K; the amino acid at position 185 (EU numbering) of the CH1 H1 is a D and the amino acid at position 137 (EU numbering) of the CL1 is a K; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is a C; the amino acid at position 366 (EU numbering) of the CH1 H3 is a S; the amino acid at position
- the bispecific antibody EIP0473 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 187 (EU numbering) of the CH2 H1 is a D and the amino acid at position 138 (EU numbering) of the CL2 is a K; the amino acid at position 171 (EU numbering) of the CH2 H1 is a C and the amino acid at position 162 (EU numbering) of the CL2 is a C; the amino acid at position 220 (EU numbering) in the H2H is a S and the amino acid at position 214 (EU numbering) of the CL2 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (
- the bispecific antibody EIP0473 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 4, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 3.
- the bispecific antibody EIP0473 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 138, a H2 comprising the amino acid sequence of SEQ ID NO: 136, a L1 comprising the amino acid sequence of SEQ ID NO: 137, and a L2 comprising the amino acid sequence of SEQ ID NO: 135.
- the bispecific antibody EIP0598 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 170 (EU numbering) of the CH1 H1 is a S and the amino acid at position 131 (EU numbering) of the CL1 is a D; the amino acid at position 173 (EU numbering) of the CH1 H1 is a C and the amino acid at position 162 (EU numbering) of the CL1 is a C; the amino acid at position 220 (EU numbering) of the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is an S; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU
- the bispecific antibody EIP0598 comprises the following amino acids substitutions in the H2 and L2: the amino acid at position 39 (Kabat numbering) of the VH2 is a D and the amino acid at position 38 (Kabat numbering) of the VL2 is a K; the amino acid at position 147 (EU numbering) of the CH2 H1 is a D and the amino acid at position 180 (EU numbering) of the CL2 is a R; the amino acids at positions 234, 235, and 237 (EU numbering) of the H2H are an A; the amino acid at position 354 (EU numbering) of the CH2 H3 is a C; the amino acid at position 366 (EU numbering) of the CH2 H3 is a W; and the amino acid at position 447 (EU numbering) of the CH2 H3 is deleted, when numbered in accordance with H2 amino acid sequence of SEQ NO: 437 and L2 amino acid sequence of SEQ
- the bispecific antibody EIP0598 comprises a VH1 comprising the amino acid sequence of SEQ ID NO: 13, a VH2 comprising the amino acid sequence of SEQ ID NO: 2, a VL1 comprising the amino acid sequence of SEQ ID NO: 22, and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- the bispecific antibody EIP0598 comprises a H1 comprising the amino acid sequence of SEQ ID NO: 142, a H2 comprising the amino acid sequence of SEQ ID NO: 140, a L1 comprising the amino acid sequence of SEQ ID NO: 141, and a L2 comprising the amino acid sequence of SEQ ID NO: 139.
- any one of the bispecific antibodies shown above in Table 13 can be further modified by substituting any one of the anti-CD3 ⁇ antigen binding regions with any one of the anti-CD3 ⁇ binding regions shown in Tables 7-9.
- the anti-CD3 ⁇ antigen binding regions of bispecific antibody “EIP0205” can be substituted with any one of the anti-CD3 ⁇ binding regions shown in Tables 7-9 to produce the bispecific antibodies of the invention.
- Exemplary antibodies are shown in Table 14. The underlined sequences are CDR sequence according to Kabat and the bolded sequences are CDR sequences according to Chothia.
- Table 14 Exemplary Bispecific Antibodies that bind to CD3 ⁇ and ULBP2/5/6
- exemplary, CD3 ⁇ x ULBP2/5/6 bispecific antibodies of the invention include EIP0527, EIP0624, EIP0486, EIP0626, EIP0483, EIP0623, EIP0621, EIP0625, EIP0622, EIP0525.
- Bispecific antibodies EIP0527, EIP0624, EIP0486, EIP0626, EIP0483, EIP0623, EIP0621, EIP0625, EIP0622, and EIP0525 comprise the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; the amino acid at position 173 (EU numbering) of the CH1 H1 is a C and the amino acid at position 162 (EU numbering) of the CL1 is a C; the amino acid at position 220 (EU numbering) of the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is a S; the amino acids at positions 23
- Bispecific antibodies EIP0527, EIP0624, EIP0486, EIP0626, EIP0483, EIP0623, EIP0621, EIP0625, EIP0622, and EIP0525 have a second antigen binding domain that binds ULBP2/5/6 comprising a VH2, comprising VH2 CDR1 having the amino acid sequence of SEQ ID NO: 5; a VH2 CDR2 having the amino acid sequence of SEQ ID NO: 7; and a VH2 CDR3 having the amino acid sequence of SEQ ID NO: 9; and a VL2, comprising a VL2 CDR1 having the amino acid sequence of SEQ ID NO: 10; a VL2 CDR2 having the amino acid sequence of SEQ ID NO: 11; and a VL2 CDR3 having the amino acid sequence of SEQ ID NO: 12.
- Bispecific antibodies EIP0527, EIP0624, EIP0486, EIP0626, EIP0483, EIP0623, EIP0621, EIP0625, EIP0622, and EIP0525 comprise a VH2 comprising the amino acid sequence of SEQ ID NO: 2; and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- Bispecific antibodies EIP0527, EIP0624, EIP0486, EIP0626, EIP0483, EIP0623, EIP0621, EIP0625, EIP0622, and EIP0525 have a H2 comprising the amino acid sequence of SEQ ID NO: 68; and a L2 comprising the amino acid sequence of SEQ ID NO: 67.
- the bispecific antibody EIP0527 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 37; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 46.
- the bispecific antibody EIP0527 comprises a VH1 having the amino acid sequence of SEQ ID NO: 13 and a VL1 having the amino acid sequence of SEQ ID NO: 25. In some embodiments, the bispecific antibody EIP0527 comprises a H1 having the amino acid sequence of SEQ ID NO: 146 and a L1 having the amino acid sequence of SEQ ID NO: 145.
- the bispecific antibody EIP0624 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 38; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 47.
- the bispecific antibody EIP0624 comprises a VH1 having the amino acid sequence of SEQ ID NO: 15 and a VL1 having the amino acid sequence of SEQ ID NO: 26. In some embodiments, the bispecific antibody EIP0624 comprises a H1 having the amino acid sequence of SEQ ID NO: 150 and a L1 having the amino acid sequence of SEQ ID NO: 149.
- the bispecific antibody EIP0486 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 37; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 44; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 45.
- the bispecific antibody EIP0486 comprises a VH1 having the amino acid sequence of SEQ ID NO: 13 and a VL1 having the amino acid sequence of SEQ ID NO: 27. In some embodiments, the bispecific antibody EIP0486 comprises a H1 having the amino acid sequence of SEQ ID NO: 154 and a L1 having the amino acid sequence of SEQ ID NO: 153.
- the bispecific antibody EIP0626 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 39; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 47.
- the bispecific antibody EIP0626 comprises a VH1 having the amino acid sequence of SEQ ID NO: 16 and a VL1 having the amino acid sequence of SEQ ID NO: 26. In some embodiments, the bispecific antibody EIP0626 comprises a H1 having the amino acid sequence of SEQ ID NO: 158 and a L1 having the amino acid sequence of SEQ ID NO: 157.
- the bispecific antibody EIP0483 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 30; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 37; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 45.
- the bispecific antibody EIP0483 comprises a VH1 having the amino acid sequence of SEQ ID NO: 17 and a VL1 having the amino acid sequence of SEQ ID NO: 22. In some embodiments, the bispecific antibody EIP0483 comprises a H1 having the amino acid sequence of SEQ ID NO: 162 and a L1 having the amino acid sequence of SEQ ID NO: 161.
- the bispecific antibody EIP0623 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 35; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 38; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 47.
- the bispecific antibody EIP0623 comprises a VH1 having the amino acid sequence of SEQ ID NO: 18 and a VL1 having the amino acid sequence of SEQ ID NO: 26. In some embodiments, the bispecific antibody EIP0623 comprises a H1 having the amino acid sequence of SEQ ID NO: 166 and a L1 having the amino acid sequence of SEQ ID NO: 165.
- the bispecific antibody EIP0621 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 40; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 47.
- the bispecific antibody EIP0621 comprises a VH1 having the amino acid sequence of SEQ ID NO: 19 and a VL1 having the amino acid sequence of SEQ ID NO: 26. In some embodiments, the bispecific antibody EIP0621 comprises a H1 having the amino acid sequence of SEQ ID NO: 170 and a L1 having the amino acid sequence of SEQ ID NO: 169.
- the bispecific antibody EIP0625 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 35; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 38; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 45.
- the bispecific antibody EIP0625 comprises a VH1 having the amino acid sequence of SEQ ID NO: 18 and a VL1 having the amino acid sequence of SEQ ID NO: 22. In some embodiments, the bispecific antibody EIP0625 comprises a H1 having the amino acid sequence of SEQ ID NO: 174 and a L1 having the amino acid sequence of SEQ ID NO: 173.
- the bispecific antibody EIP0622 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 41; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 47.
- the bispecific antibody EIP0622 comprises a VH1 having the amino acid sequence of SEQ ID NO: 20 and a VL1 having the amino acid sequence of SEQ ID NO: 26. In some embodiments, the bispecific antibody EIP0622 comprises a H1 having the amino acid sequence of SEQ ID NO: 178 and a L1 having the amino acid sequence of SEQ ID NO: 177.
- the bispecific antibody EIP0525 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 31; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 37; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 45.
- the bispecific antibody EIP0525 comprises a VH1 having the amino acid sequence of SEQ ID NO: 21 and a VL1 having the amino acid sequence of SEQ ID NO: 22. In some embodiments, the bispecific antibody EIP0525 comprises a H1 having the amino acid sequence of SEQ ID NO: 182 and a L1 having the amino acid sequence of SEQ ID NO: 181.
- exemplary, CD3 ⁇ x ULBP2/5/6 bispecific antibodies of the invention include EIP0630, EIP0540, EIP0628, EIP0542, EIP0627, EIP0515, EIP0477, EIP0541, EIP0513, EIP0629.
- bispecific antibodies EIP0630, EIP0540, EIP0628, EIP0542, EIP0627, EIP0515, EIP0477, EIP0541, EIP0513, and EIP0629 have the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 170 (EU numbering) of the CH1 H1 is a S and the amino acid at position 131 (EU numbering) of the CL1 is a D; the amino acid at position 173 (EU numbering) of the CH1 H1 is a C and the amino acid at position 162 (EU numbering) of the CL1 is a C; the amino acid at position 220 (EU numbering) of the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is an S; the amino acids at positions 234,
- Bispecific antibodies EIP0630, EIP0540, EIP0628, EIP0542, EIP0627, EIP0515, EIP0477, EIP0541, EIP0513, and EIP0629 have a second antigen binding domain that binds ULBP2/5/6 comprising a VH2, having VH2 CDR1 having the amino acid sequence of SEQ ID NO: 5; a VH2 CDR2 comprising the amino acid sequence of SEQ ID NO: 7; and a VH2 CDR3 having the amino acid sequence of SEQ ID NO: 9; and a VL2, having VL2 CDR1 having the amino acid sequence of SEQ ID NO: 10; a VL2 CDR2 having the amino acid sequence of SEQ ID NO: 11; and a VL2 CDR3 having the amino acid sequence of SEQ ID NO: 12.
- Bispecific antibodies EIP0630, EIP0540, EIP0628, EIP0542, EIP0627, EIP0515, EIP0477, EIP0541, EIP0513, and EIP0629 have a VH2 having the amino acid sequence of SEQ ID NO: 2; and a VL2 having the amino acid sequence of SEQ ID NO: 1.
- Bispecific antibodies EIP0630, EIP0540, EIP0628, EIP0542, EIP0627, EIP0515, EIP0477, EIP0541, EIP0513, and EIP0629 have a H2 having the amino acid sequence of SEQ ID NO: 140; and a L2 having the amino acid sequence of SEQ ID NO: 139.
- the bispecific antibody EIP0630 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 37; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 46.
- the bispecific antibody EIP0630 comprises a VH1 having the amino acid sequence of SEQ ID NO: 13 and a VL1 having the amino acid sequence of SEQ ID NO: 25. In some embodiments, the bispecific antibody EIP0630 comprises a H1 having the amino acid sequence of SEQ ID NO: 186 and a L1 having the amino acid sequence of SEQ ID NO: 185.
- the bispecific antibody EIP0540 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 38; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 47.
- the bispecific antibody EIP0540 comprises a VH1 having the amino acid sequence of SEQ ID NO: 15 and a VL1 having the amino acid sequence of SEQ ID NO: 26. In some embodiments, the bispecific antibody EIP0540 comprises a H1 having the amino acid sequence of SEQ ID NO: 190 and a L1 having the amino acid sequence of SEQ ID NO: 189.
- the bispecific antibody EIP0628 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 37; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 44; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 45.
- the bispecific antibody EIP0628 comprises a VH1 having the amino acid sequence of SEQ ID NO: 13 and a VL1 having the amino acid sequence of SEQ ID NO: 27. In some embodiments, the bispecific antibody EIP0628 comprises a H1 having the amino acid sequence of SEQ ID NO: 194 and a L1 having the amino acid sequence of SEQ ID NO: 193.
- the bispecific antibody EIP0542 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 39; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 47.
- the bispecific antibody EIP0542 comprises a VH1 having the amino acid sequence of SEQ ID NO: 16 and a VL1 having the amino acid sequence of SEQ ID NO: 26. In some embodiments, the bispecific antibody EIP0542 comprises a H1 having the amino acid sequence of SEQ ID NO: 198 and a L1 having the amino acid sequence of SEQ ID NO: 197.
- the bispecific antibody EIP0627 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 30; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 37; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 45.
- the bispecific antibody EIP0627 comprises a VH1 having the amino acid sequence of SEQ ID NO: 17 and a VL1 having the amino acid sequence of SEQ ID NO: 22. In some embodiments, the bispecific antibody EIP0627 comprises a H1 having the amino acid sequence of SEQ ID NO: 202 and a L1 having the amino acid sequence of SEQ ID NO: 201.
- the bispecific antibody EIP0515 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 35; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 38; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 47.
- the bispecific antibody EIP0515 comprises a VH1 having the amino acid sequence of SEQ ID NO: 18 and a VL1 having the amino acid sequence of SEQ ID NO: 26. In some embodiments, the bispecific antibody EIP0515 comprises a H1 having the amino acid sequence of SEQ ID NO: 206 and a L1 having the amino acid sequence of SEQ ID NO: 205.
- the bispecific antibody EIP0477 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 40; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 47.
- the bispecific antibody EIP0477 comprises a VH1 having the amino acid sequence of SEQ ID NO: 19 and a VL1 having the amino acid sequence of SEQ ID NO: 26. In some embodiments, the bispecific antibody EIP0477 comprises a H1 having the amino acid sequence of SEQ ID NO: 210 and a L1 having the amino acid sequence of SEQ ID NO: 209.
- the bispecific antibody EIP0541 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 35; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 38; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 45.
- the bispecific antibody EIP0541 comprises a VH1 having the amino acid sequence of SEQ ID NO: 18 and a VL1 having the amino acid sequence of SEQ ID NO: 22. In some embodiments, the bispecific antibody EIP0541 comprises a H1 having the amino acid sequence of SEQ ID NO: 214 and a L1 having the amino acid sequence of SEQ ID NO: 213.
- the bispecific antibody EIP0513 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 29; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 41; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 47.
- the bispecific antibody EIP0513 comprises a VH1 having the amino acid sequence of SEQ ID NO: 20 and a VL1 having the amino acid sequence of SEQ ID NO: 26. In some embodiments, the bispecific antibody EIP0513 comprises a H1 having the amino acid sequence of SEQ ID NO: 218 and a L1 having the amino acid sequence of SEQ ID NO: 217.
- the bispecific antibody EIP0629 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 31; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 37; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 45.
- the bispecific antibody EIP0629 comprises a VH1 having the amino acid sequence of SEQ ID NO: 21 and a VL1 having the amino acid sequence of SEQ ID NO: 22. In some embodiments, the bispecific antibody EIP0629 comprises a H1 having the amino acid sequence of SEQ ID NO: 222 and a L1 having the amino acid sequence of SEQ ID NO: 221.
- an exemplary CD3 ⁇ x ULBP2/5/6 bispecific antibody of the invention includes EIP0820.
- bispecific antibody EIP0820 comprises the following amino acids substitutions in the H1 and L1: the amino acid at position 39 (Kabat numbering) of the VH1 is a K and the amino acid at position 38 (Kabat numbering) of the VL1 is a D; the amino acid at position 147 (EU numbering) of the CH1 H1 is a K and the amino acid at position 131 (EU numbering) of the CL1 is a D; the amino acid at position 173 (EU numbering) of the CH1 H1 is a C and the amino acid at position 162 (EU numbering) of the CL1 is a C; the amino acid at position 220 (EU numbering) of the H1H is a S and the amino acid at position 214 (EU numbering) of the CL1 is a S; the amino acids at positions 234, 235, and 237 (EU numbering) in the H1H are an A; the amino acid at position 349 (EU numbering) of the CH1 H3 is
- bispecific antibody EIP0820 has a second antigen binding domain that binds ULBP2/5/6 comprising a VH2, comprising VH2 CDR1 having the amino acid sequence of SEQ ID NO: 5; a VH2 CDR2 having the amino acid sequence of SEQ ID NO: 7; and a VH2 CDR3 having the amino acid sequence of SEQ ID NO: 9; and a VL2, comprising a VL2 CDR1 having the amino acid sequence of SEQ ID NO: 10; a VL2 CDR2 having the amino acid sequence of SEQ ID NO: 11; and a VL2 CDR3 having the amino acid sequence of SEQ ID NO: 12.
- bispecific antibody EIP0820 comprises a VH2 comprising the amino acid sequence of SEQ ID NO: 2; and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- bispecific antibody EIP0820 comprises a VH2 comprising the amino acid sequence of SEQ ID NO: 629; and a VL2 comprising the amino acid sequence of SEQ ID NO: 1.
- bispecific antibody EIP0820 comprises a H2 comprising the amino acid sequence of SEQ ID NO: 621; and a L2 comprising the amino acid sequence of SEQ ID NO: 67.
- the bispecific antibody EIP0820 comprises a first antigen binding domain that binds CD3 ⁇ comprising a VH1, comprising a VH1 CDR1 having the amino acid sequence of SEQ ID NO: 30; a VH1 CDR2 having the amino acid sequence of SEQ ID NO: 34; and a VH1 CDR3 having the amino acid sequence of SEQ ID NO: 37; and a VL1, comprising a VL1 CDR1 having the amino acid sequence of SEQ ID NO: 42; a VL1 CDR2 having the amino acid sequence of SEQ ID NO: 43; and a VL1 CDR3 having the amino acid sequence of SEQ ID NO: 45.
- the bispecific antibody EIP0820 comprises a VH1 having the amino acid sequence of SEQ ID NO: 17 and a VL1 having the amino acid sequence of SEQ ID NO: 22. In some embodiments, the bispecific antibody EIP0820 comprises a H1 having the amino acid sequence of SEQ ID NO: 622 and a L1 having the amino acid sequence of SEQ ID NO: 69.
- exemplary CD3 ⁇ x ULBP2/5/6 bispecific antibodies of the present disclosure comprise an amino acid at position 446 (EU numbering) and/or at position 447 (EU numbering) of the CH1 H3 and/or of the CH2 H3 .
- the amino acid at position 446 (EU numbering) is a G. In some embodiments, wherein the exemplary bispecific antibodies comprise an amino acid at position 446 (EU numbering) of the CH1 H3 and/or of the CH2 H3 , the bispecific antibodies further comprise an amino acid at position 447 (EU numbering) of the CH1 H3 and/or of the CH2H3.
- exemplary bispecific antibodies comprise an amino acid at position 447 (EU numbering) of the CH1 H3 and/or of the CH2 H3
- the amino acid at position 447 (EU numbering) is a K.
- exemplary CD3 ⁇ x ULBP2/5/6 bispecific antibodies of the present disclosure comprise an amino acid at position 446 (EU numbering) of the CH1 H3 or CH2 H3 .
- the bispecific antibodies comprise an amino acid at position 446 (EU numbering) of the CH1 H3 and CH2 H3 .
- the bispecific antibodies comprise an amino acid at position 446 (EU numbering) of the CH1 H3.
- the bispecific antibodies comprise an amino acid at position 446 (EU numbering) of the CH2 H3 .
- the amino acid at position 446 (EU numbering) is a G.
- the bispecific antibodies comprise an amino acid at position 446 (EU numbering) of the CH1 H3
- the amino acid at position 446 (EU numbering) is a G.
- the bispecific antibodies comprise an amino acid at position 446 (EU numbering) of the CH2 H3
- the amino acid at position 446 (EU numbering) is a G.
- the amino acid at position 446 (EU numbering) of the CH1 H3 and CH2 H3 is a G.
- exemplary CD3 ⁇ x ULBP2/5/6 bispecific antibodies of the comprise an amino acid at position 447 (EU numbering) of the CH1 H3 and/or of the CH2 H3 .
- the bispecific antibodies comprise an amino acid at position 447 (EU numbering) of the CH1 H3 or of the CH2 H3 .
- the bispecific antibodies comprise an amino acid at position 447 (EU numbering) of the CH1 H3 and of the CH2 H3 . In some embodiments, the bispecific antibodies comprise an amino acid at position 447 (EU numbering) of the CH1 H3 . In some embodiments, the bispecific antibodies comprise an amino acid at position 447 (EU numbering) of the CH2 H3 . [0499] In some embodiments, wherein CD3 ⁇ x ULBP2/5/6 bispecific antibodies comprise an amino acid at position 447 (EU numbering) of the CH1 H3 and/or of the CH2 H3 , the amino acid at position 447 (EU numbering) is a K.
- the amino acid at position 447 (EU numbering) is a K. In some embodiments, wherein the bispecific antibodies comprise an amino acid at position 447 (EU numbering) of the CH2 H3 , the amino acid at position 447 (EU numbering) is a K.
- the amino acid at position 447 (EU numbering) is a K.
- FUSION PEPTIDES Provided herein is an antibody (e.g. monospecific antibody or bispecific antibody) that has a fusion peptide fused to the N-terminus or the C-terminus of the first heavy chain polypeptide or the second heavy chain polypeptide.
- T cell activation Critical to the initial T cell response is the capacity for T cells to detect foreign and mutated proteins through their T cell receptor.
- This response often referred to as signal 1 of T cell activation, occurs when the T cell receptor engages a cell that displays a foreign or mutated protein fragment or antigen in a specific protein complex called the Major Histocompatibility Complex I (MHCI).
- MHCI Major Histocompatibility Complex I
- the activation of the T cell receptor is by itself both activating and auto-regulatory to T cells. Strong binding of the TCR to an MHCI complex creates chronic activation of the TCR.
- This form of signal is associated with T cells that are reactive to self-antigens. T cells are programed to inactivate when they experience this form activation.
- T cell cytokine activation is important in T cell transitions, either from non-dividing to a state of rapid cell division or from one phenotypic state to another.
- T cell cytokine receptors bind to cytokines that are produced by immune and non-immune cells and depending on the cytokine and the state of the T cell at the time of receiving the cytokine signal can induce cell proliferation, can sustain vitality, or can induce differentiation of T cells into a specialized cell state appropriate for sustained activation or inactivation following infection.
- cytokines which can induce na ⁇ ve T cells to proliferate and promote T cell differentiation into memory T cells.
- cytokines include but are not limited to IL-2, IL-7, IL-10, IL-12, IL-15, IL-18 and IL-21.
- Costimulatory receptor activation referred to as signal 2 provides a context specific cell-to-cell reinforcement of T activation. The most recognized form of costimulation occurs when T cells interact with activated antigen presenting cells through the T cell costimulatory receptor CD28 with CD80 and CD86 ligands found on APCs.
- Costimulatory ligands include but are not limited to CD48, CD58, CD86, TNFSF9, OX40L, 4-1BBL, GITL, CD70, CD80, MR1, TNFSF4, ICOSL or ICOSLG.
- CD58 is advantageous over other costimulatory ligands in that it is the primary costimulatory pathway available at the tumor site as tumor infiltrating T lymphocytes often lose expression of other costimulatory receptors like CD28, or due to the low immunogenicity of tumor cells, tumor cells do not sufficiently activate T cell, thus limiting the potential of inducible costimulatory receptors like 41BB.
- the anti-CD3 ⁇ antibodies of the disclosure induce varying levels of T cell receptor activation that confer alteration in T cell vitality and cytokine production. Accordingly, a fusion of the costimulatory ligand CD58 to the anti-CD3 ⁇ bispecific antibody provides integrated costimulatory T cell activation for optimal T cell activation.
- the bispecific antibody has a peptide fused to the N-terminus of the first heavy chain polypeptide (H1). In some embodiments, the bispecific antibody has a peptide fused to the C-terminus of the first heavy chain polypeptide (H1). In some embodiments, the bispecific antibody has a polypeptide fused to the N-terminus of the second heavy chain polypeptide (H2). In some embodiments, the bispecific antibody has a peptide fused to the C-terminus of the second heavy chain polypeptide (H2). Exemplary peptides include but are not limited to IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 or portions thereof.
- Exemplary peptides include but are not limited to CD48, CD58, CD86, TNFSF9, OX40L, 4-1BBL, GITL, CD70, CD80, MR1, TNFSF4, ICOSL, ICOSLG or portions thereof.
- Exemplary peptide sequences that are fused to the bispecific antibodies include but are not limited to those listed in Table 15.1. [0511] Table 15.1. Exemplary Fusion Peptide Sequences DLCFLKRLLQEIKTCWNKILMGTKEH [0512]
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a CD58 fusion peptide comprising any one of the CD58 sequences of Table 15.2.
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a CD58 fusion peptide comprising any one of SEQ ID NOs: 624-628.
- the polypeptide is fused directly to the bispecific antibody. In some embodiments, the polypeptide is fused indirectly through a linker. In some embodiments, the bispecific antibody fused with a peptide comprises a linker sequence. Exemplary linker sequences include but are not limited to those listed in Table 16.1. [0514] Table 16.1 Exemplary Linker Sequences [0515] In some embodiments, the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a CD58 fusion peptide (SEQ ID NO: 49) fused indirectly at the C-terminus of the first heavy chain polypeptide (H1) using linker-1 (SEQ ID NO: 52).
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a CD58v* fusion peptide (SEQ ID NO: 50) fused indirectly at the C-terminus of the first heavy chain polypeptide (H1) using linker-1 (SEQ ID NO: 52).
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a IL-7 fusion peptide (SEQ ID NO: 51) fused indirectly at the C-terminus of the first heavy chain polypeptide (H1) using linker-1 (SEQ ID NO: 52).
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a CD58 fusion peptide (SEQ ID NO: 49) fused indirectly at the C-terminus of the first heavy chain polypeptide (H1) using linker-2 (SEQ ID NO: 53).
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a CD58v* fusion peptide (SEQ ID NO: 50) fused indirectly at the C terminus of the first heavy chain polypeptide (H1) using linker-2 (SEQ ID NO: 53).
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a IL-7 fusion peptide (SEQ ID NO: 51) fused indirectly at the C-terminus of the first heavy chain polypeptide (H1) using linker-2 (SEQ ID NO: 53).
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a CD58 fusion peptide (SEQ ID NO: 49) fused indirectly at the C-terminus of the first heavy chain polypeptide (H1) using linker-3 (SEQ ID NO: 54).
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a CD58v* fusion peptide (SEQ ID NO: 50) fused indirectly at the C-terminus of the first heavy chain polypeptide (H1) using linker-3 (SEQ ID NO: 54).
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a IL-7 fusion peptide (SEQ ID NO: 51) fused indirectly at the C-terminus of the first heavy chain polypeptide (H1) using linker-3 (SEQ ID NO: 54).
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a hinge sequence comprising any one of the linker sequences of Table 16.2.
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a linker sequence comprising any one of SEQ ID NOs: 530-552.
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a linker sequence comprising any one of the linker sequences of Table 16.3.
- the CD3 x ULBP2/5/6 bispecific antibodies of the invention have a linker sequence comprising any one of SEQ ID NOs: 553-606.
- CD3 x ULBP2/5/6 bispecific antibodies having a CD58, CD58v* and IL- 7 fusion are shown in Table 17 and Table 18. [0523] Table 17. Exemplary Bispecific Fusion Molecules
- Table 18 Exemplary Bispecific Antibodies that bind to CD3 ⁇ and ULBP2/5/6 with a C-terminus fusion peptide
- Table 19 Exemplary Bispecific Antibodies that bind to CD3 ⁇ and a Second Antigen (Italics – Variable region, Italics and underline – Kabat CDR definition, Italics and bold –
- the bispecific antibody EIP0373 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 450, a H2 comprising the amino acid sequence of SEQ ID NO: 451, a L1 comprising the amino acid sequence of SEQ ID NO: 452, and a H1 comprising the amino acid sequence of SEQ ID NO: 453.
- the bispecific antibody EIP0535 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 454, a H2 comprising the amino acid sequence of SEQ ID NO: 455, a L1 comprising the amino acid sequence of SEQ ID NO: 456, and a H1 comprising the amino acid sequence of SEQ ID NO: 457.
- the bispecific antibody EIP0506 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 458, a H2 comprising the amino acid sequence of SEQ ID NO: 459, a L1 comprising the amino acid sequence of SEQ ID NO: 460, and a H1 comprising the amino acid sequence of SEQ ID NO: 461.
- the bispecific antibody EIP0534 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 462, a H2 comprising the amino acid sequence of SEQ ID NO: 463, a L1 comprising the amino acid sequence of SEQ ID NO: 464, and a H1 comprising the amino acid sequence of SEQ ID NO: 465.
- the bispecific antibody EIP0702 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 466, a H2 comprising the amino acid sequence of SEQ ID NO: 467, a L1 comprising the amino acid sequence of SEQ ID NO: 468, and a H1 comprising the amino acid sequence of SEQ ID NO: 469.
- the bispecific antibody EIP0703 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 470, a H2 comprising the amino acid sequence of SEQ ID NO: 471, a L1 comprising the amino acid sequence of SEQ ID NO: 472, and a H1 comprising the amino acid sequence of SEQ ID NO: 473.
- the bispecific antibody EIP0765 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 474, a H2 comprising the amino acid sequence of SEQ ID NO: 475, a L1 comprising the amino acid sequence of SEQ ID NO: 476, and a H1 comprising the amino acid sequence of SEQ ID NO: 477.
- the bispecific antibody EIP0766 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 478, a H2 comprising the amino acid sequence of SEQ ID NO: 479, a L1 comprising the amino acid sequence of SEQ ID NO: 480, and a H1 comprising the amino acid sequence of SEQ ID NO: 481.
- the bispecific antibody EIP0990 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 482, a H2 comprising the amino acid sequence of SEQ ID NO: 483, a L1 comprising the amino acid sequence of SEQ ID NO: 484, and a H1 comprising the amino acid sequence of SEQ ID NO: 485.
- the bispecific antibody EIP0991 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 486, a H2 comprising the amino acid sequence of SEQ ID NO: 487, a L1 comprising the amino acid sequence of SEQ ID NO: 488, and a H1 comprising the amino acid sequence of SEQ ID NO: 489.
- the bispecific antibody EIP0991 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 486, a H2 comprising the amino acid sequence of SEQ ID NO: 487, a L1 comprising the amino acid sequence of SEQ ID NO: 488, and a H1 comprising the amino acid sequence of SEQ ID NO: 489.
- the bispecific antibody EIP0992 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 490, a H2 comprising the amino acid sequence of SEQ ID NO: 491, a L1 comprising the amino acid sequence of SEQ ID NO: 492, and a H1 comprising the amino acid sequence of SEQ ID NO: 493.
- the bispecific antibody EIP0993 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 494, a H2 comprising the amino acid sequence of SEQ ID NO: 495, a L1 comprising the amino acid sequence of SEQ ID NO: 496, and a H1 comprising the amino acid sequence of SEQ ID NO: 497.
- the bispecific antibody EIP0869 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 498, a H2 comprising the amino acid sequence of SEQ ID NO: 499, a L1 comprising the amino acid sequence of SEQ ID NO: 500, and a H1 comprising the amino acid sequence of SEQ ID NO: 501.
- the bispecific antibody EIP0870 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 502, a H2 comprising the amino acid sequence of SEQ ID NO: 503, a L1 comprising the amino acid sequence of SEQ ID NO: 504, and a H1 comprising the amino acid sequence of SEQ ID NO: 505.
- the bispecific antibody EIP0871 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 506, a H2 comprising the amino acid sequence of SEQ ID NO: 507, a L1 comprising the amino acid sequence of SEQ ID NO: 508, and a H1 comprising the amino acid sequence of SEQ ID NO: 509.
- the bispecific antibody EIP0872 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 510, a H2 comprising the amino acid sequence of SEQ ID NO: 511, a L1 comprising the amino acid sequence of SEQ ID NO: 512, and a H1 comprising the amino acid sequence of SEQ ID NO: 513.
- the bispecific antibody EIP0546 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 514, a H2 comprising the amino acid sequence of SEQ ID NO: 515, a L1 comprising the amino acid sequence of SEQ ID NO: 516, and a H1 comprising the amino acid sequence of SEQ ID NO: 517.
- the bispecific antibody EIP0607 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 518, a H2 comprising the amino acid sequence of SEQ ID NO: 519, a L1 comprising the amino acid sequence of SEQ ID NO: 520, and a H1 comprising the amino acid sequence of SEQ ID NO: 521.
- the bispecific antibody EIP0614 comprises a L2 comprising the amino acid sequence of SEQ ID NO: 522, a H2 comprising the amino acid sequence of SEQ ID NO: 523, a L1 comprising the amino acid sequence of SEQ ID NO: 524, and a H1 comprising the amino acid sequence of SEQ ID NO: 525.
- the specific antigen which is the target of the immunoglobulin sought, or an epitope thereof may be immobilized on a column to purify the immune specific antibody by immunoaffinity chromatography. Purification of immunoglobulins is discussed, for example, by D. Wilkinson (The Engineer, published by The Engineer, Inc., Philadelphia PA, Vol.14, No.8 (April 17, 2000), pp.25-28). [0551]
- the antibodies of the invention are monoclonal antibodies. Monoclonal antibodies are generated, for example, by using the procedures set forth in the Examples provided herein.
- Antibodies are also generated, e.g., by immunizing BALB/c mice with combinations of cell transfectants expressing high levels of a given target on their surface. Hybridomas resulting from myeloma/B cell fusions are then screened for reactivity to the selected target.
- Monoclonal antibodies are prepared, for example, using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975). In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent.
- the lymphocytes can be immunized in vitro.
- the immunizing agent will typically include the protein antigen, a fragment thereof or a fusion protein thereof.
- peripheral blood lymphocytes are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired.
- the lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, (1986) pp.59- 103).
- Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed.
- the hybridoma cells can be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells.
- a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells.
- the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT)
- the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (“HAT medium”), which substances prevent the growth of HGPRT-deficient cells.
- Preferred immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. More preferred immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, California and the American Type Culture Collection, Manassas, Virginia. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of monoclonal antibodies. (See Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, Marcel Dekker, Inc., New York, (1987) pp.51-63)).
- the culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against the antigen.
- the binding specificity of monoclonal antibodies produced by the hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA).
- RIA radioimmunoassay
- ELISA enzyme-linked immunoabsorbent assay
- the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard, Anal. Biochem., 107:220 (1980).
- the clones can be subcloned by limiting dilution procedures and grown by standard methods. (See Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, (1986) pp.59-103). Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium. Alternatively, the hybridoma cells can be grown in vivo as ascites in a mammal.
- the monoclonal antibodies secreted by the subclones can be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
- Monoclonal antibodies can also be made by recombinant DNA methods, such as those described in U.S. Patent No.4,816,567. DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
- the hybridoma cells of the invention serve as a preferred source of such DNA.
- the DNA can be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
- host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein.
- the DNA also can be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences (see U.S.
- Monoclonal antibodies of the invention include humanized antibodies or human antibodies. These antibodies are suitable for administration to humans without engendering an immune response by the human against the administered immunoglobulin.
- Humanized forms of antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies) that are principally comprised of the sequence of a human immunoglobulin, and contain minimal sequence derived from a non-human immunoglobulin.
- Humanization is performed, e.g., by following the method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534- 1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. (See also U.S. Patent No.5,225,539). In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non- human residues. Humanized antibodies also comprise, e.g., residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences.
- the humanized antibody includes substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non- human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence.
- the humanized antibody optimally also includes at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al., 1986; Riechmann et al., 1988; and Presta, Curr. Op. Struct. Biol., 2:593-596 (1992)).
- Fully human antibodies are antibody molecules in which the entire sequence of both the light chain and the heavy chain, including the CDRs, arise from human genes.
- Monoclonal antibodies can be prepared by using trioma technique; the human B-cell hybridoma technique (see Kozbor, et al., 1983 Immunol Today 4: 72); and the EBV hybridoma technique to produce monoclonal antibodies (see Cole, et al., 1985 In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp.77-96). Monoclonal antibodies may be utilized and may be produced by using human hybridomas (see Cote, et al., 1983.
- human antibodies can also be produced using additional techniques, including phage display libraries. (See Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991)).
- human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S.
- Human antibodies may additionally be produced using transgenic nonhuman animals which are modified so as to produce fully human antibodies rather than the animal’s endogenous antibodies in response to challenge by an antigen.
- transgenic nonhuman animals which are modified so as to produce fully human antibodies rather than the animal’s endogenous antibodies in response to challenge by an antigen.
- the endogenous genes encoding the heavy and light immunoglobulin chains in the nonhuman host have been incapacitated, and active loci encoding human heavy and light chain immunoglobulins are inserted into the host’s genome.
- the human genes are incorporated, for example, using yeast artificial chromosomes containing the requisite human DNA segments. An animal which provides all the desired modifications is then obtained as progeny by crossbreeding intermediate transgenic animals containing fewer than the full complement of the modifications.
- Xenomouse TM is a mouse termed the Xenomouse TM as disclosed in PCT publications WO 96/33735 and WO 96/34096.
- This animal produces B cells which secrete fully human immunoglobulins.
- the antibodies can be obtained directly from the animal after immunization with an immunogen of interest, as, for example, a preparation of a polyclonal antibody, or alternatively from immortalized B cells derived from the animal, such as hybridomas producing monoclonal antibodies.
- the genes encoding the immunoglobulins with human variable regions can be recovered and expressed to obtain the antibodies directly, or can be further modified to obtain analogs of antibodies such as, for example, single chain Fv (scFv) molecules.
- scFv single chain Fv
- U.S. Patent No.5,939,598 An example of a method of producing a nonhuman host, exemplified as a mouse, lacking expression of an endogenous immunoglobulin heavy chain is disclosed in U.S. Patent No.5,939,598. It can be obtained by a method, which includes deleting the J segment genes from at least one endogenous heavy chain locus in an embryonic stem cell to prevent rearrangement of the locus and to prevent formation of a transcript of a rearranged immunoglobulin heavy chain locus, the deletion being effected by a targeting vector containing a gene encoding a selectable marker; and producing from the embryonic stem cell a transgenic mouse whose somatic and germ cells contain the gene encoding the selectable marker.
- U.S. Patent No.5,916,771 One method for producing an antibody of interest, such as a human antibody, is disclosed in U.S. Patent No.5,916,771.
- This method includes introducing an expression vector that contains a nucleotide sequence encoding a heavy chain into one mammalian host cell in culture, introducing an expression vector containing a nucleotide sequence encoding a light chain into another mammalian host cell, and fusing the two cells to form a hybrid cell.
- the hybrid cell expresses an antibody containing the heavy chain and the light chain.
- a method for identifying a clinically relevant epitope on an immunogen and a correlative method for selecting an antibody that binds specifically to the relevant epitope with high affinity are disclosed in PCT publication WO 99/53049.
- the antibody can be expressed by a vector containing a DNA segment encoding the single chain antibody described above.
- These can include vectors, liposomes, naked DNA, adjuvant-assisted DNA. gene gun, catheters, etc.
- Vectors include chemical conjugates such as described in WO 93/64701, which has targeting moiety (e.g., a ligand to a cellular surface receptor), and a nucleic acid binding moiety (e.g., polylysine), viral vector (e.g., a DNA or RNA viral vector), fusion proteins such as described in PCT/US 95/02140 (WO 95/22618) which is a fusion protein containing a target moiety (e.g., an antibody specific for a target cell) and a nucleic acid binding moiety (e.g., a protamine), plasmids, phage, etc.
- the vectors can be chromosomal, non-chromosomal or synthetic.
- Retroviral vectors include moloney murine leukemia viruses.
- DNA viral vectors are preferred.
- These vectors include pox vectors such as orthopox or avipox vectors, herpesvirus vectors such as a herpes simplex I virus (HSV) vector (see Geller, A. I. et al., J. Neurochem, 64:487 (1995); Lim, F., et al., in DNA Cloning: Mammalian Systems, D. Glover, Ed. (Oxford Univ. Press, Oxford England) (1995); Geller, A. I. et al., Proc Natl. Acad.
- HSV herpes simplex I virus
- Avipox virus vectors result in only a short term expression of the nucleic acid.
- Adenovirus vectors, adeno- associated virus vectors and herpes simplex virus (HSV) vectors are preferred for introducing the nucleic acid into neural cells.
- the adenovirus vector results in a shorter term expression (about 2 months) than adeno-associated virus (about 4 months), which in turn is shorter than HSV vectors.
- the particular vector chosen will depend upon the target cell and the condition being treated.
- the introduction can be by standard techniques, e.g., infection, transfection, transduction or transformation.
- Examples of modes of gene transfer include e.g., naked DNA, (Ca) 2 (PO 4 ) 3 precipitation, DEAE dextran, electroporation, protoplast fusion, lipofection, cell microinjection, and viral vectors.
- the vector can be employed to target essentially any desired target cell.
- stereotaxic injection can be used to direct the vectors (e.g., adenovirus, HSV) to a desired location.
- the particles can be delivered by intracerebroventricular (icv) infusion using a minipump infusion system, such as a SynchroMed Infusion System.
- Bispecific antibodies are antibodies that have binding specificities for at least two different antigens. In the present case, one of the binding specificities is for a first target such as CD3 ⁇ or any fragment thereof.
- the second binding target is a disease associated antigen such as ULBP2/5/6 or any fragment thereof.
- a disease associated antigen such as ULBP2/5/6 or any fragment thereof.
- Bispecific and/or monovalent antibodies of the invention can be made using any of a variety of art-recognized techniques, including those disclosed in co-pending application WO 2012/023053, filed August 16, 2011, the contents of which are hereby incorporated by reference in their entirety.
- the methods described in WO 2012/023053 generate bispecific antibodies that are identical in structure to a human immunoglobulin.
- This type of molecule is composed of two copies of a unique heavy chain polypeptide, a first light chain variable region fused to a constant Kappa domain and second light chain variable region fused to a constant Lambda domain.
- Each combining site displays a different antigen specificity to which both the heavy and light chain contribute.
- the light chain variable regions can be of the Lambda or Kappa family and are preferably fused to a Lambda and Kappa constant domains, respectively. This is preferred in order to avoid the generation of non-natural polypeptide junctions.
- bispecific antibodies of the invention by fusing a Kappa light chain variable domain to a constant Lambda domain for a first specificity and fusing a Lambda light chain variable domain to a constant Kappa domain for the second specificity.
- the bispecific antibodies described in WO 2012/023053 are referred to as IgG ⁇ antibodies or “ ⁇ bodies,” a new fully human bispecific IgG format.
- This ⁇ -body format allows the affinity purification of a bispecific antibody that is undistinguishable from a standard IgG molecule with characteristics that are undistinguishable from a standard monoclonal antibody and, therefore, favorable as compared to previous formats.
- An essential step of the method is the identification of two antibody Fv regions (each composed by a variable light chain and variable heavy chain domain) having different antigen specificities that share the same heavy chain variable domain.
- Numerous methods have been described for the generation of monoclonal antibodies and fragments thereof. (See, e.g., Antibodies: A Laboratory Manual, Harlow E, and Lane D, 1988, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, incorporated herein by reference).
- Fully human antibodies are antibody molecules in which the sequence of both the light chain and the heavy chain, including the CDRs 1 and 2, arise from human genes.
- the CDR3 region can be of human origin or designed by synthetic means. Such antibodies are termed “human antibodies”, or “fully human antibodies” herein.
- Human monoclonal antibodies can be prepared by using the trioma technique; the human B-cell hybridoma technique (see Kozbor, et al., 1983 Immunol Today 4: 72); and the EBV hybridoma technique to produce human monoclonal antibodies (see Cole, et al., 1985 In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp.77-96). Human monoclonal antibodies may be utilized and may be produced by using human hybridomas (see Cote, et al., 1983.
- Monoclonal antibodies are generated, e.g., by immunizing an animal with a target antigen or an immunogenic fragment, derivative or variant thereof. Alternatively, the animal is immunized with cells transfected with a vector containing a nucleic acid molecule encoding the target antigen, such that the target antigen is expressed and associated with the surface of the transfected cells.
- the antibodies are obtained by screening a library that contains antibody or antigen binding domain sequences for binding to the target antigen.
- This library is prepared, e.g., in bacteriophage as protein or peptide fusions to a bacteriophage coat protein that is expressed on the surface of assembled phage particles and the encoding DNA sequences contained within the phage particles (i.e., “phage displayed library”).
- a library can be prepared in yeast as protein or peptide fusions to a cell wall protein on the surface of yeast cells and encoding DNA sequences contained within the yeast cells (i.e. “yeast display library”).
- yeast display library e.g. “yeast display library”.
- Hybridomas resulting from myeloma/B cell fusions are then screened for reactivity to the target antigen.
- Monoclonal antibodies are prepared, for example, using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975).
- a mouse, hamster, or other appropriate host animal is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent.
- the lymphocytes can be immunized in vitro.
- antibody libraries containing the same heavy chain variable domain and either a diversity of Lambda variable light chains or Kappa variable light chains can be used in parallel for in vitro selection of antibodies against different antigens.
- This approach enables the identification of two antibodies having a common heavy chain but one carrying a Lambda light chain variable domain and the other a Kappa light chain variable domain that can be used as building blocks for the generation of a bispecific antibody in the full immunoglobulin format of the invention.
- the bispecific antibodies of the invention can be of different Isotypes and their Fc portion can be modified in order to alter the bind properties to different Fc receptors and in this way modify the effectors functions of the antibody as well as it pharmacokinetic properties.
- the ratio of monospecific (same light chains) and bispecific (two different light chains) should be 50%.
- a means to modulate the relative expression of the different polypeptides is used to compensate for their intrinsic expression characteristics or different propensities to assemble with the common heavy chain. This modulation can be achieved via promoter strength, the use of internal ribosome entry sites (IRES) featuring different efficiencies or other types of regulatory elements that can act at transcriptional or translational levels as well as acting on mRNA stability.
- IRS internal ribosome entry sites
- Different promoters of different strength could include CMV (Immediate-early Cytomegalovirus virus promoter); EF1-1 ⁇ (Human elongation factor 1 ⁇ -subunit promoter); Ubc (Human ubiquitin C promoter); SV40 (Simian virus 40 promoter).
- CMV Intermediate-early Cytomegalovirus virus promoter
- EF1-1 ⁇ Human elongation factor 1 ⁇ -subunit promoter
- Ubc Human ubiquitin C promoter
- SV40 Synimian virus 40 promoter
- IRES have also been described from mammalian and viral origin. (See e.g., Hellen CU and Sarnow P. Genes Dev 200115: 1593–612). These IRES can greatly differ in their length and ribosome recruiting efficiency. Furthermore, it is possible to further tune the activity by introducing multiple copies of an IRES (Stephen et al.2000 Proc Natl Acad Sci USA 97: 1536-1541).
- the modulation of the expression can also be achieved by multiple sequential transfections of cells to increase the copy number of individual genes expressing one or the other light chain and thus modify their relative expressions.
- the Examples provided herein demonstrate that controlling the relative expression of the different chains is critical for maximizing the assembly and overall yield of the bispecific antibody.
- the co-expression of the heavy chain and two light chains generates a mixture of three different antibodies into the cell culture supernatant: two monospecific bivalent antibodies and one bispecific bivalent antibody. The latter has to be purified from the mixture to obtain the molecule of interest.
- the method described herein greatly facilitates this purification procedure by the use of affinity chromatography media that specifically interact with the Kappa or Lambda light chain constant domains such as the CaptureSelect Fab Kappa and CaptureSelect Fab Lambda affinity matrices (BAC BV, Holland).
- affinity chromatography media that specifically interact with the Kappa or Lambda light chain constant domains such as the CaptureSelect Fab Kappa and CaptureSelect Fab Lambda affinity matrices (BAC BV, Holland).
- This multi-step affinity chromatography purification approach is efficient and generally applicable to antibodies of the invention. This is in sharp contrast to specific purification methods that have to be developed and optimized for each bispecific antibodies derived from quadromas or other cell lines expressing antibody mixtures. Indeed, if the biochemical characteristics of the different antibodies in the mixtures are similar, their separation using standard chromatography technique such as ion exchange chromatography can be challenging or not possible at all.
- antibody variable domains with the desired binding specificities can be fused to immunoglobulin constant domain sequences.
- the fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CH1) containing the site necessary for light-chain binding present in at least one of the fusions.
- DNAs encoding the immunoglobulin heavy-chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors, and are co- transfected into a suitable host organism.
- a suitable host organism for further details of generating bispecific antibodies see, for example, Suresh et al., Methods in Enzymology, 121:210 (1986).
- the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture.
- the preferred interface includes at least a part of the CH3 region of an antibody constant domain.
- one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g., tyrosine or tryptophan).
- Compensatory “cavities” of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g., alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
- Techniques for generating bispecific antibodies from antibody fragments have been described in the literature. For example, bispecific antibodies can be prepared using chemical linkage. The bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
- bispecific antibodies have been produced using leucine zippers.
- the leucine zipper peptides from the Fos and Jun proteins were linked to the Fab’ portions of two different antibodies by gene fusion.
- the antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers.
- the fragments comprise a heavy-chain variable domain (V H ) connected to a light-chain variable domain (V L ) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen-binding sites.
- V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen-binding sites.
- sFv single-chain Fv
- trispecific antibodies can be prepared. Tutt et al., J. Immunol.147:60 (1991).
- Exemplary bispecific antibodies can bind to two different epitopes, at least one of which originates in the protein antigen of the invention.
- an anti-antigenic arm of an immunoglobulin molecule can be combined with an arm which binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g., CD2, CD3, CD28, or B7), or Fc receptors for IgG (Fc ⁇ R), such as Fc ⁇ RI (CD64), Fc ⁇ RII (CD32) and Fc ⁇ RIII (CD16) so as to focus cellular defense mechanisms to the cell expressing the particular antigen.
- a triggering molecule e.g., CD2, CD3, CD28, or B7
- Fc receptors for IgG Fc ⁇ R
- Bispecific antibodies can also be used to direct cytotoxic agents to cells which express a particular antigen.
- Heteroconjugate antibodies possess an antigen-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA. Another bispecific antibody of interest binds the protein antigen described herein and further binds tissue factor (TF).
- TF tissue factor
- Heteroconjugate antibodies are also within the scope of the present invention. Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (see U.S. Patent No.4,676,980), and for treatment of HIV infection (see WO 91/00360; WO 92/200373; EP 03089).
- the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
- immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond.
- suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate and those disclosed, for example, in U.S. Patent No.4,676,980.
- cysteine residue(s) can be introduced into the Fc region, thereby allowing interchain disulfide bond formation in this region.
- the homodimeric antibody thus generated can have improved internalization capability and/or increased complement- mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- an antibody can be engineered that has dual Fc regions and can thereby have enhanced complement lysis and ADCC capabilities.
- the invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent such as a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
- a cytotoxic agent such as a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
- Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
- Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis- diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6-diisocyanate
- a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238: 1098 (1987).
- Carbon-14-labeled 1-isothiocyanatobenzyl-3- methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody.
- MX-DTPA 1-isothiocyanatobenzyl-3- methyldiethylene triaminepentaacetic acid
- Those of ordinary skill in the art will recognize that a large variety of possible moieties can be coupled to the resultant antibodies of the invention. (See, for example, “Conjugate Vaccines”, Contributions to Microbiology and Immunology, J. M. Cruse and R. E.
- Coupling may be accomplished by any chemical reaction that will bind the two molecules so long as the antibody and the other moiety retain their respective activities.
- This linkage can include many chemical mechanisms, for instance covalent binding, affinity binding, intercalation, coordinate binding and complexation.
- the preferred binding is, however, covalent binding.
- Covalent binding can be achieved either by direct condensation of existing side chains or by the incorporation of external bridging molecules.
- Many bivalent or polyvalent linking agents are useful in coupling protein molecules, such as the antibodies of the present invention, to other molecules.
- representative coupling agents can include organic compounds such as thioesters, carbodiimides, succinimide esters, diisocyanates, glutaraldehyde, diazobenzenes and hexamethylene diamines.
- organic compounds such as thioesters, carbodiimides, succinimide esters, diisocyanates, glutaraldehyde, diazobenzenes and hexamethylene diamines.
- linkers include: (i) EDC (1-ethyl-3-(3-dimethylamino-propyl) carbodiimide hydrochloride; (ii) SMPT (4-succinimidyloxycarbonyl-alpha-methyl-alpha-(2- pridyl-dithio)-toluene (Pierce Chem. Co., Cat. (21558G); (iii) SPDP (succinimidyl-6 [3-(2- pyridyldithio) propionamido]hexanoate (Pierce Chem.
- sulfo-NHS esters of alkyl carboxylates are more stable than sulfo-NHS esters of aromatic carboxylates.
- NHS-ester containing linkers are less soluble than sulfo-NHS esters.
- the linker SMPT contains a sterically hindered disulfide bond, and can form conjugates with increased stability. Disulfide linkages, are in general, less stable than other linkages because the disulfide linkage is cleaved in vitro, resulting in less conjugate available.
- Sulfo-NHS in particular, can enhance the stability of carbodimide couplings.
- Carbodimide couplings when used in conjunction with sulfo-NHS, forms esters that are more resistant to hydrolysis than the carbodimide coupling reaction alone.
- the antibodies disclosed herein can also be formulated as immunoliposomes. Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA, 77: 4030 (1980); and U.S. Pat. Nos.4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S.
- Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG- derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
- Fab' fragments of the antibody of the present invention can be conjugated to the liposomes as described in Martin et al., J. Biol. Chem., 257: 286-288 (1982) via a disulfide-interchange reaction.
- any of the anti-CD3 ⁇ antibodies of the invention e.g., bispecific anti-CD3 antibodies of the invention that bind to CD3 ⁇ , and a second biological molecule, e.g., a disease associated antigen
- a second biological molecule e.g., a disease associated antigen
- an anti-CD3 antibody e.g. bispecific anti-CD3 and ULBP2 antibody for use as a medicament is provided.
- an anti-CD3 antibody for use in treating or delaying progression of a cell proliferative disorder e.g., cancer, e.g., esophageal cancer or an adenocarcinoma
- an autoimmune disorder e.g., arthritis
- an anti-CD3 antibody for use in treating or delaying aged related diseases is provided.
- an anti-CD3 ⁇ antibody for use in a method of treatment is provided.
- the invention provides an anti-CD3 ⁇ antibody for use in a method of treating an individual having a cell proliferative disorder or an autoimmune disorder comprising administering to the individual an effective amount of the anti-CD3 ⁇ antibody.
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, for example, as described below.
- the invention provides an anti-CD3 ⁇ antibody for use in enhancing immune function in an individual having a cell proliferative disorder or an autoimmune disorder.
- the invention provides an anti-CD3 ⁇ antibody for use in a method of enhancing immune function in an individual having a cell proliferative disorder or an autoimmune disorder comprising administering to the individual an effective of the anti-CD3 ⁇ antibody to activate effector cells (e.g., T cells, e.g., CD8+ and/or CD4+ T cells), expand (increase) an effector cell population, reduce a target cell (e.g., a cell expressing a second biological molecule recognized by an anti-CD3 ⁇ antibody of the invention, such as a bispecific anti-CD3 ⁇ and ULBP2/5/6 antibody of the invention) population, and/or kill a target cell (e.g., target tumor cell).
- effector cells e.g., T cells, e.g., CD8+ and/or CD4+ T cells
- a target cell e.g., a cell expressing a second biological molecule recognized by an anti-CD3 ⁇ antibody of the invention, such as a bispecific anti-CD3 ⁇
- an “individual” may be a human.
- the invention provides for the use of an anti- anti-CD3 ⁇ antibody (e.g. bispecific anti- anti-CD3 ⁇ and ULBP2/5/6 antibody) in the manufacture or preparation of a medicament.
- the medicament is for treatment of a cell proliferative disorder (e.g., cancer, e.g., esophageal cancer or an adenocarcinoma) or an autoimmune disorder (e.g., arthritis).
- a cell proliferative disorder e.g., cancer, e.g., esophageal cancer or an adenocarcinoma
- an autoimmune disorder e.g., arthritis
- the medicament is for use in a method of treating a cell proliferative disorder or an autoimmune disorder comprising administering to an individual having a cell proliferative disorder or an autoimmune disorder an effective amount of the medicament.
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, for example, as described below.
- the medicament is for activating effector cells (e.g., T cells, e.g., CD8+ and/or CD4+ T cells), expanding (increasing) an effector cell population, reducing a target cell (e.g., a cell expressing a second biological molecule recognized by an anti-CD3 antibody of the invention, such as a bispecific TDB antibody of the invention) population, and/or killing target cells (e.g., target tumor cells) in the individual.
- effector cells e.g., T cells, e.g., CD8+ and/or CD4+ T cells
- expanding expanding (increasing) an effector cell population
- reducing a target cell e.g., a cell expressing a second biological molecule recognized by an anti-CD3 antibody of the invention, such as a bispecific TDB antibody of the invention
- target cells e.g., target tumor cells
- the medicament is for use in a method of enhancing immune function in an individual having a cell proliferative disorder or an autoimmune disorder comprising administering to the individual an amount effective of the medicament to activate effector cells (e.g., T cells, e.g., CD8+ and/or CD4+ T cells), expand (increase) an effector cell population, reduce a target cell (e.g., a cell expressing a second biological molecule recognized by an anti-CD3 antibody of the invention, such as a bispecific anti-CD3 and ULBP2 antibody of the invention) population, and/or kill a target cell (e.g., target tumor cell).
- effector cells e.g., T cells, e.g., CD8+ and/or CD4+ T cells
- a target cell e.g., a cell expressing a second biological molecule recognized by an anti-CD3 antibody of the invention, such as a bispecific anti-CD3 and ULBP2 antibody of the invention
- kill a target cell
- the invention provides a method for treating a cell proliferative disorder (e.g., cancer, e.g., esophageal cancer or an adenocarcinoma) or an autoimmune disorder (e.g., arthritis).
- a cell proliferative disorder e.g., cancer, e.g., esophageal cancer or an adenocarcinoma
- an autoimmune disorder e.g., arthritis
- the method comprises administering to an individual having such a cell proliferative disorder or an autoimmune disorder an effective amount of an anti- anti-CD3 ⁇ antibody (e.g. bispecific anti-CD3 ⁇ and ULBP2/5/6 antibody).
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, for example, as described below.
- An "individual" according to any of the above embodiments may be a human.
- the invention provides a method for enhancing immune function in an individual having a cell proliferative disorder or an autoimmune disorder in an individual having a cell proliferative disorder or an autoimmune disorder.
- the method comprises administering to the individual an effective amount of an anti-CD3 ⁇ antibody to activate effector cells (e.g., T cells, e.g., CD8+ and/or CD4+ T cells), expand (increase) an effector cell population, reduce a target cell (e.g., a cell expressing a second biological molecule recognized by an anti-CD3 ⁇ antibody of the invention, such as a e.g.
- effector cells e.g., T cells, e.g., CD8+ and/or CD4+ T cells
- a target cell e.g., a cell expressing a second biological molecule recognized by an anti-CD3 ⁇ antibody of the invention, such as a e.g.
- the invention provides a method for treating urothelial cancer, esophageal cancer, stomach cancer, small intestine cancer, large intestine cancer, colorectal cancer, or an adenocarcinoma (e.g., colorectal adenocarcinoma, gastric adenocarcinoma, or pancreatic adenocarcinoma), which may be metastatic adenocarcinoma (e.g., metastatic colorectal adenocarcinoma, metastatic gastricadenocarcinoma, or metastatic pancreatic adenocarcinoma), by administering an effective amount of an anti-CD3 ⁇ antibody of the invention, such as a e.g.
- the bispecific anti-CD3 ⁇ antibody is coadministered (concurrently, as a single or multiple compositions (e.g., formulations)) with one or more additional therapeutic agents.
- the bispecific anti-CD3 ⁇ antibody is administered before one or more additional therapeutic agents.
- the bispecific anti-CD3 ⁇ antibody is administered after one or more additional therapeutic agents.
- additional therapeutic agents include but are not limited to CDK4/6 inhibitors (e.g. Palbociclib (Ibrance®)), anti-PD1 antibodies (e.g.
- ELOXATINTM oxaliplatin
- XELODA® 5-fluorouracil
- CapeOx CapeOx
- leucovorin folinic acid
- bevacizumab AVASTIN
- the invention provides a method for treating a hematological cancer, such as a B cell cancer (for example, mature B-cell lymphoma) by administering an effective amount of an anti-CD3 ⁇ antibody of the invention, such as a bispecific TDB antibody of the invention, such as an anti-B cell targeting TDB, such as a CD20-TDB having an anti-CD3 ⁇ arm and an anti-CD20 arm.
- a hematological cancer such as a B cell cancer (for example, mature B-cell lymphoma) by administering an effective amount of an anti-CD3 ⁇ antibody of the invention, such as a bispecific TDB antibody of the invention, such as an anti-B cell targeting TDB, such as a CD20-TDB having an anti-CD3 ⁇ arm and an anti-CD20 arm.
- a hematological cancer such as a B cell cancer (for example, mature B-cell lymphoma)
- an anti-CD3 ⁇ antibody of the invention such as a bispecific TDB antibody of the invention, such
- the NHL is selected from the group comprising: germinal-center B-cell-like (GCB) DLBCL, activated B-cell like (ABC) DLBCL, follicular lymphoma (FL), mantle cell lymphoma ( CL), acute myeloid leukemia (AML), chronic lymphoid leukemia (CLL), marginal zone lymphoma ( ZL), small lymphocytic leukemia (SLL), lymphoplasmacytic lymphoma (LL), Waldenstrom macroglobulinemia (W ), central nervous system lymphoma (CNSL), Burkitt's lymphoma (BL), B-cell prolymphocytic leukemia, Splenic marginal zone lymphoma, Hairy cell leukemia, Splenic lymphoma/leukemia, unclassifiable, Splenic diffuse red pulp small B-cell lymphoma, Hairy cell leukemia variant, Waldenstrom macroglobulinemia, Heavy chain diseases, a Heavy chain disease,
- GCB germinal-
- the method comprises treating a cancer comprising germinal-center B-cell like (GCB) DLBCL, activated B-cell-like (ABC) DLBCL, follicular lymphoma (FL), mantle cell lymphoma (MCL), acute myeloid leukemia (AML), chronic lymphoid leukemia (CLL), marginal zone lymphoma (MZL), small lymphocytic leukemia (SLL), lymphoplasmacytic lymphoma (LL), Waldenstrom macroglobulinemia (WM), central nervous system lymphoma (CNSL), or Burkitt's lymphoma (BL).
- GCB germinal-center B-cell like
- ABSC activated B-cell-like
- FL follicular lymphoma
- MCL mantle cell lymphoma
- AML acute myeloid leukemia
- CLL chronic lymphoid leukemia
- MZL marginal zone lymphoma
- SLL small lymphocytic leukemia
- the invention provides pharmaceutical formulations comprising any of the anti-CD3 ⁇ antibodies provided herein, e.g., for use in any of the above therapeutic methods.
- a pharmaceutical formulation comprises any of the anti-CD3 ⁇ antibodies provided herein and a pharmaceutically acceptable carrier.
- a pharmaceutical formulation comprises any of the anti-CD3 ⁇ antibodies provided herein and at least one additional therapeutic agent, for example, as described herein.
- Antibodies of the invention can be used either alone or in combination with other agents in a therapy. For instance, an antibody of the invention may be co-administered with at least one additional therapeutic agent.
- an additional therapeutic agent is a chemotherapeutic agent, growth inhibitory agent, cytotoxic agent, agent used in radiation therapy, anti-angiogenesis agent, apoptotic agent, anti-tubulin agent, or other agent, such as a epidermal growth factor receptor (EGFR) antagonist (e.g., a tyrosine kinase inhibitor), HER1/EGFR inhibitor (e.g., erlotinib (TarcevaTM), platelet derived growth factor inhibitor (e.g., GleevecTM (Imatinib Mesylate)), a COX-2 inhibitor (e.g., celecoxib), interferon, cytokine, antibody other than the anti-CD3 antibody of the invention, such as an antibody that bind to one or more of the following targets ErbB2, ErbB3, ErbB4, PDGFR- beta, BlyS, APRIL, BCMA VEGF, or VEGF receptor(s), TRAIL/Apo2, PD-1 (EGFR) antagonist
- the invention provides a method wherein the additional therapeutic agent is a glucocorticoid.
- the glucocorticoid is dexamethasone.
- administration of the anti-CD3 ⁇ antibody and administration of an additional therapeutic agent occur within about one month, or within about one, two or three weeks, or within about one, two, three, four, five, or six days, of each other.
- Anti-CD3 ⁇ antibodies of the invention e.g., bispecific anti-CD3 ⁇ antibodies of the invention that bind to CD3 ⁇ and a second biological molecule, e.g., a disease associated antigen
- An antibody of the invention (and/or any additional therapeutic agent) can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration.
- Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
- the antibody is administered by subcutaneous administration.
- an anti-CD3 ⁇ antibody administered by subcutaneous injection exhibits a less toxic response in a patient than the same anti-CD3 ⁇ antibody administered by intravenous injection.
- Dosing can be by any suitable route, for example, by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.
- Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
- Antibodies of the invention would be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
- the antibody need not be, but is optionally formulated with one or more agents currently used to prevent or treat the disorder in question. The effective amount of such other agents depends on the amount of antibody present in the formulation, the type of disorder or treatment, and other factors discussed above.
- an antibody of the invention when used alone or in combination with one or more other additional therapeutic agents, will depend on the type of disease to be treated, the type of antibody, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician.
- the antibody is suitably administered to the patient at one time or over a series of treatments.
- the therapeutically effective amount of the anti-CD3 ⁇ antibody (e.g. bispecific anti-CD3 ⁇ and ULBP2/5/6 antibody) administered to human will be in the range of about 0.01 to about 100 mg/kg of patient body weight whether by one or more administrations.
- the antibody used is about 0.01 to about 45 mg/kg, about 0.01 to about 40 mg kg, about 0.01 to about 35 mg/kg, about 0.01 to about 30 mg/kg, about 0.01 to about 25 mg/kg, about 0.01 to about 20 mg/kg, about 0.01 to about 15 mg kg, about 0.01 to about 10 mg/kg, about 0.01 to about 5 mg/kg, or about 0.01 to about 1 mg/kg administered daily, for example.
- an anti-CD3 ⁇ antibody described herein is administered to a human at a dose of about 100 mg, about 200 mg, about 300 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg or about 1400 mg on day 1 of 21 -day cycles.
- the dose may be administered as a single dose or as multiple doses (e.g., 2 or 3 doses), such as infusions.
- the treatment would generally be sustained until a desired suppression of disease symptoms occurs.
- One exemplary dosage of the antibody would be in the range from about 0.05 mg/kg to about 10 mg/kg.
- one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 4.0 mg kg, or 10 mg/kg (or any combination thereof) may be administered to the patient.
- Such doses may be administered intermittently, for example, every week or every three weeks (e.g., such that the patient receives from about two to about twenty, or, for example, about six doses of the anti-CD3 ⁇ antibody).
- An initial higher loading dose, followed by one or more lower doses may be administered. The progress of this therapy is easily monitored by conventional techniques and assays.
- the methods may further comprise an additional therapy.
- the additional therapy may be radiation therapy, surgery, chemotherapy, gene therapy, DMA therapy, viral therapy, RNA therapy, immunotherapy, bone marrow transplantation, nanotherapy, monoclonal antibody therapy, or a combination of the foregoing.
- the additional therapy may be in the form of adjuvant or neoadjuvant therapy.
- the additional therapy is the administration of small molecule enzymatic inhibitor or anti-metastatic agent.
- the additional therapy is the administration of side-effect limiting agents (e.g., agents intended to lessen the occurrence and/or severity of side effects of treatment, such as anti-nausea agents, etc.).
- the additional therapy is radiation therapy.
- the additional therapy is surgery.
- the additional therapy is a combination of radiation therapy and surgery. In some embodiments, the additional therapy is gamma irradiation. In some embodiments, the additional therapy may be a separate administration of one or more of the therapeutic agents described above. [0617] It will be appreciated that administration of therapeutic entities in accordance with the invention will be administered with suitable carriers, excipients, and other agents that are incorporated into formulations to provide improved transfer, delivery, tolerance, and the like. A multitude of appropriate formulations can be found in the formulary known to all pharmaceutical chemists: Remington's Pharmaceutical Sciences (15th ed, Mack Publishing Company, Easton, PA (1975)), particularly Chapter 87 by Blaug, Seymour, therein.
- formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, lipid (cationic or anionic) containing vesicles (such as LipofectinTM), DNA conjugates, anhydrous absorption pastes, oil-in-water and water-in-oil emulsions, emulsions carbowax (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax. Any of the foregoing mixtures may be appropriate in treatments and therapies in accordance with the present invention, provided that the active ingredient in the formulation is not inactivated by the formulation and the formulation is physiologically compatible and tolerable with the route of administration.
- Therapeutic formulations of the invention are used to treat or alleviate a symptom associated with a cancer, such as, by way of non-limiting example, leukemias, lymphomas, breast cancer, colon cancer, ovarian cancer, bladder cancer, prostate cancer, glioma, lung & bronchial cancer, colorectal cancer, pancreatic cancer, esophageal cancer, liver cancer, urinary bladder cancer, kidney and renal pelvis cancer, oral cavity & pharynx cancer, uterine corpus cancer, and/or melanoma
- a cancer such as, by way of non-limiting example, leukemias, lymphomas, breast cancer, colon cancer, ovarian cancer, bladder cancer, prostate cancer, glioma, lung & bronchial cancer, colorectal cancer, pancreatic cancer, esophageal cancer, liver cancer, urinary bladder cancer, kidney and renal pelvis cancer, oral cavity & pharynx cancer, uterine corpus cancer, and/or melanoma
- a therapeutic regimen is carried out by identifying a subject, e.g., a human patient suffering from (or at risk of developing) a cancer, using standard methods. [0619] Efficaciousness of treatment is determined in association with any known method for diagnosing or treating the particular immune-related disorder. Alleviation of one or more symptoms of the immune-related disorder indicates that the antibody confers a clinical benefit. [0620] Methods for the screening of antibodies that possess the desired specificity include, but are not limited to, enzyme linked immunosorbent assay (ELISA) and other immunologically mediated techniques known within the art.
- ELISA enzyme linked immunosorbent assay
- Antibodies directed against a target such as CD3 ⁇ , ULBP2/5/6, or a combination thereof (or a fragment thereof), may be used in methods known within the art relating to the localization and/or quantitation of these targets, e.g., for use in measuring levels of these targets within appropriate physiological samples, for use in diagnostic methods, for use in imaging the protein, and the like).
- antibodies specific any of these targets, or derivative, fragment, analog or homolog thereof, that contain the antibody derived antigen binding domain are utilized as pharmacologically active compounds (referred to hereinafter as “Therapeutics”).
- An antibody of the invention can be used to isolate a particular target using standard techniques, such as immunoaffinity, chromatography or immunoprecipitation.
- Antibodies of the invention (or a fragment thereof) can be used diagnostically to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling (i.e., physically linking) the antibody to a detectable substance.
- detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase;
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
- an example of a luminescent material includes luminol;
- examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include 125 I, 131 I, 35 S or 3 H.
- Antibodies of the invention may be used as therapeutic agents. Such agents will generally be employed to treat or prevent a disease or pathology associated with aberrant expression or activation of a given target in a subject.
- An antibody preparation preferably one having high specificity and high affinity for its target antigen, is administered to the subject and will generally have an effect due to its binding with the target.
- Administration of the antibody may abrogate or inhibit or interfere with the signaling function of the target.
- Administration of the antibody may abrogate or inhibit or interfere with the binding of the target with an endogenous ligand to which it naturally binds.
- a therapeutically effective amount of an antibody of the invention relates generally to the amount needed to achieve a therapeutic objective. As noted above, this may be a binding interaction between the antibody and its target antigen that, in certain cases, interferes with the functioning of the target.
- the amount required to be administered will furthermore depend on the binding affinity of the antibody for its specific antigen, and will also depend on the rate at which an administered antibody is depleted from the free volume other subject to which it is administered.
- Common ranges for therapeutically effective dosing of an antibody or antibody fragment of the invention may be, by way of nonlimiting example, from about 0.1 mg/kg body weight to about 50 mg/kg body weight. Common dosing frequencies may range, for example, from twice daily to once a week.
- Antibodies or a fragment thereof of the invention can be administered for the treatment of a variety of diseases and disorders in the form of pharmaceutical compositions. Principles and considerations involved in preparing such compositions, as well as guidance in the choice of components are provided, for example, in Remington: The Science And Practice Of Pharmacy 19th ed. (Alfonso R. Gennaro, et al., editors) Mack Pub. Co., Easton, Pa.: 1995; Drug Absorption Enhancement: Concepts, Possibilities, Limitations, And Trends, Harwood Academic Publishers, Langhorne, Pa., 1994; and Peptide And Protein Drug Delivery (Advances In Parenteral Sciences, Vol.4), 1991, M. Dekker, New York.
- peptide molecules can be designed that retain the ability to bind the target protein sequence.
- Such peptides can be synthesized chemically and/or produced by recombinant DNA technology. (See, e.g., Marasco et al., Proc. Natl. Acad. Sci. USA, 90: 7889-7893 (1993)).
- the formulation can also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
- the composition can comprise an agent that enhances its function, such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent.
- an agent that enhances its function such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent.
- Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
- the active ingredients can also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions.
- colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-
- sustained-release preparations can be prepared. Suitable examples of sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat.
- copolymers of L-glutamic acid and ⁇ ethyl-L-glutamate non-degradable ethylene-vinyl acetate
- degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT TM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate)
- poly-D-(-)-3-hydroxybutyric acid While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
- an antibody according to the invention can be used as an agent for detecting the presence of a given target (or a protein fragment thereof) in a sample.
- the antibody contains a detectable label.
- Antibodies are polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment thereof (e.g., F ab , scFv, or F (ab)2 ) is used.
- the term “labeled”, with regard to the probe or antibody is intended to encompass direct labeling of the probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled.
- Examples of indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end- labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin.
- bio sample is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. Included within the usage of the term “biological sample”, therefore, is blood and a fraction or component of blood including blood serum, blood plasma, or lymph. That is, the detection method of the invention can be used to detect an analyte mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo.
- in vitro techniques for detection of an analyte mRNA include Northern hybridizations and in situ hybridizations.
- In vitro techniques for detection of an analyte protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, and immunofluorescence.
- In vitro techniques for detection of an analyte genomic DNA include Southern hybridizations. Procedures for conducting immunoassays are described, for example in “ELISA: Theory and Practice: Methods in Molecular Biology”, Vol.42, J. R. Crowther (Ed.) Human Press, Totowa, NJ, 1995; “Immunoassay”, E. Diamandis and T.
- analyte protein antibody introducing into a subject a labeled anti-analyte protein antibody.
- the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
- PHARMACEUTICAL COMPOSITIONS [0632]
- the antibodies of the invention also referred to herein as “active compounds”), and derivatives, fragments, analogs and homologs thereof, can be incorporated into pharmaceutical compositions suitable for administration.
- compositions typically comprise the antibody and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington’s Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference. Preferred examples of such carriers or diluents include, but are not limited to, water, saline, ringer’s solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used.
- a pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration.
- routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (i.e., topical), transmucosal, and rectal administration.
- Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose.
- the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- suitable carriers include physiological saline, bacteriostatic water, Cremophor EL TM (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringeability exists.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition.
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
- Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets.
- the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules.
- Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed.
- Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition.
- the tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
- a binder such as microcrystalline cellulose, gum tragacanth or gelatin
- an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch
- a lubricant such as magnesium stearate or Sterotes
- a glidant such as colloidal silicon dioxide
- the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
- a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
- Systemic administration can also be by transmucosal or transdermal means.
- penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
- Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
- the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
- the compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
- the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid.
- compositions for preparation of such formulations will be apparent to those skilled in the art.
- the materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc.
- Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Patent No.4,522,811. [0641] It is especially advantageous to formulate oral or parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
- the pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.
- the invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.
- Enzymatic reactions and purification techniques are performed according to manufacturer's specifications or as commonly accomplished in the art or as described herein.
- the foregoing techniques and procedures are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification. See e.g., Sambrook et al. Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989)).
- the nomenclatures utilized in connection with, and the laboratory procedures and techniques of, analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein are those well-known and commonly used in the art. Standard techniques are used for chemical syntheses, chemical analyses, pharmaceutical preparation, formulation, and delivery, and treatment of patients.
- the term “antibody” refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
- immunoglobulin immunoglobulin
- Ig immunoglobulin
- bind or “immunoreacts with” or “immunospecifically bind” is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react with other polypeptides or binds at much lower affinity (K d > 10 -6 ).
- Antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, dAb (domain antibody), single chain, F ab , F ab’ and F (ab')2 fragments, scFvs, and an F ab expression library.
- the basic antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa).
- the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function.
- antibody molecules obtained from humans relate to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses as well, such as IgG 1 , IgG 2 , IgG4 and others. Furthermore, in humans, the light chain may be a kappa chain or a lambda chain.
- the complementarity determining regions (CDRs) of the monoclonal antibody are identical in all the molecules of the population.
- MAbs contain an antigen binding site capable of immunoreacting with a particular epitope of the antigen characterized by a unique binding affinity for it.
- the term “antigen binding region” or “antigen-binding site” or “binding portion” refers to the part of the immunoglobulin molecule that participates in antigen binding.
- the antigen binding site is formed by amino acid residues of the N-terminal variable (“V”) regions of the heavy (“H”) and light (“L”) chains.
- FR refers to amino acid sequences which are naturally found between, and adjacent to, hypervariable regions in immunoglobulins.
- the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface.
- the antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as “complementarity-determining regions,” or “CDRs.”
- CDRs complementarity-determining regions
- Various methods are known in the art for numbering the amino acids sequences of antibodies and identification of the complementary determining regions. For example, the Kabat numbering system (See Kabat, E.A., et al., Sequences of Protein of immunological interest, Fifth Edition, US Department of Health and Human Services, US Government Printing Office (1991)) or the IMGT numbering system (See IMGT ® , the international ImMunoGeneTics information system ® . Available online: http://www.imgt.org/).
- the IMGT numbering system is routinely used and accepted as a reliable and accurate system in the art to determine amino acid positions in coding sequences, alignment of alleles, and to easily compare sequences in immunoglobulin (IG) and T-cell receptor (TR) from all vertebrate species.
- the accuracy and the consistency of the IMGT data are based on IMGT- ONTOLOGY, the first, and so far unique, ontology for immunogenetics and immunoinformatics (See Lefranc. M.P. et al., Biomolecules, 2014 Dec; 4(4), 1102-1139).
- IMGT tools and databases run against IMGT reference directories built from a large repository of sequences.
- the IG V-DOMAIN and IG C-DOMAIN are delimited taking into account the exon delimitation, whenever appropriate. Therefore, the availability of more sequences to the IMGT database, the IMGT exon numbering system can be and “is used” by those skilled in the art reliably to determine amino acid positions in coding sequences and for alignment of alleles. Additionally, correspondences between the IMGT unique numbering with other numberings (i.e., Kabat) are available in the IMGT Scientific chart (See Lefranc. M.P. et al., Biomolecules, 2014 Dec; 4(4), 1102-1139).
- hypervariable region refers to the amino acid residues of an antibody that are typically responsible for antigen-binding.
- the hypervariable region generally comprises amino acid residues from a "complementarity determining region" or "CDR" (e.g., around about residues 24-34 (LI), 50-56 (L2) and 89-97 (L3) in theV L , and around about 31-35 (HI), 50-65 (H2) and 95-102 (H3) in the VH when numbered in accordance with the Kabat numbering system; Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.
- CDR complementarity determining region
- residues from a "hypervariable loop” e.g., residues 24- 34 (LI), 50-56 (L2) and 89-97 (L3) in the V L , and 26-32 (HI), 52-56 (H2) and 95-101 (H3) in the V H when numbered in accordance with the Chothia numbering system; Chothia and Lesk, J. Mol.
- the antibody has symmetrical insertions at one or more of the following points 28, 36 (LI), 63, 74-75 (L2) and 123 (L3) in the V L , and 28, 36 (HI), 63, 74-75 (H2) and 123 (H3) in the VH when numbered in accordance with AHo; Honneger, A. and Plunkthun, A. J. Mol. Biol.309:657- 670 (2001)).
- the term “epitope” includes any protein determinant capable of specific binding to an immunoglobulin, an scFv, or a T-cell receptor.
- epitopic determinants includes any protein determinant capable of specific binding to an immunoglobulin or T- cell receptor.
- Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
- antibodies may be raised against N-terminal or C-terminal peptides of a polypeptide.
- An antibody is the to specifically bind an antigen when the dissociation constant is ⁇ 1 ⁇ M; e.g., ⁇ 100 nM, preferably ⁇ 10 nM and more preferably ⁇ 1 nM.
- immunological binding refers to the non-covalent interactions of the type which occur between an immunoglobulin molecule and an antigen for which the immunoglobulin is specific.
- the strength, or affinity of immunological binding interactions can be expressed in terms of the dissociation constant (K d ) of the interaction, wherein a smallerK d represents a greater affinity.
- Immunological binding properties of selected polypeptides can be quantified using methods well known in the art. One such method entails measuring the rates of antigen- binding site/antigen complex formation and dissociation, wherein those rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that equally influence the rate in both directions.
- both the “on rate constant” (K on ) and the “off rate constant” (K off ) can be determined by calculation of the concentrations and the actual rates of association and dissociation. (See Nature 361:186-87 (1993)).
- the ratio of K off /K on enables the cancellation of all parameters not related to affinity, and is equal to the dissociation constant K d . (See, generally, Davies et al. (1990) Annual Rev Biochem 59:439-473).
- An antibody of the present invention is the to specifically bind to its target, when the equilibrium binding constant (K d ) is ⁇ 1 ⁇ M, e.g., ⁇ 100 nM, preferably ⁇ 10 nM, and more preferably ⁇ 1 nM, as measured by assays such as radioligand binding assays or similar assays known to those skilled in the art.
- K d equilibrium binding constant
- isolated polynucleotide shall mean a polynucleotide of genomic, cDNA, or synthetic origin or some combination thereof, which by virtue of its origin the “isolated polynucleotide” (1) is not associated with all or a portion of a polynucleotide in which the “isolated polynucleotide” is found in nature, (2) is operably linked to a polynucleotide which it is not linked to in nature, or (3) does not occur in nature as part of a larger sequence.
- Polynucleotides in accordance with the invention include the nucleic acid molecules encoding the heavy chain immunoglobulin molecules, and nucleic acid molecules encoding the light chain immunoglobulin molecules described herein.
- isolated protein referred to herein means a protein of cDNA, recombinant RNA, or synthetic origin or some combination thereof, which by virtue of its origin, or source of derivation, the “isolated protein” (1) is not associated with proteins found in nature, (2) is free of other proteins from the same source, e.g., free of marine proteins, (3) is expressed by a cell from a different species, or (4) does not occur in nature.
- polypeptide is used herein as a generic term to refer to native protein, fragments, or analogs of a polypeptide sequence. Hence, native protein fragments, and analogs are species of the polypeptide genus. Polypeptides in accordance with the invention comprise the heavy chain immunoglobulin molecules, and the light chain immunoglobulin molecules described herein, as well as antibody molecules formed by combinations comprising the heavy chain immunoglobulin molecules with light chain immunoglobulin molecules, such as kappa light chain immunoglobulin molecules, and vice versa, as well as fragments and analogs thereof.
- the term “naturally-occurring” as used herein as applied to an object refers to the fact that an object can be found in nature.
- a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory or otherwise is naturally-occurring.
- the term “operably linked” as used herein refers to positions of components so described are in a relationship permitting them to function in their intended manner.
- a control sequence “operably linked” to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.
- control sequence refers to polynucleotide sequences which are necessary to affect the expression and processing of coding sequences to which they are ligated.
- control sequences differs depending upon the host organism in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence in eukaryotes, generally, such control sequences include promoters and transcription termination sequence.
- control sequences is intended to include, at a minimum, all components whose presence is essential for expression and processing, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences.
- polynucleotide as referred to herein means a polymeric boron of nucleotides of at least 10 bases in length, either ribonucleotides or deoxynucleotides or a modified form of either type of nucleotide.
- the term includes single and double stranded forms of DNA.
- the twenty conventional amino acids and their abbreviations follow conventional usage. See Immunology - A Synthesis (2nd Edition, E.S. Golub and D.R. Gren, Eds., Sinauer Associates, Sunderland Mass. (1991)). Stereoisomers (e.g., D- amino acids) of the twenty conventional amino acids, unnatural amino acids such as ⁇ -, ⁇ - disubstituted amino acids, N-alkyl amino acids, lactic acid, and other unconventional amino acids may also be suitable components for polypeptides of the present invention.
- Examples of unconventional amino acids include: 4 hydroxyproline, ⁇ -carboxyglutamate, ⁇ -N,N,N- trimethyllysine, ⁇ -N-acetyllysine, O-phosphoserine, N- acetylserine, N-formylmethionine, 3-methylhistidine, 5-hydroxylysine, ⁇ -N-methylarginine, and other similar amino acids and imino acids (e.g., 4- hydroxyproline).
- the left-hand direction is the amino terminal direction and the right-hand direction is the carboxy-terminal direction, in accordance with standard usage and convention.
- the term “substantial identity” means that two peptide sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap weights, share at least 80 percent sequence identity, preferably at least 90 percent sequence identity, more preferably at least 95 percent sequence identity, and most preferably at least 99 percent sequence identity.
- residue positions which are not identical differ by conservative amino acid substitutions.
- Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains.
- a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic- hydroxyl side chains is serine and threonine; a group of amino acids having amide- containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur- containing side chains is cysteine and methionine.
- Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine valine, glutamic- aspartic, and asparagine-glutamine.
- minor variations in the amino acid sequences of antibodies or immunoglobulin molecules are contemplated as being encompassed by the present invention, providing that the variations in the amino acid sequence maintain at least 75%, more preferably at least 80%, 90%, 95%, and most preferably 99%.
- conservative amino acid replacements are contemplated.
- Conservative replacements are those that take place within a family of amino acids that are related in their side chains.
- amino acids are generally divided into families: (1) acidic amino acids are aspartate, glutamate; (2) basic amino acids are lysine, arginine, histidine; (3) non-polar amino acids are alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, and (4) uncharged polar amino acids are glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine.
- the hydrophilic amino acids include arginine, asparagine, aspartate, glutamine, glutamate, histidine, lysine, serine, and threonine.
- the hydrophobic amino acids include alanine, cysteine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, tyrosine and valine.
- Other families of amino acids include (i) serine and threonine, which are the aliphatic-hydroxy family; (ii) asparagine and glutamine, which are the amide containing family; (iii) alanine, valine, leucine and isoleucine, which are the aliphatic family; and (iv) phenylalanine, tryptophan, and tyrosine, which are the aromatic family.
- Structural and functional domains can be identified by comparison of the nucleotide and/or amino acid sequence data to public or proprietary sequence databases.
- computerized comparison methods are used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function. Methods to identify protein sequences that fold into a known three-dimensional structure are known. Bowie et al. Science 253:164 (1991).
- sequence motifs and structural conformations that may be used to define structural and functional domains in accordance with the invention.
- Preferred amino acid substitutions are those which: (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter binding affinities, and (4) confer or modify other physicochemical or functional properties of such analogs.
- Analogs can include various muteins of a sequence other than the naturally-occurring peptide sequence. For example, single or multiple amino acid substitutions (preferably conservative amino acid substitutions) may be made in the naturally- occurring sequence (preferably in the portion of the polypeptide outside the domain(s) forming intermolecular contacts.
- a conservative amino acid substitution should not substantially change the structural characteristics of the parent sequence (e.g., a replacement amino acid should not tend to break a helix that occurs in the parent sequence, or disrupt other types of secondary structure that characterizes the parent sequence).
- Examples of art-recognized polypeptide secondary and tertiary structures are described in Proteins, Structures and Molecular Principles (Creighton, Ed., W. H. Freeman and Company, New York (1984)); Introduction to Protein Structure (C. Branden and J. Tooze, eds., Garland Publishing, New York, N.Y. (1991)); and Thornton et at. Nature 354:105 (1991).
- label refers to incorporation of a detectable marker, e.g., by incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or calorimetric methods). In certain situations, the label or marker can also be therapeutic. Various methods of labeling polypeptides and glycoproteins are known in the art and may be used.
- labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (e.g., 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, 111 In, 125 I, 131 I), fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors), enzymatic labels (e.g., horseradish peroxidase, p- galactosidase, luciferase, alkaline phosphatase), chemiluminescent, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags).
- radioisotopes or radionuclides e.g., 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, 111 In, 125 I, 131 I
- labels are attached by spacer arms of various lengths to reduce potential steric hindrance.
- pharmaceutical agent or drug refers to a chemical compound or composition capable of inducing a desired therapeutic effect when properly administered to a patient.
- Other chemistry terms herein are used according to conventional usage in the art, as exemplified by The McGraw-Hill Dictionary of Chemical Terms (Parker, S., Ed., McGraw- Hill, San Francisco (1985)).
- substantially pure means an object species is the predominant species present (i.e., on a molar basis it is more abundant than any other individual species in the composition), and preferably a substantially purified fraction is a composition wherein the object species comprises at least about 50 percent (on a molar basis) of all macromolecular species present.
- a substantially pure composition will comprise more than about 80 percent of all macromolecular species present in the composition, more preferably more than about 85%, 90%, 95%, and 99%.
- the object species is purified to essential homogeneity (contaminant species cannot be detected in the composition by conventional detection methods) wherein the composition consists essentially of a single macromolecular species.
- EXAMPLE 1 Materials and Methods for Examples 2-8
- Proteins [0674] Amino acids 26-216 of cynomolgus ULBP2 (NCBI Reference Sequence: XP_005552169.1) was fused to hIgG1 Fc and expressed in Expi293 HEK cells. Human ULBP2-Fc, ULBP2-His, ULBP5-His, ULBP6-His and NKG2D-Fc was purchased from R&D Systems.
- Biotin labeled human CD3 epsilon/delta and cynomolgus CD3 epsilon/delta were also purchased from Acro Biosystems.
- Bio-layer interferometry was performed on the Octet RED384 (Sartorius).
- ULBP2 antibodies were diluted to 5 ⁇ g/mL in kinetics buffer (PBS+ 0.02% Tween20, 0.1% BSA, 0.05% sodium azide) followed by loading to AHC biosensors (Sartorius) for 120 seconds.
- sensors were transferred to wells containing ULBP2, ULBP5 and ULBP6 at the following concentrations (250, 125, 62.5 and 31.25 nM) for 300 seconds. Subsequently, dissociation was measured over 600 seconds. The kinetic and affinity constants are determined by fitting the data to a 1:1 binding model using the Octet analysis software.
- SPR Surface plasmon resonance
- Biotin labelled proteins were captured using the Sensor chip SA (Cytiva).
- Antibodies were diluted in the running buffer (10 mM HEPES, 150 mM NaCl, 0.05% v/v Surfactant P20, pH 7.4) to appropriate concentrations and injected to each channel at a flow rate of 30 ⁇ L/min for the multi-cycle kinetics/affinity analysis.
- the association contact and dissociation time are 60-120 seconds and 120-420 seconds respectively.
- the chip surface is regenerated by injecting 10 mM glycine, pH 1.5, at a flow rate of 30 ⁇ L/min for 60 seconds.
- the kinetic and affinity constants are determined by fitting the data to a 1:1 binding model using the Biacore insight evaluation software.
- NKG2D competition ELISA [0680] Maxisorp plates (Nunc) were coated with 5 ⁇ g/mL of ULBP2-His in PBS. Following 1 hour blocking with PBS containing 5% BSA, wells were incubated with 10 nM of biotin labeled NKG2D-Fc and increasing concentration of A06 or E12 antibodies (0.0003, 0.0011, 0.0046, 0.0183, 0.0732, 0.29, 1.17, 4.69, 18.8, 75, 300 nM) for an additional 1 hour. Wells were then washed and incubated with streptavidin horse radish peroxidase conjugate for another 1 hour.
- T cells were isolated from healthy PBMC by negative selection using EasySep Human T cell CD3+ Isolation kit (STEMCELL) according to the manufacturer’s instructions and resuspended in RPMI 1640 GlutaMAX Media plus 10% FBS. For each round of stimulation, isolated T cells (1 ⁇ 10 6 cells/ml) were incubated with 10 nM of protein conjugated to Dynabeads (Thermofisher) at 37 °C for 2 to 3 days.
- T cell isolation and activation T-cells were isolated from healthy PBMCs donors using StemCell T-cell isolation kit. OpTmizer media was supplemented with 2% human AB serum, 1X penicillin/streptomycin, 4mM glutaMAX, 2mM glutamine.
- T cells were incubated at 37°C in 5% CO2 in the supplemented OpTmizer media at 5x10 5 cells/mL and treated with Dynabeads coated with CD3 and CD28 antibodies for 48 hours.
- T cells were incubated with IL-7 (2.5 ng/ml) and IL-15 (2.5 ng/ml) in supplemented OpTmizer media for an additional 6 days.
- the supplemented media was replaced with freshly thawed cytokines (IL7 and IL15) every 48 hours. On day of adoptive transfer T cell number and viability were measured using hemocytometer.
- Biotin conjugated ULBP2 (4.5 ⁇ g/mL) in blocking buffer (3% BSA in PBS) was incubated with streptavidin-coated plates (100 ⁇ L per well) for 16 hours at 4°C. Plasma samples were thawed on ice and centrifuged at 21,000 x g for 5 minutes at 4 °C. Serial dilutions of samples at each time point were prepared in blocking buffer while for the standard curve, four-fold serial dilutions of EIP0561 were made in blocking buffer plus 2% normal cynomolgus monkey serum in duplicate. ELISA plates were incubated overnight at 4°C.
- NCA model was defined by profile type: “single dose” and administration type: “IV bolus”, since IV infusion times were not provided. Under these conditions, any missing pre-dose imputation for AUC calculation are back-extrapolated according to the manufacturer’s criteria. (https://iqnca.intiquan.com/).
- AUC calculation method was Linear Trapezoidal with Linear Interpolation. Lambda Z ( ⁇ z) method was best fit for ⁇ z, Log regression and required a minimum of three points. No weighting was used in ⁇ z calculation.
- Yeast surface display Plasmid DNA encoding the following: (1) human ULBP2 (26-216), human ULBP2 with the substitution R106L, alanine variants of human ULBP2 (26-216) containing single alanine substitutions or cynomolgus ULBP2 (26-216), (2) V5 epitope tag, and (3) Aga2 protein, all under galactose inducible promoter were transformed into competent EBY-100 yeast (ATCC) and plated on CM glucose media minus tryptophan and grown 30 ⁇ C for 2-4 days. Single colony transformants were then transferred into 2 mL deep well plates with CM glucose media minus tryptophan and grown at 30 °C overnight with shaking.
- human ULBP2 sequence (SEQ ID NO: 421) was used. Crystal structure of human NKG2D in complex with ULBP6 (PDB ID: 4S0U) was utilized as template for building human ULBP2 structure. Generated model was refined using “protein preparation workflow” in Bioluminate by performing a restrained minimization using OPLS_2005 forcefield. Human ULBP2 and ULBP6 (SEQ ID: 423) share 96% sequence identity. [0696] Structure of human ULBP2-NKG2D complex was modeled using the crystal structure of human NKG2D in complex with ULBP6 (PDB ID: 4S0U).
- Table 23 Association, dissociation, and equilibrium constants for antibody binding to human and cynomolgus ULBP2
- the binding kinetics of humanized ULBP2 antibodies A06 and E12 to human ULBP2, ULBP5 and ULBP6 was determined using Bio-layer interferometry (BLI) for which the dissociation constant are summarized in Table 24 below.
- BBI Bio-layer interferometry
- Table 24 Equilibrium dissociation constants for antibody binding to human ULBP2, ULBP5 and ULBP6 . o g
- the characteristic feature of A06 is lack of binding to ULBP5, ULBP6 and cynomolgus ULBP2 which all share a common amino acid leucine at position 106.
- EXAMPLE 3 Design and Expression of Bispecific Antibodies with Heavy Chain and Light Chain Heterodimerization
- Challenges for bispecific IgG-like antibody format designs are (i) efficient heavy chain heterodimerization and, (ii) efficient light chain heterodimerization for correct cognate pairing with good specificity.
- bispecific or multispecific antibodies were designed to include (i) knob-into-hole mutations to promote efficient heavy chain heterodimerization and (ii) charged pairing (between VH1 and VL1 interface and/or VH2 and VL2 interface, and CH1 H1 and CL1 interface and/or CH2 H1 and CL2 interface) and disulfide stabilization mutations (between CH1 H1 and CL1 interface and/or CH2 H1 and CL2 interface), which together promote correct cognate pairing of heavy chain and light chains. Correct pairing of heavy and light chains is advantageous for efficient large scale antibody production and purification. [0724] Bioluminate modeling suite and Pymol molecular graphics system from Schrodinger were used to perform all molecular modeling works.
- a high resolution crystal structure of Trastuzumab (PDB ID: 1N8Z) was used as a backbone template for homology modeling of VH2-CH2 H1 /VL2-CL2 kappa antigen binding fragment (Fab) of the disease-associated antigen (DAA) binding portion of the antibody, and a high resolution crystal structure of Pertuzumab (PDB ID: 4LLU) was used as a backbone template for homology modeling of VH1-CH1 H1 /VL1-CL1 lambda (Fab) of the CD3 binding portion of the antibody.
- Antibodies were then purified using an AKTA Avant chromatography system (Cytiva) and a tandem purification method using HiTrap Protein A and HiLoad Superdex 200 columns (Cytiva). Antibodies were stored in PBS, pH 7.22 at 4 degrees Celsius following purification and prior to analysis.
- Biophysical characterization [0729] Analytical size exclusion chromatography (aSEC) was performed using AdvanceBio 1.9 ⁇ m SEC column (Agilent) equipped on a 1260 Infinity II Bioinert HPLC system for the determination of aggregates and other higher and low molecular weight mass species.
- Antibody samples were run with a linear gradient using 1xPBS (pH7.2) at a flow rate of 0.3 mL/min for 10 min with Ultraviolet (UV) absorbance monitoring at 280 nm.
- UV Ultraviolet
- the eluted protein was quantified by UV absorbance and integration of peak areas.
- BEH SEC protein standard mix Waters served as a standard.
- Hydrophobic interaction chromatography was performed using AdvanceBio HIC (4.6x100 mm).
- Antibody samples were mixed 1:1 with buffer A (1.8 M ammonium sulfate in 0.1 M Na-phosphate buffer pH 7.2) and run with a linear gradient using mobile phase A and B (0.1 M Na-phosphate buffer pH7.2) over 20 min at a flow rate of 0.4 mL/min with UV absorbance monitoring at 280 nm.
- the thermal stability of the antibodies was determined by differential scanning calorimetry (DSC) using Nano DSC calorimeter (TA Instrument).
- DSC differential scanning calorimetry
- samples were prepared in 1xPBS in 1 mg/mL concentration, loaded into sample cell and scanned at 1 °C/min increment from 25 to 95 °C. Data was analyzed using NanoAnalyzer program subtracting PBS buffer background from each individual scan.
- NuPAGE Pre-Cast gel system (Invitrogen) was used according to the manufacturer's instruction.
- 4-12% NuPAGE Novex Bis-TRIS Pre-Cast gels (pH 6.4) and a NuPAGE MES (reduced gels, with NuPAGE Antioxidant running buffer additive) or MOPS (non-reduced gels) running buffer was used.
- Half of the sample was combined with NuPAGE Sample Reducing Agent or left unreduced, respectively, and heated for 10 min at 70°C.
- bispecific antibodies have high thermal stability, high protein integrity and efficient and accurate assembly of light chain and heavy chain components.
- Enzyme Linked Immunosorbent Assay [0733] The bispecific variants without any undesired mass (HMMS or LMMS) on aSEC and on NuPAGE gel electrophoresis were advanced for further analysis by sandwich ELISA for binding to their corresponding antigens. Maxisorp plates (Nunc) were coated with proteins at a concentration of 1 ⁇ g/ml in bicarbonate buffer pH 9.2 or PBS, pH 7.22 for 16 hours at 4 °C. All subsequent steps were performed at room temperature.
- Bispecific antibodies were functional and able to engage both the disease associated antigen (i.e. ULBP2) and CD3 antigens simultaneously (FIGS.4A-4B).
- Mass Spectrometry [0735] The selected bispecific variants with desired biophysical properties were further characterized by mass spectrometry to determine intact antibody mass, and reduced masses of heavy chains and light chains, and the specificity of assembly of light chains with corresponding heavy chains was assessed. [0736] The intact mass of the purified fusion proteins and antibody chains was confirmed by Xevo G2-XS QTof Quadrupole Time-of-Flight Mass Spectrometry coupled to a Acquity UHPLC system (Waters) equipped with a Protein BEH C4 (300 ⁇ 1.7 ⁇ m) column.
- Antibody samples were deglycosylated first using rapid PNGase F enzyme (New England Biolabs) in reducing and non-reducing conditions following supplier’s protocols. Reaction mixture was diluted to 1:10 in 50% Acetonitrile containing 0.1% Formic acid and 2 ⁇ L of which was injected into LC-MS. The total ion chromatogram and m/z data of the proteins were acquired with gradient run of 10 to 70 mL HPLC grade acetonitrile over 12 min. Mass of the protein samples was deconvoluted from total ion chromatogram using BYOS software from Protein Metrics. [0737] Deconvoluted intact mass of one of the representative bispecific variant EIP0205 is shown in FIG.5A.
- FIGS.5E-5F The expected sizes for corresponding heavy chain masses (FIG.5B) and light chain masses (FIG.5C) were observed. No species or masses that corresponds to mispairing of the light chains with non-cognate heavy chains were observed. Relative intensity ratio of 1:1 of two heavy chains and two light chains suggests that the bispecific antibody is fully intact with near 100% cognate pairing. Certain bispecific antibodies which failed to achieve complete cognate pairing, the intact masses for mis-paired LC and HC were easily observable from deconvoluted ion chromatogram shown in FIG.5D, as ‘mis- paired mass species’. The deconvoluted masses of reduced heavy chains and light chains are shown in FIGS.5E-5F.
- EIP0174, EIP0175, EIP0187, EIP0205, EIP0206, EIP0207, EIP0208, EIP0294, EIP0295, EIP0306, EIP0307, EIP0318, EIP0342, EIP0344, EIP0356, EIP0377, EIP0598) were constructed with sixteen different mutation sets (A-P).
- Each bispecific antibody has identical CDRs that bind to ULBP2 (derived from “E12” antibody) and identical CDRs that bind to CD3 (derived from “SP34” antibody), but differed in (i) knob-into-hole mutations to promote efficient heavy chain heterodimerization and (ii) charged pairing (VH1 and VL1 interface and/or VH2 and VL2 interface, and CH1 H1 and CL1 interface and/or CH2 H1 and CL2 interface) and disulfide stabilization mutations (between CH1 H1 and CL1 interface and/or CH2 H1 and CL2 interface), which together promote correct cognate pairing of heavy chain and light chains.
- T-cell Mediated Cytotoxicity Assay T cells were isolated from healthy human PBMCs donors using StemCell T-cell isolation kit and resuspended in RPMI was supplemented with 10% FBS, 1X penicillin/streptomycin.
- T cells were incubated with IL-7 (10 ng/ml) and IL-15 (10 ng/ml) in supplemented in media for an additional 7 days. The supplemented media was replaced with freshly thawed cytokines (IL7 and IL15) every 48 hours.
- Human tumor cells were seeded at 10,000 cells per well in 96- well tissue culture plates (Perkin Elmer) and incubated for 24 hours at 37 °C with 5 % CO 2 .
- na ⁇ ve or activated human T cells 50-100,000 or PBMCs (250-300,000) were added to tumor cells in the presence or absence of antibodies and incubated for up to 3-7 days.
- Cytolysis of Green Fluorescent Protein engineered MDA-MB-231 and HCT116 (Genecopoeia) cells were visualized using fluorescent plate reader (Ensight, Perkin Elmer). Cytolysis of CORL105 and SiHa cells were measured using the LDH-Glo cytotoxicity assay (Promega).
- the bispecific variants with complete cognate pairing were then tested for their functional cytolytic activity using T cell or PBMC and tumor cell co-culture cytotoxicity assay with different E:T ratio.
- EXAMPLE 5 Characterization ⁇ ULBP2- ⁇ BCMA and ⁇ ULBP2- ⁇ EGFR Bispecific Antibodies With Mutations That Promote Heavy Chain And Light Chain Heterodimerization
- the mutations sets from EIP0187, EIP0205, EIP0356, EIP0377, and EIP0598 were used to engineer asymmetric bispecifics using other therapeutically validated antibodies against different disease-associated antigen targets such as EGFR (Cetuximab) and BCMA (Belantamab) described in PCT application WO1996040210 and US application US20140105915, respectively, each of which is incorporated herein by reference.
- the purified bispecific antibodies were tested for their target binding, thoroughly characterized by mass spectrometry for specificity and correct LC and HC pairings, and functionally evaluated in retargeted T cell cytotoxicity assay.
- the biophysical and functional characterization data summarized in FIGS.7A-7E and Table 33 suggest that the bispecific variants engineered with different target arms achieved 100% specificity and complete cognate LC/HC pairing with fully functional asymmetric bispecific antibody. This indicates that these novel combinations of mutation sets (compensatory charge pairing and disulfide stabilized mutations) could be applied universally to engineer asymmetric bispecific or multispecific antibodies.
- Table 33 Characteristics of bispecific antibodies utilizing light chain pairing mutation set D.
- EXAMPLE 6 Affinity Modulation of Anti-CD3 Antibodies
- Kinetic binding analysis of CD3 affinity variant antibodies [0751] The binding kinetics of ULBP2xCD3 bispecific CD58 fusions containing CD3 variants to human and cynomolgus CD3 epsilon/delta heterodimer was determined using surface plasmon resonance (SPR) for which the kinetic constants are summarized in Table 34. [0752] Table 34.
- mutants of the humanized SP34 antibody in which a single CDR position was substituted with alanine were displayed as scFv on the surface of yeast and binding of recombinant human CD3 epsilon was assessed using flow cytometry.
- Several strategies were used to identify SP34 mutants with a range of affinities to CD3 epsilon. In one strategy, alanine mutants with observed reductions in CD3 affinity were selected from the alanine scanning analysis described above. In a second strategy, alanine mutants with reduced CD3 affinity were interrogated using molecular modeling in order to replace alanine substitution with alternative amino acids in order to better modulate the degree of affinity reduction.
- Bispecific Antibodies with SP34 having CDR mutations in the Variable Heavy and Variable Light Chain Domains *Mutants for which human and cynomolgus CD3 binding and NFAT activation for SiHa and HCT116 cell lines are reported is indicated in bold.
- Bispecific antibodies were produced with SP34 affinity mutants and the ULBP2 antibody E12 using light chain pairing set D and evaluated for monovalent binding to human and cynomolgus CD3 epsilon by ELISA (FIG.8A-8B).
- Three bispecific SP34 mutants, EIP0527 EIP0540 and EIP542 Retained similar strong affinity to the bispecific having a SP34 arm without mutations (EIP0205).
- cytolytic activity was also directly correlated with the levels of ULBP2 on the tumor cells.
- the EC50 for EIP0483 among the 3 cell lines are: SiHa, 1.11 nM; MDA-MB-23, 2.93 nM; and HCT116, 71.21 nM.
- T cell secreted cytokines IFN ⁇ , IL-2, and TNF ⁇
- Human tumor cells were seeded at 10,000 cells per well in 96-well tissue culture plates (Perkin Elmer) and incubated for 24 hours at 37 °C with 5 % CO 2 .
- Na ⁇ ve or activated human T cells 50-100,000 or PBMCs (250-300,000) were added to tumor cells in the presence or absence of antibodies and incubated for an additional 24-48 hours.
- Conditioned media was then transferred to separate 96-well plate and centrifuged (1000 x g) for 5 min to pellet cells.
- EXAMPLE 7 Production and biophysical characterization of ⁇ ULBP2- ⁇ CD3 Bispecific Antibodies with Fusion Peptides
- the crystal structure of human CD58 in complex with human CD2 confirmed that the interface occurs through amino terminal or IgV-like domain of CD58 (CD58v) which is one of two domain in the extracellular region (the other CD58 domain is IgC2-like; https://doi.org/10.3389/fimmu.2018.01204) and the amino-terminal domain of CD2 (Sung H, Ferlay J, Siegel RL, Laversanne M, Soerjomataram I, Jemal A, Bray F.
- CD58 or CD58v may be functional as both amino and carboxyl terminal fusions to all four antibody chains of the bispecific antibody allowing several formats possible (FIG.12A-12K).
- Bispecific fusion was generated by fusing the full-length extracellular domain of CD58 (UNIPROTKB: P19256, amino acids: 29-216), CD58v (amino acids: 29-122), IL7 (UNIPROTKB: P13232, amino acids: 26-177) using glycine serine linker to the carboxyl- terminus of the hole heavy chain of the bispecific consisting of ULBP2 antibody E12 and CD3 antibody SP34 (EIP0205).
- FIG.13 shows the size exclusion chromatograms of bispecific ⁇ ULBP2- ⁇ CD3 (EIP0205) and bispecific fusions: ⁇ ULBP2- ⁇ CD3-CD58 (EIP0359), ⁇ ULBP2- ⁇ CD3- CD58v (EIP0360), and ⁇ ULBP2- ⁇ CD3-IL7 (EIP0363) following elution from protein A.
- EXAMPLE 8 In vitro functional characterization of bispecific antibodies with fusion peptides [0772] The activity of bispecific fusion, ⁇ ULBP2- ⁇ CD3-CD58 (EIP0359), was compared to the bispecific, ⁇ ULBP2- ⁇ CD3 bispecific (EIP0205), in a cytotoxicity assay with na ⁇ ve T cells co-cultured with MDA-MB-231 GFP/luciferase cells.
- ⁇ ULBP2- ⁇ CD3-CD58 showed greater cytolytic activity than ⁇ ULBP2- ⁇ CD3 as indicated by EC50 (3-fold lower concentration) and maximum cell death (9% increase).
- T cell cytokines IFN ⁇ , IL-2 and TNF ⁇ were also measured from the media of na ⁇ ve T cells co-cultured with MDA-MB-231 GFP/luciferase cells in the presence of bispecific ⁇ ULBP2- ⁇ CD3 (EIP0205) and the bispecific fusion, ⁇ ULBP2- ⁇ CD3-CD58 (EIP0359) after 24 hours.
- the Control- ⁇ CD3 bispecific did not induce cytokines from both parental and ULBP2-deficient MDA-MB-231 cells.
- Bispecific SP34 affinity mutants and their cognate CD58 fusions were evaluated for cytotoxicity (FIGS.20 and 21) and for cytokine release (FIGS.22-27) using in a co-culture assay with SiHa cells and activated T cells. Significant improvements in cytotoxicity were observed as measured both in EC50 and in maximum cell death when CD58 was fused to bispecifics with lower CD3 affinity. In general, the improvement in cytolytic activity of the bispecific CD58 fusion compared to the bispecific was inversely related to the CD3 affinity of the bispecific.
- the lowest CD3 affinity bispecific, EIP0477 induces minimal cell death only at the highest concentration of antibody with undetermined EC50 (FIGS.20 and 21), whereas the equivalent bispecific CD58 fusion (EIP0560) induced 98% cell death with an EC50 of 0.15 nM.
- EIP0562 the fusion of CD58 (EIP0562) improved cytotoxicity modestly lowering the EC50 concentration by 3-fold (FIG.20).
- the gain of cytokine release for the bispecific CD58 fusion compared to the bispecific was inversely related to the CD3 affinity of the bispecific.
- the therapeutic window can be modulated, as defined by balance of cytotoxicity and cytokine release, to suit a variety of tumor antigens with different expression patterns both in distribution and in absolute receptor number.
- Bispecific fusion with CD58v, ⁇ ULBP2- ⁇ CD3-CD58v show similar improvements in cytolytic activity as the ⁇ ULBP2- ⁇ CD3-CD58 (EIP0359) compared to the bispecific ⁇ ULBP2- ⁇ CD3 (EIP0205) as determined by the cytolysis of MDA-MB-231 GFP cells using human PBMCs (FIG.28).
- the improved activity of bispecific fusion, ⁇ ULBP2- ⁇ CD3-CD58 (EIP0141) is dependent on the physical linkage between CD58 and the bispecific ULBP2-CD3 bispecific.
- na ⁇ ve CD8 T cells were first subjected to increasing rounds of stimulation with each round consisting of a 2-day incubation with Dynabeads coupled to anti-CD3 and anti- CD28 antibodies.
- the ⁇ ULBP2- ⁇ CD3-CD58 was able to induce cytolysis of tumor cells even with exhausted T cells from round 5, while the activity of ULBP2-CD3 peaked with early exhausted T cells from round 3 (FIG.30).
- the Control- ⁇ CD3 bispecific (EIP0209) did not induce cytolysis from both na ⁇ ve or exhausted T cells.
- T cell markers intracellular and cell surface markers of T cell activation and exhaustion in CD8 T cells from co-cultures of human PBMCs with MDA-MB-231 cells in the presence of bispecific, ⁇ ULBP2- ⁇ CD3 (EIP0205) and the bispecific fusion, ⁇ ULBP2- ⁇ CD3-CD58 (EIP0359) was assessed.
- the MFI for each marker was normalized for the ULBP2-CD3 bispecific and represented in a radar plot (FIG.31).
- ⁇ ULBP2- ⁇ CD3-CD8 Compared to the ⁇ ULBP2- ⁇ CD3, ⁇ ULBP2- ⁇ CD3-CD8, produced a distinct phenotype that is consistent with greater T cell activation as observed by the increased levels of IFN ⁇ , CD25 and GZMB.
- T cells appeared to be less exhausted when treated with ⁇ ULBP2- ⁇ CD3-CD58 bispecific fusion as evidenced by the reduction in CD38 and no increase seen for TIM3 compared to ⁇ ULBP2- ⁇ CD3.
- the Control- ⁇ CD3 (EIP0209) which does not bind to any known target protein on MDA-MB-231 cells, did not induce expression in any of the markers. This is consistent with the mechanism of CD3 bispecifics which require the presence of the target for T cell activation to occur.
- T cell proliferation induced by CD3 affinity variant antibodies Differences in CD8+ T cell proliferation induced by bispecifics versus bispecific CD58 fusions across the different CD3 affinities were observed using a T cell stimulation assay. Freshly isolated na ⁇ ve T cells were repeatedly exposed to Dynabeads coupled bispecifics and bispecfic CD58 fusions for successive rounds of 48-72 hour stimulation. Table 36 shows the CD8 T cell counts following each round of stimulation. As shown in Table 36, none of the bispecifics induce significant T cell proliferation beyond round 2 whereas all bispecific CD58 fusions continued to stimulate proliferation up to round 7. [0781] Table 36.
- CD58 fusion to asymmetric CD3 bispecifics using therapeutically validated antibodies cetuximab (EGFR), belantamab (BCMA), denintumab (CD19) and obexelimab (CD19) was demonstrated to lead to improvements in tumor cell cytotoxicity, as shown in FIGS.36A-36C.
- HCT116 colon carcinoma cells were co-cultured with activated T cells in the presence of EIP0373 (CetuximabxCD3-01), EIP0535 (CetuximabxCD3-01xCD58) EIP0546 (ControlxCD3-01) and EIP0607 (ControlxCD3- A5xCD58).
- EIP0373 CetuximabxCD3-01
- EIP0535 CetuximabxCD3-01xCD58
- EIP0546 ControlxCD3-01
- EIP0607 ControlxCD3- A5xCD58
- U266B1 multiple myeloma cells were co-cultured with activated T cells in the presence of EIP0506 (BelantamabxCD3-01), EIP0524 (BelantamabxCD3- 01xCD58), and EIP0546 (ControlxCD3-01).
- JeKo-1 mantle lymphoma cells were co-cultured with activated T cells in the presence of EIP0870 (DenintumabxCD3- A6xCD58), EIP0872 (ObexelimabxCD3-A5xCD58), and EIP0607 (ControlxCD3- A5xCD58).
- EIP0870 DenintumabxCD3- A6xCD58
- EIP0872 ObexelimabxCD3-A5xCD58
- EIP0607 ControlxCD3- A5xCD58.
- TNB-383B BCMA
- TNB-486 CD19
- TNB-585 are CD3 bispecifics in various stages of clinical development.
- PSMA negative LNCAP prostate cancer cells generated by CRISPR-Cas9 inactivation of PSMA gene
- PSMA encoding lentivirus created by CRISPR-Cas9 inactivation of PSMA gene
- This cell line was co-cultured with activated T cells in the presence of EIP0993 (TNB-585xCD8), EIP0992 (TNB-585), and EIP0607 (ControlxCD3-A5xCD58).
- EIP0993 TB-585xCD8
- EIP0992 TB-585
- EIP0607 ControlxCD3-A5xCD58
- MM1S multiple myeloma cells were co- cultured with activated T cells in the presence of EIP0765 (TNB-383B), EIP0766 (TNB- 383BxCD58), EIP0546 (ControlxCD3-01), and EIP0607 (ControlxCD3-A5xCD58).
- Engineered disulfide improves expression and increases homogeneity of antibodies
- An engineered disulfide through cysteine substitutions at Y370 and S375 (Kabat numbering) in the CH2 regions of TNB-383B sequence (Publication No. US20210403587A1) can improve expression titers and increased homogeneity of the antibody post protein A purification as observed by size exclusion chromatography, as shown in FIG.37. [0791] Table 37.
- EXAMPLE 9 In Vivo Characterization of Bispecific Antibodies with fusion peptides [0793] Expansion of T cells for in vivo studies [0794] T-cells were isolated from healthy PBMCs donors using StemCell T-cell isolation kit. OpTmizer media was supplemented with 2% human AB serum, 1X penicillin/streptomycin, 4mM GlutaMAX, 2 mM Glutamine.
- T cells were incubated at 37°C in 5% CO 2 in the supplemented OpTmizer media at 5 ⁇ 10 5 cells/mL and T cells were treated with ⁇ CD3 and ⁇ CD28 antibody coated Dynabeads at a ratio of 25 ⁇ L dynabeads per million cells for 48 hours.
- T cells were incubated with IL-7 (10 ng/ml) and IL-15 (10 ng/ml) in supplemented OpTmizer media for an additional 6 days.
- the supplemented media was replaced with freshly thawed cytokines (IL7 and IL15) every 48 hours.
- T-cells are harvested and a hemocytometer was used to determine cell number and viability. T cells were suspended in cold PBS and stored on ice for no longer than 30 minutes until injection.
- Tumor studies with adoptive human T cell transfer [0796] SiHa tumor cells were initially cultured from frozen stock in an DMEM with 10% fetal bovine serum (FBS) media and incubated at 37 °C in 5% CO 2 in treated cell culture flasks. Cells were then split every 2-3 days pending the cell density in the culture flasks. On the days of implantation cells were dissociated from the flask using TrypLE Select and washed twice with PBS.
- FBS fetal bovine serum
- mice were randomized into following treatment groups where each group had similar mean tumor volumes with each group receiving Control- ⁇ CD3 (EIP0546), ⁇ ULBP2- ⁇ CD3 (EIP0205) and ⁇ ULBP2- ⁇ CD3-CD58 (EIP0359) at a dose level of 4 mg/kg) by tail vein infusion on Day 21 after the initial implantation.
- Control- ⁇ CD3 EIP0546
- ⁇ ULBP2- ⁇ CD3 EIP0205
- ⁇ ULBP2- ⁇ CD3-CD58 EIP0359
- mice Eight million SiHa cells and 1.6 million activated human T cells were implanted subcutaneously into flank of 9 NSG mice. The mice were then separated into 3 groups and treated with the following agents: Control- ⁇ CD3 (EIP0546), ⁇ ULBP2- ⁇ CD3 (EIP0205) and ⁇ ULBP2- ⁇ CD3-CD58 (EIP0359) at a dose of 4 mg/kg by tail vein infusion immediately after co-engraftment. Three days later, all tumors from same treatment group were harvested and pooled prior to tumor dissociation.
- Control- ⁇ CD3 EIP0546
- ⁇ ULBP2- ⁇ CD3 EIP0205
- EIP0359 ⁇ ULBP2- ⁇ CD3-CD58
- EIP0561 Concentration of EIP0561 per animal by time determined by sandwich ELISA.
- AUCLST (ug/L*h), area under the curve from the time of dosing to the time of the last observation; C0 (ug/L), concentration at first time point; CMAX (ug/L), maximal concentration, occurring at TMAX; CLST (ug/L), concentration at last time point; LAMZHLD (days), terminal half-life (days); CLO (L/h), total body clearance based on CLST; VSSO (L), estimated volume of distribution at steady state based on CLST; VZO (L), volume of distribution associated with the terminal phase, based on CLST.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Cell Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Dispersion Chemistry (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3254549A CA3254549A1 (en) | 2022-03-18 | 2023-03-20 | BISPECIFIC ANTIBODY FUSION MOLECULES AND THEIR METHODS OF USE |
| KR1020247032451A KR20250005568A (ko) | 2022-03-18 | 2023-03-20 | 이중특이성 항체 융합 분자 및 이의 사용 방법 |
| IL315714A IL315714A (en) | 2022-03-18 | 2023-03-20 | Bispecific antibody fusion molecules and methods of using them |
| JP2024555332A JP2025509824A (ja) | 2022-03-18 | 2023-03-20 | 二特異性抗体融合分子及びその使用方法 |
| EP23717791.0A EP4493593A1 (en) | 2022-03-18 | 2023-03-20 | Bispecific antibody fusion molecules and methods of use thereof |
| AU2023236386A AU2023236386A1 (en) | 2022-03-18 | 2023-03-20 | Bispecific antibody fusion molecules and methods of use thereof |
| CN202380040726.5A CN119562970A (zh) | 2022-03-18 | 2023-03-20 | 双特异性抗体融合分子及其使用方法 |
| US18/847,825 US20250197496A1 (en) | 2022-03-18 | 2023-03-20 | Bispecific antibody fusion molecules and methods of use thereof |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202263321563P | 2022-03-18 | 2022-03-18 | |
| US63/321,563 | 2022-03-18 | ||
| US202263330250P | 2022-04-12 | 2022-04-12 | |
| US63/330,250 | 2022-04-12 | ||
| US202263368852P | 2022-07-19 | 2022-07-19 | |
| US63/368,852 | 2022-07-19 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023178357A1 true WO2023178357A1 (en) | 2023-09-21 |
Family
ID=86052253
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2023/064728 Ceased WO2023178357A1 (en) | 2022-03-18 | 2023-03-20 | Bispecific antibody fusion molecules and methods of use thereof |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20250197496A1 (https=) |
| EP (1) | EP4493593A1 (https=) |
| JP (1) | JP2025509824A (https=) |
| KR (1) | KR20250005568A (https=) |
| CN (1) | CN119562970A (https=) |
| AU (1) | AU2023236386A1 (https=) |
| CA (1) | CA3254549A1 (https=) |
| IL (1) | IL315714A (https=) |
| WO (1) | WO2023178357A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024130032A1 (en) * | 2022-12-14 | 2024-06-20 | Evolveimmune Therapeutics, Inc. | Bispecific antibody fusion molecules and methods of use thereof |
| WO2024173607A2 (en) | 2023-02-14 | 2024-08-22 | Evolveimmune Therapeutics, Inc. | Combination of bispecific antibodies and chimeric antigen receptor t cells for treatment |
| WO2025064890A1 (en) | 2023-09-20 | 2025-03-27 | Evolveimmune Therapeutics, Inc. | Bispecific antibody fusion molecules targeting cd180 and cd3 and methods of use thereof |
| WO2025085512A1 (en) * | 2023-10-16 | 2025-04-24 | Evolveimmune Therapeutics, Inc. | Combination therapies with ulbp2 targeting antibodies for treating cancers |
Citations (58)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| EP0003089A1 (fr) | 1978-01-06 | 1979-07-25 | Bernard David | Séchoir pour feuilles imprimées par sérigraphie |
| US4485045A (en) | 1981-07-06 | 1984-11-27 | Research Corporation | Synthetic phosphatidyl cholines useful in forming liposomes |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US4544545A (en) | 1983-06-20 | 1985-10-01 | Trustees University Of Massachusetts | Liposomes containing modified cholesterol for organ targeting |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| US5013556A (en) | 1989-10-20 | 1991-05-07 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US5030719A (en) | 1986-08-28 | 1991-07-09 | Teijin Limited | Cytotoxic antibody conjugates and a process for preparation thereof |
| WO1992020373A1 (en) | 1991-05-14 | 1992-11-26 | Repligen Corporation | Heteroconjugate antibodies for treatment of hiv infection |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1994002602A1 (en) | 1992-07-24 | 1994-02-03 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1994011026A2 (en) | 1992-11-13 | 1994-05-26 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| WO1995022618A1 (en) | 1994-02-22 | 1995-08-24 | Dana-Farber Cancer Institute | Nucleic acid delivery system, method of synthesis and uses thereof |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| WO1996027011A1 (en) | 1995-03-01 | 1996-09-06 | Genentech, Inc. | A method for making heteromultimeric polypeptides |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5916771A (en) | 1996-10-11 | 1999-06-29 | Abgenix, Inc. | Production of a multimeric protein by cell fusion method |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| WO1999053049A1 (en) | 1998-04-15 | 1999-10-21 | Abgenix, Inc. | Epitope-driven human antibody production and gene expression profiling |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2004056312A2 (en) | 2002-12-16 | 2004-07-08 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| US20050014934A1 (en) | 2002-10-15 | 2005-01-20 | Hinton Paul R. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| WO2005063820A2 (en) | 2003-12-30 | 2005-07-14 | Merck Patent Gmbh | Il-7 fusion proteins |
| WO2007042261A2 (en) | 2005-10-11 | 2007-04-19 | Micromet Ag | Compositions comprising cross-species-specific antibodies and uses thereof |
| US7371826B2 (en) | 1999-01-15 | 2008-05-13 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US20090182127A1 (en) | 2006-06-22 | 2009-07-16 | Novo Nordisk A/S | Production of Bispecific Antibodies |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| US20100111856A1 (en) | 2004-09-23 | 2010-05-06 | Herman Gill | Zirconium-radiolabeled, cysteine engineered antibody conjugates |
| WO2010135558A1 (en) | 2009-05-20 | 2010-11-25 | Novimmune S.A. | Systhetic polypeptide libraries and methods for generating naturally diversified polypeptide variants |
| WO2011084255A2 (en) | 2009-12-17 | 2011-07-14 | Novimmune S.A. | Synthetic polypeptide libraries and methods for generating naturally diversified polypeptide variants |
| WO2012023053A2 (en) | 2010-08-16 | 2012-02-23 | Novimmune S.A. | Methods for the generation of multispecific and multivalent antibodies |
| WO2013088259A2 (en) | 2011-10-19 | 2013-06-20 | Novimmune S.A. | Methods of purifying antibodies |
| US20140105915A1 (en) | 2011-05-27 | 2014-04-17 | Glaxo Group Limited | Bcma (cd269/tnfrsf17) - binding proteins |
| WO2016105450A2 (en) * | 2014-12-22 | 2016-06-30 | Xencor, Inc. | Trispecific antibodies |
| US9502140B2 (en) | 2013-03-22 | 2016-11-22 | Kabushiki Kaisha Toshiba | Semiconductor memory device |
| WO2016204966A1 (en) | 2015-06-16 | 2016-12-22 | Genentech, Inc. | Anti-cd3 antibodies and methods of use |
| WO2017055539A1 (en) * | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Multispecific antibodies |
| WO2019204522A1 (en) * | 2018-04-17 | 2019-10-24 | Invenra Inc. | Binding molecules |
| WO2020136566A1 (en) * | 2018-12-24 | 2020-07-02 | Sanofi | Multispecific binding proteins with mutant fab domains |
| WO2020236655A1 (en) | 2019-05-17 | 2020-11-26 | Xencor, Inc. | Il-7-fc-fusi0n proteins |
| US20210403587A1 (en) | 2020-04-29 | 2021-12-30 | Teneobio, Inc. | Methods of treating multiple myeloma |
-
2023
- 2023-03-20 WO PCT/US2023/064728 patent/WO2023178357A1/en not_active Ceased
- 2023-03-20 EP EP23717791.0A patent/EP4493593A1/en active Pending
- 2023-03-20 CN CN202380040726.5A patent/CN119562970A/zh active Pending
- 2023-03-20 KR KR1020247032451A patent/KR20250005568A/ko active Pending
- 2023-03-20 AU AU2023236386A patent/AU2023236386A1/en active Pending
- 2023-03-20 IL IL315714A patent/IL315714A/en unknown
- 2023-03-20 JP JP2024555332A patent/JP2025509824A/ja active Pending
- 2023-03-20 CA CA3254549A patent/CA3254549A1/en active Pending
- 2023-03-20 US US18/847,825 patent/US20250197496A1/en active Pending
Patent Citations (60)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| EP0003089A1 (fr) | 1978-01-06 | 1979-07-25 | Bernard David | Séchoir pour feuilles imprimées par sérigraphie |
| US4485045A (en) | 1981-07-06 | 1984-11-27 | Research Corporation | Synthetic phosphatidyl cholines useful in forming liposomes |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4544545A (en) | 1983-06-20 | 1985-10-01 | Trustees University Of Massachusetts | Liposomes containing modified cholesterol for organ targeting |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5030719A (en) | 1986-08-28 | 1991-07-09 | Teijin Limited | Cytotoxic antibody conjugates and a process for preparation thereof |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| US5013556A (en) | 1989-10-20 | 1991-05-07 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1992020373A1 (en) | 1991-05-14 | 1992-11-26 | Repligen Corporation | Heteroconjugate antibodies for treatment of hiv infection |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| WO1994002602A1 (en) | 1992-07-24 | 1994-02-03 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1994011026A2 (en) | 1992-11-13 | 1994-05-26 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| WO1995022618A1 (en) | 1994-02-22 | 1995-08-24 | Dana-Farber Cancer Institute | Nucleic acid delivery system, method of synthesis and uses thereof |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| WO1996027011A1 (en) | 1995-03-01 | 1996-09-06 | Genentech, Inc. | A method for making heteromultimeric polypeptides |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5916771A (en) | 1996-10-11 | 1999-06-29 | Abgenix, Inc. | Production of a multimeric protein by cell fusion method |
| US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO1999053049A1 (en) | 1998-04-15 | 1999-10-21 | Abgenix, Inc. | Epitope-driven human antibody production and gene expression profiling |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7371826B2 (en) | 1999-01-15 | 2008-05-13 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US20050014934A1 (en) | 2002-10-15 | 2005-01-20 | Hinton Paul R. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| WO2004056312A2 (en) | 2002-12-16 | 2004-07-08 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| WO2005063820A2 (en) | 2003-12-30 | 2005-07-14 | Merck Patent Gmbh | Il-7 fusion proteins |
| US20100111856A1 (en) | 2004-09-23 | 2010-05-06 | Herman Gill | Zirconium-radiolabeled, cysteine engineered antibody conjugates |
| WO2007042261A2 (en) | 2005-10-11 | 2007-04-19 | Micromet Ag | Compositions comprising cross-species-specific antibodies and uses thereof |
| US20090182127A1 (en) | 2006-06-22 | 2009-07-16 | Novo Nordisk A/S | Production of Bispecific Antibodies |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2010135558A1 (en) | 2009-05-20 | 2010-11-25 | Novimmune S.A. | Systhetic polypeptide libraries and methods for generating naturally diversified polypeptide variants |
| WO2011084255A2 (en) | 2009-12-17 | 2011-07-14 | Novimmune S.A. | Synthetic polypeptide libraries and methods for generating naturally diversified polypeptide variants |
| WO2012023053A2 (en) | 2010-08-16 | 2012-02-23 | Novimmune S.A. | Methods for the generation of multispecific and multivalent antibodies |
| US20140105915A1 (en) | 2011-05-27 | 2014-04-17 | Glaxo Group Limited | Bcma (cd269/tnfrsf17) - binding proteins |
| WO2013088259A2 (en) | 2011-10-19 | 2013-06-20 | Novimmune S.A. | Methods of purifying antibodies |
| US9502140B2 (en) | 2013-03-22 | 2016-11-22 | Kabushiki Kaisha Toshiba | Semiconductor memory device |
| WO2016105450A2 (en) * | 2014-12-22 | 2016-06-30 | Xencor, Inc. | Trispecific antibodies |
| WO2016204966A1 (en) | 2015-06-16 | 2016-12-22 | Genentech, Inc. | Anti-cd3 antibodies and methods of use |
| WO2017055539A1 (en) * | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Multispecific antibodies |
| WO2019204522A1 (en) * | 2018-04-17 | 2019-10-24 | Invenra Inc. | Binding molecules |
| WO2020136566A1 (en) * | 2018-12-24 | 2020-07-02 | Sanofi | Multispecific binding proteins with mutant fab domains |
| WO2020236655A1 (en) | 2019-05-17 | 2020-11-26 | Xencor, Inc. | Il-7-fc-fusi0n proteins |
| US20210403587A1 (en) | 2020-04-29 | 2021-12-30 | Teneobio, Inc. | Methods of treating multiple myeloma |
Non-Patent Citations (89)
| Title |
|---|
| "Advances In Parenteral Sciences", vol. 4, 1991, M. DEKKER, article "Peptide And Protein Drug Delivery" |
| "Conjugate Vaccines", 1989, CARGER PRESS, article "Contributions to Microbiology and Immunology" |
| "Drug Absorption Enhancement: Concepts, Possibilities, Limitations, And Trend", 1994, HARWOOD ACADEMIC PUBLISHERS |
| "ELISA: Theory and Practice: Methods in Molecular Biology", vol. 42, 1995, MACK PUB. CO |
| "Proteins, Structures and Molecular Principles", 1984, W. H. FREEMAN AND COMPANY |
| "Remington's Pharmaceutical Sciences", 1975, MACK PUBLISHING |
| "UniProt", Database accession no. Q9BZM5 |
| BAKER, D. ET AL.: "Clearance of pl6Ink4a-positive senescent cells delays ageing-associated disorders", NATURE, vol. 479, 2011, pages 232 - 236, XP055074325, DOI: 10.1038/nature10600 |
| BAKER, D. J. ET AL.: "Naturally occurring pl6Ink4a-positive cells shorten healthy lifespan", NATURE, vol. 530, 2016, pages 184 - 189, XP093027320, DOI: 10.1038/nature16932 |
| BALDRICK P.: "Pharmaceutical excipient development: the need for preclinical guidance", REGUL. TOXICOL PHARMACOL, vol. 32, no. 2, 2000, pages 210 - 8 |
| BOBO ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 2076 - 2080 |
| BOWIE ET AL., SCIENCE, vol. 253, no. 164, 1991 |
| CARON ET AL., J EXP MED, vol. 176, 1992, pages 1191 - 1195 |
| CARON ET AL., J. EXP MED., vol. 176, 1992, pages 1191 - 1195 |
| CHARMAN WN: "Lipids, lipophilic drugs, and oral drug delivery-some emerging concepts", J PHARM SCI, vol. 89, no. 8, 9 December 1999 (1999-12-09), pages 967 - 78, XP008099512 |
| CHEN SHIXUE ET AL: "Immunoglobulin Gamma-Like Therapeutic Bispecific Antibody Formats for Tumor Therapy", JOURNAL OF IMMUNOLOGY RESEARCH, vol. 2019, 11 February 2019 (2019-02-11), US, pages 1 - 13, XP055856655, ISSN: 2314-8861, Retrieved from the Internet <URL:http://downloads.hindawi.com/journals/jir/2019/4516041.xml> DOI: 10.1155/2019/4516041 * |
| CHILDS, B. G. ET AL.: "Senescent cells: an emerging target for diseases of ageing", NAT. REV. DRUG DISCOV, vol. 16, 2017, pages 718 - 735, XP055979258, DOI: 10.1038/nrd.2017.116 |
| CHOTHIALESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CONRAD, ML., DAVISW. CKOOP, B. F: "TCR and CD3 antibody cross-reactivity in 44 species", CYTOMETRY A, vol. 71, 2007, pages 925 - 933, XP055151407, DOI: 10.1002/cyto.a.20435 |
| COTE ET AL., PROC NATL ACAD SCI USA, vol. 80, 1983, pages 2026 - 2030 |
| CUNNINGHAMAND, SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| D. WILKINSON: "The Scientist", vol. 14, 17 April 2000, THE SCIENTIST, INC, pages: 25 - 28 |
| DAVIDSON ET AL., NAT. GENET, vol. 259, 1993, pages 219 |
| DAVIES ET AL., ANNUAL REV BIOCHEM, vol. 59, 1990, pages 1149 - 473 |
| DEMARIA, M. ET AL.: "Cellular Senescence Promotes Adverse Effects of Chemotherapy and Cancer Relapse", CANCER DISCOV, vol. 7, 2017, pages 165 - 176 |
| DUDGEON, K ET AL.: "General strategy for the generation of human antibody variable domains with increased aggregation resistance", PROC NATL ACAD SCI U S A, vol. 109, 2012, pages 10879 - 10884, XP055084733, DOI: 10.1073/pnas.1202866109 |
| E. DIAMANDIST. CHRISTOPOULUS: "Immunoassay", 1996, ACADEMIC PRESS, INC |
| EPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688 - 96 |
| FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 826 - 51 |
| GRUBER ET AL., J. IMMUNOL, vol. 152, 1994, pages 5368 |
| GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587 |
| HELLEN CUSARNOW P, GENES DEV, vol. 15, 2001, pages 1593 - 612 |
| HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 7889 - 7893 |
| HONNEGER, APLUNKTHUN, A, J. MOL. BIOL., vol. 309, 2001, pages 657 - 670 |
| HOOGENBOOMWINTER, J. MOL. BIOL., vol. 222, 1991, pages 581 |
| HWANG ET AL., PROC. NATL ACAD. SCI. USA, vol. 77, 1980, pages 4030 |
| IDUSOGIE ET AL., J. IMMUNOL., vol. 164, 2000, pages 4178 - 4184 |
| JACKOLA, D. RRUGER, J. KMILLER, R. A: "Age-associated changes in human T cell phenotype and function", AGING CLIN. EXP. RES, vol. 6, 1994, pages 25 - 34 |
| JANSEN ET AL., IMMUNOLOGICAL REVIEWS, vol. 62, 1982, pages 185 - 216 |
| JOERG THOMAS REGULA ET AL: "Immunoglobulin Gamma-Like Therapeutic Bispecific Antibody Formats for Tumor Therapy", PROTEIN ENGINEERING, DESIGN AND SELECTION, vol. 31, no. 7-8, 1 July 2018 (2018-07-01), GB, pages 289 - 299, XP055718025, ISSN: 1741-0126, DOI: 10.1093/protein/gzy021 * |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| KAPLITT, M. G. ET AL., NAT. GENET, vol. 8, 1994, pages 148 |
| KILLENLINDSTROM, JOUR. IMMUN, vol. 133, 1984, pages 1335 - 2549 |
| KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249 |
| KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| KONTERMANN, ACTA PHARACOL. SIN, vol. 26, 2005, pages 1 - 9 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553 |
| KOZBOR ET AL., IMMUNOL TODAY, vol. 4, 1983, pages 72 |
| KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001 |
| LEFRANC, M.P. ET AL., NUCL. ACIDS RES, vol. 27, 1999, pages 209 - 212 |
| LEFRANC. M.P. ET AL., BIOMOLECULES, vol. 4, no. 4, December 2014 (2014-12-01), pages 1102 - 1139 |
| LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859 |
| LONBERGHUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| MAKABE ET AL., J. BIOL. CHEM., vol. 283, 2007, pages 1156 - 1166 |
| MARKS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 779 - 783 |
| MARTIN ET AL., J. BIOL. CHEM., vol. 257, 1982, pages 286 - 288 |
| MARVINZHU, ACTA PHARMACOLOGICA SINCIA, vol. 26, no. 6, 2005, pages 649 - 658 |
| MILSTEINCUELLO, NATURE, vol. 305, 1983, pages 537 - 539 |
| MORRISON ET AL., AM. J. PHYSIOL., vol. 266, 1994, pages 292 - 305 |
| MUNOZ, D. P. ET AL.: "Targetable mechanisms driving immunoevasion of persistent senescent cells link chemotherapy-resistant cancer to aging", JCIINSIGHT, vol. 5, no. e124716, 2019, pages 124716 |
| MUNSONPOLLARD, ANAL. BIOCHEM., vol. 107, 1980, pages 220 |
| NATURE, vol. 361, 1993, pages 186 - 87 |
| P. TIJSSEN: "The McGraw-Hill Dictionary of Chemical Terms", 1985, ELSEVIER SCIENCE PUBLISHERS |
| POWELL ET AL.: "Compendium of excipients for parenteral formulations", PDA J PHARM SCI TECHNOL, vol. 52, 1998, pages 238 - 311, XP009119027 |
| PRESTA, CURR. OP. STRUCT. BIOL, vol. 2, 1992, pages 593 - 596 |
| RAMAKRISHNAN, S. ET AL., CANCER RES., vol. 44, 1984, pages 201 - 208 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| RODIER, F ET AL.: "Persistent DNA damage signalling triggers senescence-associated inflammatory cytokine secretion", NAT. CELL BIOL, vol. 11, 2009, pages 973 - 979 |
| RUIZ, M., NUCL. ACIDS RES, vol. 28, 2000, pages 219 - 221 |
| RUSCETTI, M. ET AL.: "NK cell-mediated cytotoxicity contributes to tumor control by a cytostatic drug combination", SCIENCE, vol. 362, 2018, pages 1416 - 1422 |
| SAGIV, A. ET AL.: "NKG2D ligands mediate immunosurveillance of senescent cells", AGING, vol. 8, 2016, pages 328 - 344 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SCHAEFER, PNAS, vol. 1 08, no. 27, 2011, pages 11187 - 11192 |
| SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604 |
| STEPHEN ET AL., PROC NATL ACAD SCI USA, vol. 97, 2000, pages 1536 - 1541 |
| STEVENSON ET AL., ANTI-CANCER DRUG DESIGN, vol. 3, 1989, pages 219 - 230 |
| STROHL, WR, CURR OPIN BIOTECHNOL, no. 6, 2009, pages 685 - 91 |
| SUNG HFERLAY JSIEGEL RLLAVERSANNE MSOERJOMATARAM IJEMAL ABRAY F: "Global Cancer Statistics 2020: GLOBOCAN Estimates of Incidence and Mortality Worldwide for 36 Cancers in 185 Countries", CA CANCER J CLIN, vol. 71, no. 3, 4 February 2021 (2021-02-04), pages 209 - 249 |
| SURESH ET AL., METHODS IN ENZYMOLOGY, vol. 121, 1986, pages 210 |
| THORNTON, NATURE, vol. 354, 1991, pages 105 |
| TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 - 3659 |
| TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 |
| ULRICH BRINKMANN ET AL: "The making of bispecific antibodies", MABS, vol. 9, no. 2, 10 January 2017 (2017-01-10), US, pages 182 - 212, XP055531122, ISSN: 1942-0862, DOI: 10.1080/19420862.2016.1268307 * |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VITETTA ET AL., SCIENCE, vol. 238, 1987, pages 1098 - 63 |
| WANG W: "Lyophilization and development of solid protein pharmaceuticals", INT. J. PHARM, vol. 203, no. 1-2, 2000, pages 1 - 60, XP002428586, DOI: 10.1016/S0378-5173(00)00423-3 |
| WANG, J. ET AL.: "Structure of a Heterophilic Adhesion Complex between the Human CD2 and CD58 (LFA-3) Counterreceptors", CELL, vol. 97, 1999, pages 791 - 803, XP055627194, DOI: 10.1016/S0092-8674(00)80790-4 |
| YANG ET AL., J. VIROL, vol. 69, 1995, pages 2004 |
| YOSHINO, NAMI, YTERAO, KTASHIRO, FHONDA, M: "Upgrading of flow cytometric analysis for absolute counts, cytokines and other antigenic molecules of cynomolgus monkeys (Macaca fascicularis) by using anti-human cross-reactive antibodies", EXP ANIM, vol. 49, 2000, pages 97 - 110, XP008135248 |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024130032A1 (en) * | 2022-12-14 | 2024-06-20 | Evolveimmune Therapeutics, Inc. | Bispecific antibody fusion molecules and methods of use thereof |
| WO2024173607A2 (en) | 2023-02-14 | 2024-08-22 | Evolveimmune Therapeutics, Inc. | Combination of bispecific antibodies and chimeric antigen receptor t cells for treatment |
| WO2025064890A1 (en) | 2023-09-20 | 2025-03-27 | Evolveimmune Therapeutics, Inc. | Bispecific antibody fusion molecules targeting cd180 and cd3 and methods of use thereof |
| WO2025085512A1 (en) * | 2023-10-16 | 2025-04-24 | Evolveimmune Therapeutics, Inc. | Combination therapies with ulbp2 targeting antibodies for treating cancers |
Also Published As
| Publication number | Publication date |
|---|---|
| CN119562970A (zh) | 2025-03-04 |
| AU2023236386A1 (en) | 2024-10-10 |
| IL315714A (en) | 2024-11-01 |
| KR20250005568A (ko) | 2025-01-09 |
| JP2025509824A (ja) | 2025-04-11 |
| EP4493593A1 (en) | 2025-01-22 |
| CA3254549A1 (en) | 2023-09-21 |
| US20250197496A1 (en) | 2025-06-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240400720A1 (en) | Anti-cd47 antibodies and methods of use thereof | |
| JP6726238B2 (ja) | 血小板非減少性かつ赤血球非減少性cd47抗体及びその使用方法 | |
| US11260117B2 (en) | Anti-CD47 x anti-mesothelin antibodies and methods of use thereof | |
| JP2015508072A (ja) | Cd47抗体及びその使用方法 | |
| US20250197496A1 (en) | Bispecific antibody fusion molecules and methods of use thereof | |
| US20220315655A1 (en) | Bispecific antibodies targeting cd47 and pd-l1 and methods of use thereof | |
| US12583922B2 (en) | Bispecific antibodies targeting CD47 and PD-L1 and methods of use thereof | |
| WO2024084052A1 (en) | Pd-l1xcd28 bispecific antibodies for immune checkpoint-dependent t cell activation | |
| WO2024173607A2 (en) | Combination of bispecific antibodies and chimeric antigen receptor t cells for treatment | |
| AU2024345039A1 (en) | Multispecific antibodies that bind cd3 and cd2 and methods of use thereof | |
| HK40120830A (zh) | 双特异性抗体融合分子及其使用方法 | |
| AU2024346729A1 (en) | Bispecific antibody fusion molecules targeting cd180 and cd3 and methods of use thereof | |
| WO2025259877A1 (en) | Bispecific antibody fusion molecules targeting gprc5d and cd3 and methods of use thereof | |
| WO2026076258A1 (en) | Bispecific antibody fusion molecules targeting cd20 and cd3 and methods of use thereof | |
| WO2025059037A9 (en) | Bispecific antibody fusion molecules targeting b7-h4 and cd3 and methods of use thereof | |
| CA3277013A1 (en) | BISPECIFIC ANTIBODY FUSION MOLECULES AND THEIR METHODS OF USE |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23717791 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024555332 Country of ref document: JP Ref document number: 315714 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2023236386 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2023236386 Country of ref document: AU Date of ref document: 20230320 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202417078222 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023717791 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2023717791 Country of ref document: EP Effective date: 20241018 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202406455Q Country of ref document: SG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202380040726.5 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: 202380040726.5 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: 18847825 Country of ref document: US |