WO2023175035A1 - Stable aqueous formulation of an anti-adrenomedullin (adm) antibody or anti-adm antibody fragment - Google Patents

Stable aqueous formulation of an anti-adrenomedullin (adm) antibody or anti-adm antibody fragment Download PDF

Info

Publication number
WO2023175035A1
WO2023175035A1 PCT/EP2023/056663 EP2023056663W WO2023175035A1 WO 2023175035 A1 WO2023175035 A1 WO 2023175035A1 EP 2023056663 W EP2023056663 W EP 2023056663W WO 2023175035 A1 WO2023175035 A1 WO 2023175035A1
Authority
WO
WIPO (PCT)
Prior art keywords
adm
antibody
adrenomedullin
formulation
patient
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2023/056663
Other languages
English (en)
French (fr)
Inventor
Jarrid GOLDSTEIN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Adrenomed AG
Original Assignee
Adrenomed AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Adrenomed AG filed Critical Adrenomed AG
Priority to CN202380036069.7A priority Critical patent/CN119072492A/zh
Priority to JP2024553456A priority patent/JP2025509304A/ja
Priority to IL315632A priority patent/IL315632A/en
Priority to EP23711082.0A priority patent/EP4493588A1/en
Priority to AU2023233838A priority patent/AU2023233838A1/en
Priority to US18/844,746 priority patent/US20250304671A1/en
Priority to CA3254142A priority patent/CA3254142A1/en
Publication of WO2023175035A1 publication Critical patent/WO2023175035A1/en
Priority to MX2024010899A priority patent/MX2024010899A/es
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39591Stabilisation, fragmentation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/16Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
    • A61K47/18Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
    • A61K47/183Amino acids, e.g. glycine, EDTA or aspartame
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/22Heterocyclic compounds, e.g. ascorbic acid, tocopherol or pyrrolidones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/08Solutions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the present invention relates to the field of pharmaceutical formulations of antibodies. Specifically, the subject matter of the present invention relates to a stable liquid antibody formulation comprising Arginine, Trehalose, a surfactant and Histidine and its pharmaceutical preparation and use.
  • Antibody preparations used for therapeutic or prophylactic use require a stabilizer to prevent loss of protein activity or structural integrity due to the effects of denaturation, oxidation, or aggregation over a period of time during storage and transportation before use. These problems are exacerbated by the presence of high levels of antibodies that are often desirable for treatment of diseases.
  • the main objectives in the development of antibody formulations are to maintain the antibody, its solubility, stability, and antigen-binding potency. It is particularly important to avoid agglomeration of particles in solution, which requires aseptic filtration prior to use for intravenous or subcutaneous administration and will limit the route of administration.
  • the formulation of antibody preparations requires careful selection of these factors among others to avoid protein denaturation and loss of antigen-binding activity. Therefore, there is a need for a stable aqueous antibody formulation that supports stable high concentrations of the bioactive antibody in solution and is suitable for parenteral administration, including intravenous, intramuscular, intraperitoneal, intradermal, or subcutaneous injection.
  • ADM peptide adrenomedullin
  • the precursor peptide which comprises, inter alia, a signal sequence of 21 amino acids at the N- terminus, is referred to as "preproadrenomedullin" (pre-proADM).
  • pre-proADM preproadrenomedullin
  • all amino acid positions specified usually relate to the pre-proADM which comprises the 185 amino acids.
  • the peptide adrenomedullin (ADM) is a peptide which comprises 52 amino acids (SEQ ID NO: 13) and which comprises the amino acids 95 to 146 of pre-proADM, from which it is formed by proteolytic cleavage.
  • ADM may be regarded as a poly-functional regulatory peptide. It is released into the circulation in an inactive form extended by glycine (Kitamura K. et al. 1998. Biochem. Biophys. Res. Commun. 244(2) :551-555). There is also a binding protein (Pio R. et al. 2001. The Journal of Biological Chemistry 276(15): 12292- 12300) which is specific for ADM and probably likewise modulates the effect of ADM. Those physiological effects of ADM as well as of PAMP which are of primary importance in the investigations to date were the effects influencing blood pressure.
  • ADM is an effective vasodilator, and it is possible to associate the hypotensive effect with the particular peptide segments in the C-terminal part of ADM. It has furthermore been found that the above- mentioned further physiologically active peptide PAMP formed from pre-proADM likewise exhibits a hypotensive effect, even if it appears to have an action mechanism differing from that of ADM.
  • the concentrations of ADM which can be measured in the circulation and other biological liquids are, in a number of pathological states, significantly above the concentrations to be found in healthy control persons.
  • the ADM level in patients with congestive heart failure, myocardial infarction, kidney diseases, hypertensive disorders, diabetes mellitus, in the acute phase of shock and in sepsis and septic shock are significantly increased, although to different extents.
  • the PAMP concentrations are also increased in some of said pathological states, but the plasma levels are lower relative to ADM ((Eto, T., supra).
  • W0-A1 2004/097423 describes the use of an antibody against adrenomedullin for diagnosis, prognosis, and treatment of cardiovascular disorders.
  • Treatment of diseases by blocking the ADM receptor are also described in the art, (e.g., W0-A1 2006/027147, PCT/EP2005/012844) said diseases may be sepsis, septic shock, cardiovascular diseases, infections, dermatological diseases, endocrinological diseases, metabolic diseases, gastroenterological diseases, cancer, inflammation, hematological diseases, respiratory diseases, muscle skeleton diseases, neurological diseases, urological diseases.
  • ADM-neutralizing antibodies neutralize the before mentioned effects during the early phase of sepsis (Wang, P., "Adrenomedullin and cardiovascular responses in sepsis", Peptides, Vol. 22, pp. 1835-1840 (2001).
  • ADM For other diseases blocking of ADM may be beneficial to a certain extent. However, it might also be detrimental if ADM is totally neutralized, as a certain amount of ADM may be required for several physiological functions. In many reports it was emphasized, that the administration of ADM may be beneficial in certain diseases. In contrast thereto, in other reports ADM was reported as being life threatening when administered in certain conditions.
  • ADM binding protein complement factor H
  • ADM binding protein is present in the circulation of said organism in high concentrations (Pio et al. : Identification, characterization, and physiological actions of factor H as an Adrenomedullin binding Protein present in Human Plasma; Microscopy Res. and Technique, 55:23- 27 (2002) and Martinez et al. Mapping of the Adrenomedullin-Binding domains in Human Complement factor H; Hypertens Res Vol. 26, Suppl (2003), S56-59).
  • Adrecizumab an N-terminal anti-ADM antibody
  • Adrecizumab a humanized version of an N-terminal anti-ADM antibody
  • beneficial effects of Adrecizumab on vascular barrier function and survival were recently demonstrated in preclinical models of systemic inflammation and sepsis (Geven et al. 2018. Shock 50(61:648-654).
  • pre-treatment with Adrecizumab attenuated renal vascular leakage in endotoxemic rats as well as in mice with CLP-induced sepsis, which coincided with increased renal expression of the protective peptide Ang-1 and reduced expression of the detrimental peptide vascular endothelial growth factor.
  • Adrecizumab improved 7-day survival in CLP-induced sepsis in mice from 10 to 50% for single and from 0 to 40% for repeated dose administration.
  • Adrecizumab Both animal and human data reveal a potent, dose-dependent increase of circulating ADM following administration of this antibody. Based on pharmacokinetic data and the lack of an increase in MR-proADM (an inactive peptide fragment derived from the same prohormone as ADM), the higher circulating ADM levels cannot be explained by an increased production.
  • a mechanistic explanation for this increase could be that the excess of antibody in the circulation may drain ADM from the interstitium to the circulation, since ADM is small enough to cross the endothelial barrier, whereas the antibody is not (Geven et al. 2018. Shock. 50(2): 132-140; and Voors et al (J. Eur J Heart Fail. 2019 Feb; 21(2): 163-171)).
  • binding of the antibody to ADM leads to a prolongation of ADM’s half-life.
  • NT-ADM antibodies partially inhibit ADM-mediated signalling, a large increase of circulating ADM results in an overall “net” increase of ADM activity in the blood compartment, where it exerts beneficial effects on ECs (predominantly barrier stabilization), whereas ADMs detrimental effects on VSMCs (vasodilation) in the interstitium are reduced.
  • WO2013/072510 describes a non-neutralizing anti- ADM antibody for use in therapy of a severe chronical or acute disease or acute condition of a patient for the reduction of the mortality risk for said patient.
  • WO2013/072511 describes a non-neutralizing anti-ADM antibody for use in therapy of a chronical or acute disease or acute condition of a patient for prevention or reduction of organ dysfunction or organ failure.
  • WO2013/072512 describes a non-neutralizing anti-ADM antibody that is an ADM stabilizing antibody that enhances the half-life (ti/2 half retention time) of adrenomedullin in serum, blood, plasma. This ADM stabilizing antibody blocks the bioactivity of ADM to less than 80 %.
  • WO2013/072513 shows that in patients having a chronic or acute disease or acute condition in need for stabilizing the circulation, anti-Adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or an anti-ADM non-lg scaffold stabilizes the blood circulation of patients and reduces the vasopressor requirement, e.g., catecholamine of said patient.
  • ADM anti-Adrenomedullin
  • WO2013/072514 shows anti- Adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or an anti-ADM non-lg scaffold can be efficiently used to regulate the fluid balance in a patient having a chronic or acute disease or acute condition, especially patients at the ICU (Intensive Care Unit) who suffers from fluid imbalance.
  • ADM Adrenomedullin
  • WO2017/182561 describes methods for determining the total amount or active DPP3 in a sample of a patient for the diagnosis of a disease related to necrotic processes. It further describes a method of treatment of necrosis-related diseases by antibodies directed to DPP3.
  • ADM anti-adrenomedullin
  • ADM anti-adrenomedullin
  • an anti- adrenomedullin antibody fragment can be particularly effective in therapy of a patient suffering from diseases associated with impaired vascular integrity.
  • ADM anti-adrenomedullin
  • the terms “about” and “approximately” denote an interval of accuracy that a person skilled in the art will understand to still ensure the technical effect of the feature in question.
  • the term typically indicates a deviation from the indicated numerical value of ⁇ 20 %, preferably ⁇ 15 %, more preferably ⁇ 10 %, and even more preferably ⁇ 5 %.
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said antibody or fragment binds to the N-terminal part (aa 1-21) of ADM: YRQSMNNFQGLRSFGCRFGTC (SEQ ID No. 1), wherein said antibody or antibody fragment is present in a concentration of 1 mg/ml to 100 mg/ml, 2 mg/ml to 50 mg/ml, more preferably 10 mg/ml to 30 mg/ml, more preferably 15 mg/ml to 25 mg/ml and most preferably 20 mg/ml and wherein said pharmaceutical aqueous formulation is further comprising:
  • Trehalose in a range of 1 g/L to 100 g/L
  • a surfactant selected from polysorbates and poloxamers in a range of 0.01 g/L to 5 g/L
  • a preferred embodiment of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said antibody or fragment binds to the N-terminal part (aa 1-21) of ADM: YRQSMNNFQGLRSFGCRFGTC (SEQ ID No. 1), wherein said antibody or antibody fragment is present in a concentration of 1 mg/ml to 100 mg/ml, preferably 2 mg/ml to 50 mg/ml, more preferably 10 mg/ml to 30 mg/ml, more preferably 15 mg/ml to 25 mg/ml and most preferably 20 mg/ml and wherein said pharmaceutical aqueous formulation is further comprising:
  • a surfactant selected from polysorbates such as ethoxylated sorbitan esterified with fatty acids comprising Polysorbate 20, Polysorbate 40, Polysorbate 60, and Polysorbate 80 and poloxamers such as copolymers based on ethylene oxide and propylene oxide in a range of 0.01 g/L to 5 g/L, and
  • the ADM antibody or an ADM antibody fragment may be administered in a dose of at least 0.5 mg / Kg body weight, particularly at least 1.0 mg/kg body weight, more particularly, from 1.0 to 20.0 mg/kg body weight, e.g., from 1.0 to 10 mg/kg, from 2.0 to 10 mg/kg body weight, from 2.0 to 8.0 mg/kg body weight or from 3.0 to 5.0 mg/kg body weight.
  • the ADM antibody or an ADM antibody fragment is present in a concentration of at least of 1 mg/ml to 100 mg/ml, preferably 2 mg/ml to 50 mg/ml, more preferably 10 mg/ml to 30 mg/ml, more preferably 15 mg/ml to 25 mg/ml and most preferably 20 mg/ml.
  • the ADM antibody or an ADM antibody fragment is present in a total amount of at least 5mg, particularly at least 10 mg, more particularly from 10 mg to 1000 mg, more particularly from 50 mg to 700 mg, more particularly from 100 mg to 500 mg and most particularly from 200 to 480 mg referring to a 10 ml vial.
  • This total amount of the ADM antibody or an ADM antibody fragment can e.g., be used to prepare a ready-to-application solution by diluting said total amount of the ADM antibody or an ADM antibody fragment in a suitable buffer comprising phosphate buffered saline solution, water and emulsions such as oil/water emulsion to a desired concentration.
  • the ADM antibody or an ADM antibody fragment is present in a total amount of at least 5mg, particularly at least 10 mg, more particularly from 10 mg to 1000 mg, more particularly from 50 mg to 700 mg, more particularly from 100 mg to 500 mg and most particularly from 200 to 480 mg referring to a 10 ml vial and may be diluted in a suitable buffer comprising phosphate buffered saline solution, water and emulsions such as oil/water emulsion to 10 ml to 200ml, preferably 20 ml to 180 ml, more preferably 30 ml to 150 ml and most preferred to 50 ml to 100 ml.
  • a suitable buffer comprising phosphate buffered saline solution, water and emulsions such as oil/water emulsion to 10 ml to 200ml, preferably 20 ml to 180 ml, more preferably 30 ml to 150 ml and most preferred to 50 ml to 100 ml.
  • the ADM antibody or an ADM antibody fragment is present in a ready-to-application solution with a concentration of at least 1 mg/ml to 100 mg/ml, preferably 2 mg/ml to 50 mg/ml, more preferably 10 mg/ml to 30 mg/ml, more preferably 15 mg/ml to 25 mg/ml and most preferably 20 mg/ml and diluted in a suitable buffer comprising phosphate buffered saline solution, water and emulsions such as oil/water emulsion to 10 ml to 200ml, preferably 20 ml to 180ml, more preferably 30 ml to 150 ml and most preferred to 50 ml to 100 ml.
  • a suitable buffer comprising phosphate buffered saline solution, water and emulsions such as oil/water emulsion to 10 ml to 200ml, preferably 20 ml to 180ml, more preferably 30 ml to 150 ml and most preferred to 50 ml
  • the pharmaceutical aqueous formulation is further diluted in an infusion solution and applied via infusion to the patient.
  • the physician as person skilled in the art would prepare a ready-for-application solution from the pharmaceutical aqueous formulation according to the patient's needs and then directly apply the ready-for-application solution to the patient.
  • the ADM antibody or an ADM antibody fragment may be administered in a dose of at least 0.5 mg / kg body weight, particularly at least 1.0 mg/kg body weight, more particularly, from 1.0 to 20.0 mg/kg body weight, e.g., from 2.0 to 10 mg/kg body weight, from 2.0 to 8.0 mg/kg body weight or from 3.0 to 5.0 mg/kg body weight.
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said antibody or fragment is a human monoclonal antibody or fragment that binds to the N- terminal region (aa 1-21) of ADM (SEQ ID No. 1) or an antibody fragment thereof wherein the heavy chain comprises the sequences: CDR1: SEQ ID NO: 2
  • CDR2 SEQ ID NO: 3
  • TEGYEYDGFDY and wherein the light chain comprises the sequences:
  • CDR2 SEQ ID NO: 6
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment comprising an Anti-Adrenomedullin antibody directed to the N-terminal end of Adrenomedullin comprising the following sequence as a heavy chain:
  • ADM human or humanized anti-adrenomedullin
  • a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment comprising an Anti-Adrenomedullin antibody directed to the N-terminal end of Adrenomedullin comprising the following sequence as a heavy chain:
  • ADM human or humanized anti-adrenomedullin
  • the identity defines the percentage of amino acids with a direct match in the alignment.
  • Surfactants can be used to alter the surface tension of a liquid antibody formulation.
  • the surfactant reduces the surface tension of a liquid antibody formulation.
  • the surfactant can contribute to an improvement in stability of any of the antibody in the formulation.
  • the surfactant can also reduce aggregation of the formulated antibody (e.g., during shipping and storage) and/or minimize the formation of particulates in the formulation and/or reduces adsorption (e.g., adsorption to a container).
  • the surfactant can also improve stability of the antibody during and after a freeze/thaw cycle.
  • the surfactant can be, for example without limitation, a polysorbate, poloxamer, triton, sodium dodecyl sulfate, sodium laurel sulfate, sodium octyl glycoside, lauryl-sulfobetaine, myristyl-sulfobetaine, linoleyl-sulfobetaine, stearyl-sulfobetaine, lauryl-sarcosine, myristyl-sarcosine, linoleyl-sarcosine, stearyl- sarcosine, linoleyl-betaine, myristyl-betaine, cetyl-betaine, lauroamidopropyl-betaine, cocamidopropyl-betaine, linoleamidopropyl-betaine, myristamidopropyl-betaine, palmidopropyl-betaine, isostearamidopropyl
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said surfactant is Poloxamer.
  • poloxamer is selected from the group comprising copolymers based on ethylene oxide and propylene oxide comprising but not limited to L64, P65, P84, P85, F88, P103, P104, P105, F108, P123 or F127.
  • Polyoxyethylen-(4)-sorbitanmonostearate Polyoxyethylen-(20)-sorbitantristearate, Polyoxyethylen- (20)-sorbitanmonooleate, Polyoxyethylen-(5)-sorbitanmonooleate, Polyoxyethylen-(20) sorbitantrioleate or Polyoxyethylen-(20)-sorbitanmonoisostearate, polyoxyethylene derivatives, Tween, PEG3350 and mixtures thereof.
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said formulation is essentially free of NaCl and/or Glycine.
  • ADM anti-adrenomedullin
  • the aqueous formulation comprises for example without limitation, acetate, succinate, gluconate, citrate, histidine, acetic acid, phosphate, phosphoric acid, ascorbate, tartaric acid, maleic acid, glycine, lactate, lactic acid, ascorbic acid, imidazole, bicarbonate and carbonic acid, succinic acid, sodium benzoate, benzoic acid, gluconate, edetate, acetate, malate, imidazole, tris, phosphate, and mixtures thereof.
  • the aqueous formulation comprises histidine, wherein the histidine can comprise either L-histidine or D-histidine, a solvated form of histidine, a hydrated form (e.g., monohydrate including L-histidine hydrochloride monohydrate) of histidine, a salt of histidine (e.g. , histidine hydrochloride) or an anhydrous form of histidine or a mixture thereof.
  • the histidine can comprise either L-histidine or D-histidine, a solvated form of histidine, a hydrated form (e.g., monohydrate including L-histidine hydrochloride monohydrate) of histidine, a salt of histidine (e.g. , histidine hydrochloride) or an anhydrous form of histidine or a mixture thereof.
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein Arginine is present in a range of 1 g/L to 100 g/L, preferably 13.1 g/L to 52.2 g/L, more preferably 26.1 g/L.
  • the aqueous formulation comprises histidine, wherein the histidine can comprise either L-histidine or D-histidine, a solvated form of histidine, a hydrated form (e.g. , monohydrate including L-histidine hydrochloride monohydrate) of histidine, a salt of histidine (e.g. , histidine hydrochloride) or an anhydrous form of histidine or a mixture thereof.
  • ADM human or humanized anti-adrenomedullin
  • Arginine is present in a range of 1 g/L to 100 g
  • the aqueous formulation comprises an isotonicity modifying agent which protects the antibody or protein in the formulation against freeze-thaw induced aggregation as well as aggregation on storage.
  • Said isotonicity agent can be a polyol with a molecular weight that, for example without limitation, is less than about 600 kD (e.g., in the range from about 120 to about 400 kD), and comprises multiple hydroxyl groups including sugars (e.g., reducing and nonreducing sugars or mixtures thereof, saccharide, or a carbohydrate), sugar alcohols, sugar acids, or a salt or mixtures thereof.
  • non-reducing sugar examples include, but are not limited to, sucrose, trehalose, and mixtures thereof.
  • the polyol is mannitol, trehalose, sorbitol, erythritol, isomalt, lactitol, maltitol, xylitol, glycerol, lactitol, propylene glycol, polyethylene glycol, inositol, or mixtures thereof.
  • the polyol can be, for example without limitation, a monosaccharide, disaccharide or polysaccharide, or mixtures of any of the foregoing.
  • the saccharide or carbohydrate can be, for example without limitation, fructose, glucose, mannose, sucrose, sorbose, xylose, lactose, maltose, sucrose, dextran, pullulan, dextrin, cyclodextrins, soluble starch, hydroxyethyl starch, water- soluble glucans, or mixtures thereof.
  • the polyol is trehalose.
  • Subject matter of the present invention is pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein Trehalose is present in a range of 1 g/L to 100 g/L, preferably 28.4 g/L to 85.1 g/L, more preferably 56.7 g/L.
  • ADM human or humanized anti-adrenomedullin
  • Trehalose is present in a range of 1 g/L to 100 g/L, preferably 28.4 g/L to 85.1 g/L, more preferably 56.7 g/L.
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein Poloxamer is present in a range of 0.01 g/L to 5 g/L, preferably 0.1 g/L to 1.0 g/L, more preferably 0.5 g/L.
  • ADM human or humanized anti-adrenomedullin
  • Poloxamer is present in a range of 0.01 g/L to 5 g/L, preferably 0.1 g/L to 1.0 g/L, more preferably 0.5 g/L.
  • the aqueous formulation comprises a chelating agent that can be selected from the group consisting of aminopolycarboxylic acids, hydroxyaminocarboxylic acids, N- substituted glycines, 2- (2-amino-2-oxocthyl) aminoethane sulfonic acid (BES), deferoxamine (DEF), citric acid, niacinamide, and desoxycholates and mixtures thereof.
  • a chelating agent that can be selected from the group consisting of aminopolycarboxylic acids, hydroxyaminocarboxylic acids, N- substituted glycines, 2- (2-amino-2-oxocthyl) aminoethane sulfonic acid (BES), deferoxamine (DEF), citric acid, niacinamide, and desoxycholates and mixtures thereof.
  • the chelating agent is selected from the group consisting of ethylenediaminetetraacetic acid (EDTA), diethylenetriamine pentaacetic acid 5 (DTPA), nitrilotriacetic acid (NTA), N-2-acetamido-2-iminodiacetic acid (ADA), bis(aminoethyl)glycol ether, N, N,N', N'-tetra acetic acid (EGTA), trans- diamino cyclohexane tetra acetic acid (DCTA), glutamic acid, and aspartic acid, N- hydroxyethyl iminodiacetic acid (HIMDA), N,N-bis-hydroxyethyl glycine (bicine) and N- (trishydroxymethylmethyl) 10 glycine (tricine), glycylglycine, sodium desoxycholate, ethylenediamine, propylenediamine, diethylenetriamine, triethylenetetramine (trien),
  • the chelating agent is selected from the group consisting of salts of EDTA including dipotassium edetate, disodium edetate, edetate calcium disodium, sodium edetate, trisodium edetate, and potassium edetate; and a suitable salt of deferoxamine (DEF) is deferoxamine mesylate (DFM), or mixtures thereof.
  • DEF deferoxamine
  • DMF deferoxamine mesylate
  • Chelating agents used in the invention can be present, where possible, as the free acid or free base form or salt form of the compound, also as an anhydrous, solvated or hydrated form of the compound or corresponding salt. In a most preferred embodiment of the present invention the chelating agent is histidine.
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein Histidine is present in a range of 0.1 g/L to 6.4 g/L, preferably 0.8 g/L to 3.2 g/L, more preferably 1.6 g/L.
  • ADM human or humanized anti-adrenomedullin
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein the pH of the formulation is in the range of 4.0 to 8.0 preferably 5.0 to 7.0, more preferably 6.0.
  • ADM anti-adrenomedullin
  • the aqueous formulation is provided with a pH close to physiological pH for reduced risk of pain or anaphylactoid side effects on injection and also provides enhanced antibody stability and resistance to aggregation, oxidation, and fragmentation.
  • the formulation can comprise a preservative.
  • the preservative agent is selected from the group comprising phenol, m-cresol, benzyl alcohol, benzalkonium chloride, benzalkonium chloride, phenoxyethanol and methyl paraben.
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said formulation comprises an Anti-Adrenomedullin antibody directed to the N-terminal end of Adrenomedullin comprising the following sequence: SEQ ID No.
  • pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said formulation comprises an Anti-Adrenomedullin antibody directed to the N- terminal end of Adrenomedullin comprising the following sequence: SEQ ID No.
  • Another aspect of the present invention relates to a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said formulation comprises an Anti-Adrenomedullin antibody directed to the N- terminal end of Adrenomedullin comprising the following sequence: SEQ ID No.
  • ADM human or humanized anti-adrenomedullin
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said formulation is stable after storage for at least 4 weeks at 2 to 8°C and less than 5 wt/wt-%, preferably 4 wt/wt-%, more preferably 3 wt/wt-%, more preferably 2 wt/wt-%, more preferably 1 wt/wt- %, more preferably 0.05 % -mol or most preferably 0.01 wt/wt-% of the total antibody is aggregated as measured for example by size exclusion high performance liquid chromatography (SEC-HPLC) and wherein said antibody is present at a concentration of 1 mg/ml to 100 mg/ml, preferably 2 mg/ml to 50 mg/ml, more preferably 10 mg/ml to 30 mg/ml, more preferably 15 mg/ml to 25 mg/ml and most
  • a preferred embodiment of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said formulation is stable after storage for at least 4 weeks at 2 to 8°C and wherein less than 5 wt/wt-%, preferably 4 wt/wt-%, more preferably 3 wt/wt-%, more preferably 2 wt/wt-%, more preferably 1 wt/wt-%, more preferably 0.05 % -mol or most preferably 0.01 wt/wt-% of the total antibody is aggregated as measured for example by size exclusion high performance liquid chromatography (SEC-HPLC) and wherein said antibody may be administered in a dose of 1 mg/kg body weight to 10 mg/kg body weight, more preferably 2 mg/kg body weight to 8 mg/kg body weight and most preferably 3 mg/kg body weight to 5 mg/kg body weight.
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said formulation is stable after storage for at least 4 weeks at 2 to 8°C and wherein less than 5 wt/wt-%, preferably 4 wt/wt-%, more preferably 3 wt/wt-%, more preferably 2 wt/wt-%, more preferably 1 wt/wt-%, more preferably 0.05 % -mol or most preferably 0.01 wt/wt-% of the total antibody is aggregated as measured for example by size exclusion high performance liquid chromatography (SEC-HPLC) and wherein said antibody is present at a total amount of 10 mg to 1000 mg, more preferably 50 mg to 700 mg and most preferably 100 mg to 500 mg referring to a 10 ml vial.
  • SEC-HPLC size exclusion high performance liquid chromatography
  • SEC-HPLC is capable to separate protein species having apparent molecular weights of 150 kDa from others having molecular weights of 300 kDa or higher.
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein the activity of said antibody or antibody fragment in said formulation is stable after stress and wherein stress is induced by storing said formulation for at least 4 weeks at 45 °C, preferably 42 °C, more preferably, 38 °C, more preferably 36 °C and most preferably 40 °C and 85% rH, preferably 80 rH, preferably 70% rH, and most preferably 75% rH and/or by storing said formulation for at least 3 months of storage at 29 °C, preferably 27 °C, more preferably, 22 °C, more preferably 20°C and most preferably 25 °C and/or 70% rH, preferably 65% rH, preferably 55% rH, more preferably 50% rH and most preferably 60% rH and/or by storing said formulation for at least 6 months of
  • rH relative humidity and refers to a measure of how much water vapor is in a water-air mixture compared to the maximum amount possible. Furthermore, rH is a ratio of the humidity ratio of a particular water-air mixture compared to the saturation humidity ratio at a given temperature (dry-bulb).
  • relative humidity is used according to the ICH Q1A guideline “Stability Testing of new Drug Substances and Products”. Because relative humidity is temperature dependent, precise air temperature control is required for close relative humidity control. The person skilled in the art would know that humidity is typically measured by a hygrometer such as a gravimetric hygrometer, chilled mirror hygrometer or electrolytic hygrometer.
  • “Stable” means that all critical quality attributes of the formulation remains within the specification limits of the quality specifications, in particular, the absence of any visible particulate after applied stress conditions such as storing said formulation for at least 2 weeks at 45 °C, preferably 42 °C, more preferably, 38 °C, more preferably 36 °C and most preferably 40 °C and/or at 29 °C, preferably 27 °C, more preferably, 22 °C, more preferably 20°C and most preferably 25 °C and/or 70% rH, preferably 65% rH, preferably 55% rH, more preferably 50% rH and most preferably 60% rH and/or at 45 °C, preferably 42 °C, more preferably, 38 °C, more preferably 36 °C and most preferably 40 °C and/or 85% rH, preferably 80 rH, preferably 70% rH, and most preferably 75% rH or by storing said formulation at 29 °C, preferably
  • pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein the activity of said antibody or antibody fragment in said formulation is stable after stress and wherein stress is induced by storing said formulation for at least 2 weeks at 45 °C, preferably 42 °C, more preferably, 38 °C, more preferably 36 °C and most preferably 40 °C and/or by performing at least 5 Freeze/Thaw cycles with said formulation and/or by subjecting said formulation to mechanical stress comprising orbital shaking and overhead rotation and wherein the stability is determined by assessing the visual appearance comprising color, clarity and visible particles of said formulation after stress.
  • ADM anti-adrenomedullin
  • pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein the activity of said antibody or antibody fragment in said formulation is stable after stress and wherein stress is induced by storing said formulation for at least 2 months of storage at 29 °C, preferably 27 °C, more preferably, 22 °C, more preferably 20°C and most preferably 25 °C and/or 70% rH, preferably 65% rH, preferably 55% rH, more preferably 50% rH and most preferably 60% rH and/or by performing at least 5 Freeze/Thaw cycles with said formulation and/or by subjecting said formulation to mechanical stress comprising orbital shaking and overhead rotation and wherein the stability is determined by assessing the visual appearance comprising color, clarity and visible particles of said formulation after stress.
  • ADM anti-adrenomedullin
  • Another embodiment of the present invention relates to pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein the activity of said antibody or antibody fragment in said formulation is stable after stress and wherein stress is induced by storing said formulation for at least 2 weeks at 45 °C, preferably 42 °C, more preferably, 38 °C, more preferably 36 °C and most preferably 40 °C and/or 85% rH, preferably 80 rH, preferably 70% rH, and most preferably 75% rH or by storing said formulation at 29 °C, preferably 27 °C, more preferably, 22 °C, more preferably 20°C and most preferably 25 °C and/or 70% rH, preferably 65% rH, preferably 55% rH, more preferably 50% rH and most preferably 60% rH or by storing said formulation at 9 °C, preferably 7 °C, more
  • 1 Freeze/Thaw cycles comprises that said formulation is first frozen to -80 °C and subsequently thawed to 25°C at 1°C per minute.
  • 1 to 50 preferably 1 to 30, more preferably 1 to 20, more preferably 1 to 10, more preferably 2 to 8 and most preferably 5 Freeze/Thaw cycles are performed.
  • pharmaceutical aqueous formulation comprising a human or humanized anti- adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein the activity of said antibody or antibody fragment in said formulation is stable after stress and wherein stress is induced by subjecting said formulation to mechanical stress comprising orbital shaking and overhead rotation.
  • stress was applied by over-head rotation at 30 rpm for 24h and/or orbital shaking at 400 rpm.
  • stress was applied by over-head rotation at 30 rpm for 24h, preferably for 36h, more preferably for 48h and most preferably for 72h and/or orbital shaking at 200 rpm, preferably at 400 rpm, more preferably at 600 rpm, more preferably 800 rpm and most preferably at 1000 rpm.
  • Micron-sized protein aggregates and particles are important quality attributes of therapeutic protein formulations due to their risk of enhancing an immunogenic response. Quantification of subvisible particles larger than 10 pm and 25 is therefore required by the pharmacopoeias and is commonly performed using light obscuration (LO) techniques.
  • the stability is determined by assessing the visual appearance comprising color, clarity and visible particles of said formulation after stress.
  • subvisible particles larger than 1 pm, more preferably 5 pm, more preferably 10 pm, more preferably 15 pm, more preferably 20 pm and most preferably 25 pm are quantified.
  • particles larger than 25 pm are quantified.
  • visual and color inspection is performed.
  • Appearance testing of said formulation regarding color accordinging to Ph. Eur. method 2.2.2. Visible particles, Ph. Eur. method 2.9.20) clarity and degree of opalescence (Ph. Eur. method 2.2.) are usually analyzed according to Ph. Eur. method 2.9.20 and 2.2.1 respectively.
  • visible particles, appearance, color and clarity are assessed by eye.
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said formulation is stable after storage for at least 4 weeks at 2 to 8°C and wherein stable means that said formulation remains free from visible particles.
  • ADM anti-adrenomedullin
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said formulation is stable after storage for at least 4 weeks at 2 to 8°C and wherein stable means that said formulation remains free from subvisible particles.
  • ADM anti-adrenomedullin
  • micron-sized protein aggregates and particles are important quality attributes of therapeutic protein formulations due to their risk of enhancing an immunogenic response. Quantification of subvisible particles larger than 10 m and 25 pm is therefore required by the pharmacopoeias and is commonly performed using light obscuration (LO) techniques.
  • LO light obscuration
  • the acceptance criteria for SVP are 6000 NMT > 10 pm / container and 600 NMT > 25 pm I container. SVPs ⁇ 10 pm have to be monitored, acceptance criteria are not defined.
  • quantification and characterization of particles with a size below 10 pm is of increasing interest and are in the meanwhile a regulatory expectation.
  • Subject matter of the present invention is a pharmaceutical aqueous formulation comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said antibody is present in a concentration of 1 mg/ml to 100 mg/ml, preferably 2 mg/ml to 50 mg/ml, more preferably 10 mg/ml to 30 mg/ml, more preferably 15 mg/ml to 25 mg/ml and most preferably 20 mg/ml.
  • ADM anti-adrenomedullin
  • pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said antibody or said fragment may be administered in a dose of at least 0.5 mg / Kg body weight, particularly at least 1.0 mg/kg body weight, more particularly, from 1.0 to 20.0 mg/kg body weight, e.g., from 2.0 to 10 mg/kg body weight, from 2.0 to 8.0 mg/kg body weight, or from 2.0 to 5.0 mg/kg body weight.
  • ADM anti-adrenomedullin
  • Subject matter of the present invention is a pharmaceutical lyophilized formulation obtainable from a pharmaceutical aqueous formulation.
  • a formulation which is lyophilized and/or has been subjected to lyophilization is provided in another aspect of the invention, the pharmaceutical formulation is provided in a lyophilized form, which is termed a "cake" or “powder” and is physically stable and compatible with a pharmaceutically acceptable solvent mixture.
  • the aqueous formulation as disclosed by the present invention has a shelf life at 5°C of at least or more than about 6 months, 12 months, 18 months, 24 months, 30 months, 36 months, 42 months, or 48 months (e.g. at 5°C, 25°C, or 40°C).
  • the formulation of the present invention has a shelf life of at least about 6 months, 7 months, 8 months, 9 months, 10 months, 1 1 months, 12 months, 13 months, 14 months, 15 months, 16 months, 17 months, 18 months, 19 months, 20 months, 21 months, 22 months, 23 months, 24 months, 25 months, 26 months, 27 months, 28 months, 29 months, 30 months, 31 months, 32 months, 33 months, 34 months, 35 months, 36 months, 37 months, 38 months, 39 months, 40 months, 41 months, 42 months, 43 months, 44 months, 45 months, 46 months, 47 months, 48 months, 49 months, 50 months, 51 months, 52 months, 53 months, 54 months, 55 months, 56 months, 57 months, 58 months, 59 months, or 60 months.
  • the aqueous formulation as disclosed by the present invention has a shelf life at 25°C of at least or more than about 6 months, 12 months, 18 months, 24 months, 30 months, 36 months, 42 months, or 48 months (e.g. at 5°C, 25°C, or 40°C).
  • the formulation of the present invention has a shelf life of at least about 6 months, 7 months, 8 months, 9 months, 10 months, 1 1 months, 12 months, 13 months, 14 months, 15 months, 16 months, 17 months, 18 months, 19 months, 20 months, 21 months, 22 months, 23 months, 24 months, 25 months, 26 months, 27 months, 28 months, 29 months, 30 months, 31 months, 32 months, 33 months, 34 months, 35 months, 36 months, 37 months, 38 months, 39 months, 40 months, 41 months, 42 months, 43 months, 44 months, 45 months, 46 months, 47 months, 48 months, 49 months, 50 months, 51 months, 52 months, 53 months, 54 months, 55 months, 56 months, 57 months, 58 months, 59 months, or 60 months.
  • the aqueous formulation as disclosed by the present invention has a shelf life at 40°C of at least or more than about 6 months, 12 months, 18 months, 24 months, 30 months, 36 months, 42 months, or 48 months (e.g. at 5°C, 25°C, or 40°C).
  • the formulation of the present invention has a shelf life of at least about 6 months, 7 months, 8 months, 9 months, 10 months, 1 1 months, 12 months, 13 months, 14 months, 15 months, 16 months, 17 months, 18 months, 19 months, 20 months, 21 months, 22 months, 23 months, 24 months, 25 months, 26 months, 27 months, 28 months, 29 months, 30 months, 31 months, 32 months, 33 months, 34 months, 35 months, 36 months, 37 months, 38 months, 39 months, 40 months, 41 months, 42 months, 43 months, 44 months, 45 months, 46 months, 47 months, 48 months, 49 months, 50 months, 51 months, 52 months, 53 months, 54 months, 55 months, 56 months, 57 months, 58 months, 59 months, or 60 months.
  • Subject matter of the present invention is a method of making a ready-for-application solution comprising the steps: a. Providing a pharmaceutical aqueous formulation b. Adjusting the pharmaceutical aqueous formulation from step a) in a physiological acceptable solution by optionally diluting the volume of the pharmaceutical formulation from step a) with a physiological acceptable solution and by optionally aliquoting the pharmaceutical formulation from step a) wherein the diluted or adjusted aqueous pharmaceutical formulation is suitable for the administration in a patient.
  • Subject matter of the present invention is a method of making a ready-for-application solution comprising the steps: a. Providing a lyophilized formulation obtained from the aqueous formulation by freeze drying optionally without adding any other bulk reagent b. Reconstitution of the lyophilizate from step a) in water and/or a physiological acceptable solution for injection c. Adjusting the reconstituted formulation from step b) in a physiological acceptable solution by optionally diluting the volume of the reconstituted formulation from step b) with a physiological acceptable solution and by optionally aliquoting the reconstituted formulation from step b) wherein the diluted or adjusted aqueous pharmaceutical formulation is suitable for the administration in a patient.
  • a preferred embodiment of the present invention is a method of making a ready-to -use solution comprising the steps: a. Providing a pharmaceutical aqueous formulation b. Adjusting the pharmaceutical aqueous formulation from step a) in a physiological acceptable solution by optionally diluting the volume of the pharmaceutical formulation from step a) with a physiological acceptable solution and by optionally aliquoting the pharmaceutical formulation from step a) wherein the diluted or adjusted aqueous pharmaceutical formulation is suitable for the administration in a patient and wherein said solution is selected from the group comprising Ringer’s lactate, glucose solution, electrolytic solutions, isotonic sodium chloride solution and wherein said infusion solution is present in a volume of 10 ml to 200ml, preferably 20 ml to 180ml, more preferably 30 ml to 150 ml and most preferred to 50 ml to 100 ml.
  • Another preferred embodiment of the present invention is a method of making a ready-to -use solution comprising the steps: a. Providing a lyophilized formulation obtained from the aqueous formulation by freeze drying optionally without adding any other bulk reagent b. Reconstitution of the lyophilizate from step a) in water and/or a physiological acceptable solution for injection c.
  • Adjusting the reconstituted formulation from step b) in a physiological acceptable solution by optionally diluting the volume of the reconstituted formulation from step b) with a physiological acceptable solution and by optionally aliquoting the reconstituted formulation from step b) wherein the diluted or adjusted aqueous pharmaceutical formulation is suitable for the administration in a patient and wherein said solution is selected from the group comprising Ringer’s lactate, glucose solution, electrolytic solutions, isotonic sodium chloride solution and wherein said infusion solution is present in a volume of 10 ml to 200ml, preferably 20 ml to 180ml, more preferably 30 ml to 150 ml and most preferred to 50 ml to 100 ml.
  • the route of antibody administration is well known in the art and may include, for example, injection or infusion by intravenous, intraperitoneal, intracerebral, intramuscular, intraocular, intraarterial, or intralesional routes, or by sustained release systems.
  • Sustained-release parenteral injections can be divided into several types: oil-based injectable solutions, injectable-drug suspensions, polymer-based microspheres and polymer-based in-situ formings.
  • the antibody can be administered continuously by infusion or by bolus injection.
  • Physiological acceptable solutions are supplemental fluids used in e.g., intravenous therapy to restore or maintain normal fluid volume and electrolyte balance.
  • physiological acceptable solution exists and that the different physiological acceptable solution can be categorized e.g., by their tonicity or purpose.
  • physiological acceptable solution 's tonicity can either be isotonic, hypotonic or hypertonic.
  • the physiological acceptable solution can be selected from the group comprising Ringer’s lactate, glucose solution, electrolytic solutions, isotonic sodium chloride solution.
  • physiological acceptable solution are also suitable with commercially available infusion or injection carrier solutions for supplying electrolytes without carbohydrate such as isotonic NaCl solution, isotonic glucose solution, Ringer's lactate and similar (Rote Liste 2004, List of finished medicinal products of the members of the Federation of the Pharmaceutical Industry eV, Editio Cantor, Aulendorf / Wuertt., main groups 52.1 and 52.2.1) to the desired concentration or dose, without exhibiting physical or chemical incompatibilities.
  • infusion or injection carrier solutions for supplying electrolytes without carbohydrate such as isotonic NaCl solution, isotonic glucose solution, Ringer's lactate and similar (Rote Liste 2004, List of finished medicinal products of the members of the Federation of the Pharmaceutical Industry eV, Editio Cantor, Aulendorf / Wuertt., main groups 52.1 and 52.2.1) to the desired concentration or dose, without exhibiting physical or chemical incompatibilities.
  • Subject matter of the present invention is devices comprising above formulations.
  • the aqueous pharmaceutical composition according to the present invention can be stored in devices such as a medical container.
  • a medical container according to the present invention is any container suitable for storing the aqueous pharmaceutical composition.
  • Typical medical containers according to the present invention are made of glass or plastic and can be selected from the group comprising vials, prefilled syringes, and cartridges.
  • Said medical container may have a different set of closures: rubber stoppers for vials; plunger, needle, and needle shield (or luer tip and cap) for prefilled syringes; and plunger and seal for cartridges.
  • the person skilled in the art would know how to select a suitable medical container.
  • Subject matter of the present invention is a ready-for-application aqueous pharmaceutical formulation obtainable by a method according to the present invention comprising said human or humanized anti- adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment in a dose of 1 to 10 mg/kg body weight.
  • ADM anti-adrenomedullin
  • Subject matter of the present invention is a ready-for-application aqueous pharmaceutical formulation obtainable by a method according to the present invention comprising said human or humanized anti- adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment in a dose of 2 to 8 mg/kg body weight, preferred 2 or 4 or 8 mg/kg body weight.
  • ADM anti-adrenomedullin
  • aqueous pharmaceutical formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said antibody or said fragment is present in a concentration of at least 0.5 mg / Kg body weight, particularly at least 1.0 mg/kg body weight, more particularly, from 1.0 to 20.0 mg/kg body weight, e.g., from 2.0 to 10 mg/kg body weight, from 2.0 to 8.0 mg/kg body weight, or from 2.0 to 5.0 mg/kg body weight.
  • ADM human or humanized anti-adrenomedullin
  • an anti-adrenomedullin antibody fragment wherein said antibody or said fragment is present in a concentration of at least 0.5 mg / Kg body weight, particularly at least 1.0 mg/kg body weight, more particularly, from 1.0 to 20.0 mg/kg body weight, e.g., from 2.0 to 10 mg/kg body weight, from 2.0 to 8.0 mg/kg body weight, or from 2.0 to 5.0 mg/kg body weight.
  • septic shock acute vascular diseases as e.g. heart failure, congestion, in particular diuretic resistant congestion, inflammatory conditions, autoimmune diseases, metabolic diseases, brain diseases, cardiovascular diseases and drug-induced diseases symptoms of illness or an illness characterized by such symptoms, wherein the symptoms of illness are selected from the group of nausea, headache, muscle aches, back pain, shivering, vomiting and/or migraine.
  • Acute disease or acute conditions may be selected from the group but are not limited to the group comprising severe infections as e.g. meningitis, Systemic inflammatory Response-Syndrome (SIRS), or sepsis; other diseases as diabetes, cancer, acute and chronic vascular diseases as e.g. heart failure, myocardial infarction, stroke, atherosclerosis; shock as e.g. septic shock and organ dysfunction as e.g. kidney dysfunction, liver dysfunction, burnings, surgery, traumata, poisoning, damages induced by chemotherapy.
  • severe infections as e.g. meningitis, Systemic inflammatory Response-Syndrome (SIRS), or sepsis
  • other diseases as diabetes, cancer, acute and chronic vascular diseases as e.g. heart failure, myocardial infarction, stroke, atherosclerosis
  • shock as e.g. septic shock and organ dysfunction as e.g. kidney dysfunction, liver dysfunction, burnings, surgery, traumata, poisoning, damages induced by chemotherapy
  • the pharmaceutical formulation according to the present invention is for reducing the risk of mortality during sepsis and septic shock, i.e., late phases of sepsis.
  • Septic shock is a potentially fatal medical condition that occurs when sepsis, which is organ injury or damage in response to infection, leads to dangerously low blood pressure and abnormalities in cellular metabolism.
  • the Third International Consensus Definitions for Sepsis and Septic Shock (Sepsis-3) defines septic shock as a subset of sepsis in which particularly profound circulatory, cellular, and metabolic abnormalities are associated with a greater risk of mortality than with sepsis alone.
  • Patients with septic shock can be clinically identified by a vasopressor requirement to maintain a mean arterial pressure of 65 mm Hg or greater and serum lactate level greater than 2 mmol/L (>18 mg/dL) in the absence of hypovolemia.
  • the primary infection is most commonly caused by bacteria, but also may be by fungi, viruses or parasites. It may be located in any part of the body, but most commonly in the lungs, brain, urinary tract, skin, or abdominal organs. It can cause multiple organ dysfunction syndrome (formerly known as multiple organ failure) and death. Frequently, people with septic shock are cared for in intensive care units. It most commonly affects children, immunocompromised individuals, and the elderly, as their immune systems cannot deal with infection as effectively as those of healthy adults. The mortality rate from septic shock is approximately 25-50%.
  • SIRS Systemic inflammatory host response
  • central venous pressure is not within the range 8-12 mm Hg
  • central venous (superior vena cava) oxygen saturation is ⁇ 70% or mixed venous ⁇ 65%
  • At least one sign of end-organ dysfunction as mentioned under 3) is manifested.
  • Septic shock is indicated, if there is refractory hypotension that does not respond to treatment and intravenous systemic fluid administration alone is insufficient to maintain a patient's blood pressure from becoming hypotensive also provides for an administration of a pharmaceutical formulation in accordance with the present invention.
  • the pharmaceutical formulation is provided for use in therapy of an acute disease or acute condition and wherein the above acute disease or acute condition may be headache, preferably a primary headache, most preferred migraine.
  • acute disease or acute conditions may be selected from the group but are not limited to the group comprising severe infections as e.g. meningitis, Systemic inflammatory Response-Syndrome (SIRS), or sepsis; other diseases as diabetes, cancer, acute and chronic vascular diseases as e.g. heart failure, myocardial infarction, stroke, atherosclerosis; shock as e.g. septic shock and organ dysfunction as e.g. kidney dysfunction, liver dysfunction, burnings, surgery, traumata, poisoning, damages induced by chemotherapy.
  • severe infections as e.g. meningitis, Systemic inflammatory Response-Syndrome (SIRS), or sepsis
  • other diseases as diabetes, cancer, acute and chronic vascular diseases as e.g. heart failure, myocardial infarction, stroke, atherosclerosis
  • shock as e.g. septic shock and organ dysfunction as e.g. kidney dysfunction, liver dysfunction, burnings, surgery, traumata, poisoning, damages induced by chemotherapy.
  • the patient is not suffering from SIRS, a severe infection, sepsis, shock as e.g., septic shock.
  • Said severe infection denotes e.g., meningitis, Systemic inflammatory Response-Syndrome (SIRS), sepsis, severe sepsis, and shock as e.g., septic shock.
  • SIRS Systemic inflammatory Response-Syndrome
  • sepsis Sepsis
  • severe sepsis severe sepsis
  • shock as e.g., septic shock.
  • a severe sepsis is characterized in that sepsis is manifested in said patient, and additionally a clinical suspicion of any organ dysfunction is present, being it:
  • the term “nausea” refers to a sensation of unease and discomfort in the upper stomach with an involuntary urge to vomit (Metz A. 2017. Australian Family Physician Vol. 36 (92: 688-692). It may precede vomiting, but a person can have nausea without vomiting.
  • Nausea When prolonged, it is a debilitating symptom. Nausea is a non-specific symptom, which means that it has many possible causes. Some common causes of nausea are motion sickness, dizziness, migraine, fainting, low blood sugar, gastroenteritis (stomach infection) or food poisoning. Nausea is a side effect of many medications including chemotherapy, or morning sickness in early pregnancy. Nausea may also be caused by anxiety, disgust and depression.
  • headache is the symptom of pain anywhere in the region of the head or neck. It occurs in migraines (sharp or throbbing pains), tension-type headaches, and cluster headaches (Waldman et al. 2014. J Yoga Phys Ther 2014. 4:1). There is also an increased risk of depression in those with severe headaches. Headaches can occur as a result of many conditions whether serious or not. There are a number of different classification systems for headaches. It is well-recognized that causes of headaches may include fatigue, sleep deprivation, stress, effects of medications, the effects of recreational drugs, Viral infections, loud noises, common colds, head injury, rapid ingestion of a very cold food or beverage, and dental or sinus issues.
  • Primary headaches are benign, recurrent headaches not caused by underlying disease or structural problems. For example, migraine is a type of primary headache. While primary headaches may cause significant daily pain and disability, they are not dangerous.
  • the four categories of primary headaches are: migraine, tension-type headache (TTH) cluster headache and other trigeminal autonomic cephalalgias, and other primary headaches.
  • a migraine is a primary headache disorder characterized by recurrent headaches that are moderate to severe (for review see: Diener et al. 2012. Nat Rev Neurol. 8(3): 162-71).
  • the headaches affect one half of the head, are pulsating in nature, and last from two to 72 hours.
  • Associated symptoms may include nausea, vomiting, and sensitivity to light, sound, or smell. The pain is generally made worse by physical activity. Up to one-third of people have an aura: typically, a short period of visual disturbance, which signals that the headache will soon occur. Occasionally, an aura can occur with little or no headache following it.
  • muscle aches or “muscle pain”, also termed “myalgia”, refer to a symptom of many diseases and disorders (for review see: Kyriakides et al. 2013. European Journal of Neurology 20: 997—1005).
  • Myalgia without a traumatic history is often due to Viral infections. Longer-term myalgias may be indicative of a metabolic myopathy, some nutritional deficiencies or chronic fatigue syndrome.
  • back pain refers to painful sensations in the any part of the back.
  • Episodes of back pain may be acute, sub-acute, or chronic depending on the duration.
  • the pain may be characterized as a dull ache, shooting or piercing pain, or a burning sensation.
  • the pain may radiate into the arms and hands as well as the legs or feet and may include paresthesia (tingling with no apparent cause), weakness or numbness in the legs and arms.
  • the anatomic classification of back pain follows the segments of the spine: neck pain (cervical), middle back pain (thoracic), lower back pain (lumbar) or coccydynia (tailbone or sacral pain) with the lumbar vertebrae area most common for pain.
  • the pain may originate from the muscles, nerves, bones, joints or other structures in the vertebral column (spine), however, internal structures such as the gallbladder and pancreas may also cause referred pain in the back (Cohen et al. 2008. BMJ. 33 7.’u2 718).
  • shivering is a bodily function in response to early hypothermia or just feeling cold in warm-blooded animals.
  • the shivering reflex is triggered to maintain homeostasis. Skeletal muscles begin to shake in small movements, creating warmth by expending energy. Shivering can also be a response to a fever, as a person may feel cold.
  • the hypothalamic set point for temperature is raised. The increased set point causes the body temperature to rise (pyrexia), but also makes the patient feel cold until the new set point is reached.
  • Severe chills with violent shivering are called rigors. Rigors occur because the patient's body is shivering in a physiological attempt to increase body temperature to the new set point. Shivering can also appear after surgery, known as post-anesthetic shivering.
  • Vomiting also known as emesis and throwing up, among other terms, is the involuntary, forcefil 1 expulsion of the contents of one's stomach through the mouth and sometimes the nose (Metz A. 2017. Australian Family physician Vol. 36 (9): 688- 692).
  • Vomiting can be caused by a wide variety of conditions; it may present as a specific response to ailments like gastritis or poisoning, or as a non-specific sequela of disorders ranging from brain tumors and elevated intracranial pressure to overexposure to ionizing radiation.
  • the symptoms of illnesses or diseases in a patient in need of therapy and/or prevention of such symptoms are selected from the groups of disease indications comprising inflammatory conditions, autoimmune diseases, metabolic diseases, brain diseases, cardiovascular diseases and drug- induced diseases.
  • the types of symptoms and illnesses associated herewith are provided in form of non- limiting lists. It is noted that the herein described therapy or prevention may be directed to more than one type of symptom. Further, it is noted that a given medical indication, illness, or disease may be associated with more than one of the symptoms.
  • the symptom “nausea” may be associated with illnesses inside the abdomen, e. g. obstructing disorders (for example pyloric obstruction, small bowel obstruction, colonic obstruction, superior mesenteric artery syndrome), enteric infections (for example viral or bacterial infection), inflammatory diseases (such as cholecystitis, pancreatitis, appendicitis, hepatitis), sensorimotor dysfunction (for example, gastroparesis, intestinal pseudo-obstruction, gastroesophageal reflux disease, chronic idiopathic nausea, functional vomiting, cyclic vomiting syndrome, rumination syndrome) or biliary colic; illnesses outside the abdomen, e. g.
  • obstructing disorders for example pyloric obstruction, small bowel obstruction, colonic obstruction, superior mesenteric artery syndrome
  • enteric infections for example viral or bacterial infection
  • inflammatory diseases such as cholecystitis, pancreatitis, appendicitis, hepatit
  • cardiopulmonary disorder such as cardiomyopathy, myocardial infarction
  • inner- car diseases such as motion sickness, labyrinthitis, malignancies
  • intracerebral disorders for example hemorrhage, abscess, hydrocephalus, malignancies
  • psychiatric illnesses for example anorexia and bulimia nervosa, depression
  • post-operative vomiting nausea associated with medications and drugs (for example chemotherapy and biologies therapy, antibiotics, anti- arrhythmics, digoxin, oral hypoglycemic medications, oral contraceptives), nausea associated with endocrine/metabolic diseases (such as pregnancy, uremia, ketoacidosis, thyroid and parathyroid disease, adrenal insufficiency), nausea due to intoxication because of liver failure, alcohol abuse, etc.
  • the symptom “back pain” may be associated with illnesses due to inflammation, especially in the acute phase, which typically lasts from two weeks to three months, and may be associated with lumbago, trauma, injury, infections, cancer (especially cancers known to spread to the spine like breast, lung and prostate cancer), etc.
  • the symptom “myalgia” or “muscle pain” may be associated with injury or trauma, including sprains, hematoma, or overuse, wherein a muscle was used too much, too often, including protecting a separate injury, chronic tension, muscle pain due to rhabdomyolysis, associated with, e.g., viral infections, compression injury, drug-related, e.g., due to fibrates and statins, ACE inhibitors, cocaine, some antiretroviral drugs, severe potassium deficiency, fibromyalgia, Ehlers-Danlos syndrome, auto-immune disorders (including for example mixed connective tissue disease, Systemic lupus erythematosus, polymyalgia rheumatic, Myositis, such as polymyositis, dermatomyositis, and inclusion body myositis, multiple sclerosis, Myalgic Encephalomyelitis (chronic fatigue syndrome), Familial Mediterranean fever, Polyart
  • the symptom “headache” may be associated with primary headaches. 90% of all headaches are primary headaches. Primary headaches usually first start when people are between 20 and 40 years old. The most common types of primary headaches are migraines and tension-type headaches. They have different characteristics. Migraines typically present with pulsing head pain, nausea, photophobia (sensitivity to light) and phonophobia (sensitivity to sound). Tension-type headaches usually present with non-pulsing "bandlike" pressure on both sides of the head, not accompanied by other symptoms. Other very rare types of primary headaches include cluster headaches: short episodes (15-180 minutes) of severe pain, usually around one eye, with autonomic symptoms (tearing, red eye, nasal congestion) which occur at the same time every day.
  • Cluster headaches can be treated with triptans and prevented with prednisone, ergotamine or lithium; trigeminal neuralgia or occipital neuralgia characterized by shooting face pain, hemicrania continua, i.e., continuous unilateral pain with episodes of severe pain; primary stabbing headaches, e.g., recurrent episodes of stabbing "ice pick pain” or "jabs and jolts” for 1 second to several minutes without autonomic symptoms (tearing, red eye, nasal congestion); Primary cough headache that starts suddenly and lasts for several minutes after coughing, sneezing or straining (anything that may increase pressure in the head).
  • trigeminal neuralgia or occipital neuralgia characterized by shooting face pain, hemicrania continua, i.e., continuous unilateral pain with episodes of severe pain
  • primary stabbing headaches e.g., recurrent episodes of stabbing "ice pick pain” or "jabs and jolts” for 1 second to several minutes
  • cervicogenic headache Pain arising from the neck muscles
  • medication overuse headache in those using excessive painkillers for headaches
  • meningitis characterized by inflammation of the meninges which presents with fever and meningism’s, or stiff neck
  • bleeding inside the brain intracranial hemorrhage
  • subarachnoid hemorrhage acute, severe headache, stiff neck without fever
  • ruptured aneurysm arteriovenous malformation, intraparenchymal hemorrhage
  • temporal arteritis i.e., an inflammatory disease of arteries common in the elderly (average age 70), polymyalgia rheumatic; acute closed angle glaucoma (increased pressure in the eyeball); post-ictal headaches that happen after a convulsion or other type of seizure, as part of the period after the seizure (the post-ictal state); gastrointestinal disorders may cause headaches, including Helicobacter pylori infection, celiac disease
  • headache is defined as primary or secondary headache.
  • Primary headache is defined as migraine, tension-type headache (TTH), cluster headache and other trigeminal autonomic cephalalgias, and other primary headaches.
  • TTH tension-type headache
  • Diagnosis or assessment of headache is well- established in the art. Assessment may be performed based on subjective measures, such as patient characterization of symptoms.
  • migraine may be diagnosed based on the following criteria: 1) episodic attacks of headache lasting 4 to 72 hours; 2) with two of the following symptoms: unilateral pain, throbbing, aggravation on movement, and pain of moderate or severe intensity; and 3) one of the following symptoms: nausea or vomiting, and photophobia or phonophobia (Goadsby et al., N. Enel. J. Med. 346:257-270, 2002).
  • the symptom “shivering” may be associated with fever, cold sensitivity, menopause, panic attack, anxiety, bacterial infection, rickettsial infection, viral infection, drug withdrawal, etc.
  • the symptom “vomiting” may be associated with gastritis (inflammation of the gastric wall), gastroenteritis, gastroesophageal reflux disease, celiac disease, non-celiac gluten sensitivity, pyloric stenosis, bowel obstruction, overeating, acute abdomen and/or peritonitis, ileus, food allergies (often in conjunction with hives or swelling); cholecystitis, pancreatitis, appendicitis, hepatitis; food poisoning, allergic reaction to cow's milk proteins, e.g., milk allergy or lactose intolerance; motion sickness, Meniere's disease, concussion, cerebral hemorrhage, migraine, brain tumors, benign intracranial hypertension and hydrocephalus, metabolic disturbances such as hypercalcemia, Uremia adrenal insufficiency, hypoglycemia, hyperglycemia, drug reaction, alcohol intoxication, opioid uptake, selective serotonin reuptake inhibitors; use
  • Another embodiment of the invention relates to an anti-ADM antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of symptoms of illness selected from the group of nausea, headache, muscle aches, back pain, shivering, vomiting or for the use in therapy or prevention of illnesses characterized by such symptoms, such as migraine, in a subject in need thereof according to any of the preceding embodiments to be used in combination with known medicaments against nausea.
  • Another embodiment of the invention relates to an anti-ADM antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of symptoms of illness selected from the group of nausea, headache, muscle aches, back pain, shivering, vomiting or for the use in therapy or prevention of illnesses characterized by such symptoms, such as migraine, in a subject in need thereof according to any of the preceding embodiments to be used in combination with known medicaments against headache.
  • Another embodiment of the invention relates to an anti-ADM antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of symptoms of illness selected from the group of nausea, headache, muscle aches, back pain, shivering, vomiting or for the use in therapy or prevention of illnesses characterized by such symptoms, such as migraine, in a subject in need thereof according to any of the preceding embodiments to be used in combination with known medicaments against myalgia.
  • Another embodiment of the invention relates to an anti-ADM antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of symptoms of illness selected from the group of nausea, headache, muscle aches, back pain, shivering, vomiting or for the use in therapy or prevention of illnesses characterized by such symptoms, such as migraine, in a subject in need thereof according to any of the preceding embodiments to be used in combination with known medicaments against shivering.
  • Another embodiment of the invention relates to an anti-ADM antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of symptoms of illness selected from the group of nausea, headache, muscle aches, back pain, shivering, vomiting or for the use in therapy or prevention of illnesses characterized by such symptoms, such as migraine, in a subject in need thereof according to any of the preceding embodiments to be used in combination with known medicaments against vomiting.
  • Another embodiment of the invention relates to an anti-ADM antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of symptoms of illness selected from the group of nausea, headache, muscle aches, back pain, shivering, vomiting or for the use in therapy or prevention of illnesses characterized by such symptoms, such as migraine, in a subject in need thereof according to any of the preceding embodiments to be used in combination with known medicaments against back pain.
  • Subject matter of the present invention is a pharmaceutical formulation for use in therapy or prevention of an acute disease or acute condition of a patient for prevention or reduction of organ dysfunction or prevention of organ failure in said patient, wherein said acute disease or acute condition is selected from the group comprising as e.g. severe infections, diabetes, cancer, acute and chronic vascular diseases as e.g. heart failure, myocardial infarction, stroke, atherosclerosis, shock and organ dysfunction,, kidney dysfunction, liver dysfunction, burnings, surgery, traumata, poisoning and damages induced by chemotherapy and wherein said disease is not SIRS, sepsis or septic shock.
  • severe infections e.g. severe infections, diabetes, cancer, acute and chronic vascular diseases as e.g. heart failure, myocardial infarction, stroke, atherosclerosis, shock and organ dysfunction,, kidney dysfunction, liver dysfunction, burnings, surgery, traumata, poisoning and damages induced by chemotherapy and wherein said disease is not SIRS, sepsis or septic shock.
  • Organic dysfunction denotes a condition or a state of health where an organ does not perform its expected function.
  • Organic failure denotes an organ dysfunction to such a degree that normal homeostasis cannot be maintained without external clinical intervention
  • the patient group(s) addressed by the instant invention can be defined as set out below.
  • the criteria orientate on the clinical SOFA score.
  • the SOFA system was created in a consensus meeting of the European Society of Intensive Care Medicine in 1994 and further revised in 1996.
  • the SOFA is a six-organ dysfunction/failure score measuring multiple organ failure daily. Each organ is graded from 0 (normal) to 4 (the most abnormal), providing a daily score of 0 to 24 points.
  • the objective of the SOFA is to create a simple, reliable, and continuous score for clinical staff.
  • MAP mean arterial pressure
  • CNS central nervous system
  • SaOi peripheral arterial oxygen saturation.
  • TaCh/FICh ratio was used preferentially. If not available, the SaO2/FIO2 ratio was used; ’’vasoactive mediations administered for at least 1 hr (dopamine and norepinephrine pg/kg/min).
  • the patient group pursuant to the invention is having as lower threshold at least one SOFA score, being it 1 for one the clinical criteria respiration, or liver, or coagulation, or cardiovascular, or CNS, or renal on day of admission to hospital or Intensive Care Unit (ICU).
  • said patient group is in need of therapeutic intervention pursuant to the invention, and thus in need for prevention or reduction of organ dysfunction or organ failure
  • the patient group pursuant to the invention is having as lower threshold at least two SOFA scores, being it 1 each for the clinical criteria respiration, and/or liver, and/or coagulation, and/or cardiovascular, and/or CNS, and/or renal on day of admission to hospital or Intensive Care Unit (ICU).
  • said patient group is in need of therapeutic intervention pursuant to the invention, and thus in need for prevention or reduction of organ dysfunction or organ failure.
  • the patient group pursuant to the invention is having as lower threshold at least three SOFA scores, being it 1 each for the clinical criteria respiration, and/or liver, and/or coagulation, and/or cardiovascular, and/or CNS, and/or renal on day of admission to hospital or Intensive Care Unit (ICU).
  • said patient group is in need of therapeutic intervention pursuant to the invention, and thus in need for prevention or reduction of organ dysfunction or organ failure.
  • the patient group pursuant to the invention is having as lower threshold at least four SOFA scores, being it 1 each for the clinical criteria respiration, and/or liver, and/or coagulation, and/or cardiovascular, and/or CNS, and/or renal on day of admission to hospital or Intensive Care Unit (ICU).
  • said patient group is in need of therapeutic intervention pursuant to the invention, and thus in need for prevention or reduction of organ dysfunction or organ failure.
  • said clinical criteria denote the patient group(s) for kidney dysfunction / failure:
  • the patient group for liver dysfunction / failure is characterized by a lower threshold of Bilirubin of > 1.2 mg/dL, preferably > 1.9 mg/dL, more preferably > 5.9 mg/dL.
  • the pharmaceutical formulation may be also administered preventively before the patient exhibits any signs of dysfunction or failure of an organ. This might be the case if the patient has a chronic or acute disease or acute condition where dysfunction or failure problems may be expected, e.g. comprising severe infections as e.g. meningitis, Systemic inflammatory Response-Syndrome (SIRS,) sepsis; other diseases as diabetes, cancer, acute and chronic vascular diseases as e.g. heart failure, myocardial infarction, stroke, atherosclerosis; shock as e.g. septic shock and organ dysfunction as e.g. kidney dysfunction, liver dysfunction, burnings, surgery, traumata, poisoning.
  • the pharmaceutical formulation may be also administered preventively or therapeutically before, or during or after chemotherapy.
  • ischemic damages may occur to certain organs which may result in dysfunction or failure of an organ.
  • Preventively means before an organ damage occurs and therapeutically means that an organ damage has been already occurred.
  • the antibody or fragment or scaffold according to the present invention for reducing the risk of organ dysfunction or failure during sepsis and septic shock, i.e., late phases of sepsis.
  • Subject matter of the present invention is a pharmaceutical formulation for use in therapy or prevention of an acute disease or acute condition of a patient for stabilizing the systemic circulation of said patient, wherein said patient suffers from a disease that is selected from the group comprising SIRS, sepsis, diabetes, cancer, acute vascular diseases as e.g., heart failure, shock as e.g., septic shock and organ dysfunction as e.g., kidney dysfunction.
  • a disease that is selected from the group comprising SIRS, sepsis, diabetes, cancer, acute vascular diseases as e.g., heart failure, shock as e.g., septic shock and organ dysfunction as e.g., kidney dysfunction.
  • a pharmaceutical formulation for use in therapy of an acute disease or acute condition of a patient for stabilizing the circulation in particular the systemic circulation of said patient.
  • subject matter of the present invention is a pharmaceutical formulation for use in therapy of an acute disease or acute condition of a patient for stabilizing the systemic circulation of said patient wherein said patient is in need of stabilizing the circulation.
  • Systemic circulation refers to the part of the circulatory system in which the blood leaves the heart, services the body's cells, and then re-enters the heart.
  • Blood leaves through the left ventricle to the aorta, the body's largest artery.
  • the aorta leads to smaller arteries, arterioles, and finally capillaries. Waste and carbon dioxide diffuse out of the cell into the blood, and oxygen in the blood diffuses into the cell. Blood then moves to venous capillaries, and then to the venae cavae: the lower inferior vena cava and the upper superior vena cava, through which the blood re-enters the heart at the right atrium.
  • stabilizing the circulation means stabilizing the systemic circulation.
  • the term systemic circulation would not encompass phenomena of microcirculation.
  • Microcirculation is the delivery of fresh blood to the smallest blood vessels, present in the vasculature embedded within organ tissues. This contrasts with macrocirculation, which transport blood to and from the organs.
  • the state of the systemic circulation may be measures by parameters like mean arterial pressure, blood pressure (other parameters see above).
  • a patient in need for stabilizing the circulation may be, thus a patient that exhibits a heart rate of > 100 beats /min and or ⁇ 65 mm Hg mean arterial pressure.
  • an anti-Adrenomedullin (ADM) antibody or by an anti-ADM antibody fragment binding to adrenomedullin or an anti-ADM non-Ig scaffold binding to adrenomedullin, this can be measured and is characterized by an increase of the mean arterial pressure over 65 mm Hg and/or a decrease of heart rate under 100 beats/min.
  • ADM anti-Adrenomedullin
  • the provided pharmaceutical formulation is intended by the present invention to be applied for sake of stabilizing the systemic circulation, and thus are not necessarily intended for any methods of primary treatment or first line treatment to the acute disease or acute condition itself that has to be considered as underlying disease(s).
  • This means the present invention do not provide for a therapy of healing/curing e.g., cancer, diabetes, meningitis, polytrauma, and the like.
  • the therapy for an acute disease or acute condition of a patient within the scope of the invention is related to any kind of systemic circulatory insufficiency, or poor systemic circulation of the blood as an acute event.
  • Subject matter of the present invention is a pharmaceutical formulation a) for use in therapy of an acute disease or acute condition of a patient for stabilizing the systemic circulation of said patient wherein said patient is in need of stabilizing the systemic circulation and exhibits a heart rate of > 100 beats /min and/ or ⁇ 65 mm Hg mean arterial pressure and wherein stabilizing the systemic circulation means increasing the mean arterial pressure over 65 mmHg or b) for preventive use in therapy of an acute disease or acute condition of a patient in order to prevent that the heart rate increases to > 100 beats /min and/ or mean arterial pressure decreases to ⁇ 65 mm Hg.
  • the pharmaceutical formulation according to the present invention reduces the vasopressor-agents requirement, e.g., catecholamine requirement, of said patient.
  • the vasopressoragents requirement, e.g., catecholamine requirement of a patient is an indicator for the condition of the circulation of said patient.
  • the pharmaceutical formulation may be administered at a point of time when the patient is in need of a vasopressor agent, e.g., catecholamine.
  • said patient is a patient in need of increasing the blood pressure.
  • a patient in need of stabilizing the circulation may be also a patient having in addition to the above symptoms a respiratory rate > 20 /min.
  • a patient in need of stabilizing the circulation may be a patient with low cardiac output and /or a low blood pressure (hypotension).
  • This may be a patient with a heart rate > 90 beats/min. This may be a patient with mean arterial pressures ⁇ 65 mmHg or even with ⁇ 60 mmHg. Some patients with sepsis-induced hypofusion may remain hypotensive despite adequate fluid replacement. In these cases, vasopressor agents are needed to increase MAP.
  • the patient having a chronic or acute disease or acute condition is a patient in need of vasopressor agents to increase MAP.
  • Catecholamines such as dopamine, epinephrine (adrenaline), norepinephrine (noradrenaline), and phenylephrine have been traditionally used to raise blood pressure in patients with e.g., septic shock.
  • vasopressin has been suggested as potential vasopressor in patients with a chronic or acute disease or acute condition in need for stabilizing the circulation.
  • Vasopressor agents as catecholamine may stabilize the circulation of a patient having a chronic or acute disease or acute condition.
  • vasopressor agents’ administration e.g., catecholamine administration
  • the additional administration of said pharmaceutical formulation together with administration of e.g., catecholamine may help to stabilize the circulation of a patient whose condition is so critical that catecholamine administration without administration of said pharmaceutical formulation would not be sufficient in order to stabilize the circulation of said patient.
  • vasopressors may have serious side effects. Dopamine stimulates DI receptors in the renal regional circulation, producing vasodilation and increases blood flow. This is one of the reasons why clinicians have utilized low doses of dopamine to protect kidney function. Also, for other vasopressors it has been suggested that increasing the blood pressure with certain drugs, despite its intuitive appeal as something beneficial, can be associated with worse outcomes.
  • subject of the invention is a pharmaceutical formulation for use in therapy of an acute disease or acute condition of a patient in order to replace the administration of a vasopressor totally or partially.
  • the patient according to the present invention may be a patient being in need of or treatment with vasopressors or a patient receiving a treatment with vasopressors.
  • the pharmaceutical formulation may be also administered preventively before the patient exhibits any signs of serious circulation problems. This might be the case if the patient has a chronic or acute disease or acute condition where circulation problems may be expected, comprising severe infections as e.g. meningitis, Systemic inflammatory Response-Syndrome (SIRS), or sepsis; other diseases as diabetes, cancer, acute and chronic vascular diseases as e.g. heart failure, myocardial infarction, stroke, atherosclerosis; shock as e.g. septic shock and organ dysfunction as e.g. kidney dysfunction, liver dysfunction, burnings, surgery, traumata, poisoning, damages induced by chemotherapy.
  • severe infections as e.g. meningitis, Systemic inflammatory Response-Syndrome (SIRS), or sepsis
  • other diseases as diabetes, cancer, acute and chronic vascular diseases as e.g. heart failure, myocardial infarction, stroke, atherosclerosis
  • shock as e.g. septic shock and organ dysfunction as
  • Acute disease or acute condition may be a disease or condition wherein the patient is characterized as being in need of stabilizing the circulation.
  • the need of stabilizing the circulation is characterized as outlined above, namely this may be a patient preferably with a heart rate of > 90 beats/min or even with a heart rate of > 100 beats/min. This may be a patient with mean arterial pressures ⁇ 65 mmHg or even with ⁇ 60 mmHg.
  • a patient in need of stabilizing the circulation may be also a patient having a respiratory rate > 20 /min.
  • another active drug e.g., used as primary medicament
  • said patient having a chronic or acute disease or acute condition being in need for stabilizing the circulation is characterized by the need of the patient to get intravenous fluids.
  • Subject matter of the invention in one specific embodiment is, thus, said pharmaceutical formulation in combination with ADM binding protein and/or further active ingredients for use in therapy or prevention of a patient in need of intravenous fluids. This is in the sense of the patient is in need of intravenous fluids for regulating the systemic fluid balance
  • Said pharmaceutical formulation thereof with ADM binding protein and/or further active ingredients may be used in combination with vasopressors e.g., catecholamine and/or with fluids administered intravenously for use in a of a chronic or acute disease or acute condition of a patient for stabilizing the circulation, in particular for stabilizing the systemic circulation.
  • vasopressors e.g., catecholamine and/or with fluids administered intravenously for use in a of a chronic or acute disease or acute condition of a patient for stabilizing the circulation, in particular for stabilizing the systemic circulation.
  • the antibodies, antibody fragments and combinations of the present invention may be used in therapy or prevention of a chronic or acute disease of a patient:
  • vasopressors e.g., catecholamine requirement of said patient and / or
  • Subject matter of the present invention is a pharmaceutical formulation for use in therapy or prevention of an acute disease or acute condition of a patient for the regulation of fluid balance, wherein said patient is a patient in need of regulating the fluid balance and suffers from a disease that is selected from the group comprising systemic inflammatory Response-Syndrome (SIRS), sepsis, diabetes, cancer, heart failure, shock and kidney dysfunction.
  • SIRS systemic inflammatory Response-Syndrome
  • regulating fluid balance with the context of the instant invention is directed to any correction of a manifested - imbalance - of a patient’s fluid balance due to an underlying chronic or acute disease or acute condition. Said correction is in favour of re-establishing normotension in said patients.
  • the person skilled in the art is fully aware that blood pressure in general, as well as hyper- and hypotension is closely related to the fluid balance of a patient.
  • Fluid balance is the balance of the input and the output of fluids in the body to allow metabolic processes to function. Dehydration is defined as a 1% or greater loss of body mass as a result of fluid loss.
  • the three elements for assessing fluid balance and hydration status are: clinical assessment, body weight and urine output; review fluid balance charts and review of blood chemistry.
  • a person in need of regulating the fluid balance and/or improving the fluid balance of such patients is a person that has a 1% or greater loss of body mass as a result of fluid loss.
  • the fluid balance may be assessed according to Scales and Pilsworth (2008) Nursing Standard 22:47, 50-57.
  • normal urine output is in the range of 0.5 to 2 ml/kg of body weight per hour.
  • the minimum acceptable urine output for a patient with normal renal function is 0.5 ml/kg per hour. All these standards may be used to assess whether a patient is in need for regulating the fluid balance and/or improving the fluid balance.
  • Patient in status of fluid imbalance may get fluid administered intravenously as a standard measure of care, especially in an ICU setting. It is, however, desirable to reduce or avoid the additional fluid administration because of complications that might occur as e.g., the occurrence of edema (acroedema).
  • Edema means swelling caused by fluid in the body’s tissues. It may occur in feet and legs but can involve the entire body and can involve organs as e.g., lung, heart, eye.
  • said pharmaceutical formulation may be administered at a point of time when the patient is in need of fluid administration.
  • said patient is a patient in need of regulating the fluid balance.
  • subject matter of the present invention is also a pharmaceutical formulation for use in therapy of an acute disease or acute condition of a patient for the regulation of fluid balance which includes but is not limited to the prevention or reduction of edema.
  • Fluid balance/ Fluid therapy includes but is not limited to the prevention or reduction of edema.
  • the patient is referred to as being in negative fluid balance.
  • physiological fluid is often given intravenously by a physician to compensate for that loss.
  • a positive fluid balance where fluid gain is greater than fluid loss may provide for information to a problem with either the renal or cardiovascular system.
  • fluid therapy in general denotes the therapeutic administration of fluids (such as physiologic saline solution or water for injection (WFI)) to a patient as a treatment or preventative measure. It can be administered via intravenous, intraperitoneal, intraosseous, subcutaneous, and oral routes.
  • fluids such as physiologic saline solution or water for injection (WFI)
  • WFI water for injection
  • Fluid therapy is indicated either when there is a loss of fluid or there is a risk of loss of fluid due to an underlying disease or condition.
  • the medicaments provided by the present invention being said pharmaceutical formulation are only intended to be used for sake of regulating the fluid balance and thus not for any methods of primary treatment to a chronic or acute disease or condition itself.
  • This means the present invention does not provide for a therapy of healing/curing e.g. meningitis, Systemic inflammatory Response-Syndrome (SIRS), or sepsis, or severe sepsis; other diseases as diabetes, cancer, acute and chronic vascular diseases as e.g. heart failure, myocardial infarction, stroke, atherosclerosis; shock as e.g. septic shock and organ dysfunction as e.g.
  • SIRS Systemic inflammatory Response-Syndrome
  • the fluid regulating effect of the pharmaceutical formulation is thus supporting the primary therapy of said chronic or acute disease or acute condition.
  • a chronic or acute disease or acute condition like severe infections as e.g., meningitis, Systemic inflammatory Response-Syndrome (SIRS), sepsis or the like
  • the primary therapy would be e.g., the administration of antibiotics.
  • the pharmaceutical formulation would regulate the fluid balance and would help to prevent worsening of the critical condition of said patient until the e.g., antibiotic administration takes effect.
  • the pharmaceutical formulation may be administered in a preventive way or in a therapeutic way, this means in order to prevent fluid imbalance problems or in order to reduce fluid imbalance when fluid imbalance problems are present in said patient. Edema is included in the term fluid imbalance problems.
  • said patient having a chronic or acute disease or condition being in need for regulation of fluid balance is characterized by the need of said patient to get vasopressor agents, e.g., catecholamine, administration.
  • vasopressor agents e.g., catecholamine
  • Subject matter of the invention in one specific embodiment is, thus, said pharmaceutical formulation for use in therapy of a patient in need of a vasopressor agent, e.g., catecholamine treatment.
  • a vasopressor agent e.g., catecholamine treatment.
  • Subject matter of the present invention is a pharmaceutical formulation for use in therapy or prevention of congestion in a patient wherein said patient has a disease or condition selected from the group comprising: congestive high blood pressure, swelling or water retention (edema), heart failure in particular acute heart failure, kidney or liver disease.
  • a disease or condition selected from the group comprising: congestive high blood pressure, swelling or water retention (edema), heart failure in particular acute heart failure, kidney or liver disease.
  • said pharmaceutical formulation may be administered to a patient with vascular barrier dysfunction or endothelial dysfunction that may result in congestion.
  • Vascular barrier dysfunction or endothelial dysfunction is a systemic pathological state of the endothelium (the inner lining of blood vessels) and can be broadly defined as an imbalance between vasodilating and vasoconstricting substances produced by (or acting on) the endothelium (Dean field et al. 2005. J Hypertens 23 (1): 7-17).
  • Normal functions of endothelial cells include mediation of coagulation, platelet adhesion, immune function and control of volume and electrolyte content of the intravascular and extravascular spaces.
  • the endothelium is a cellular monolayer that lines the entire cardiovascular system and regulates many processes including vascular tone, thrombosis, angiogenesis, and inflammation.
  • Endothelial cells have been shown to be phenotypically dynamic and, in response to a variety of local and systemic stimuli, are able to transition between quiescent and activated states (Colombo et al. 2015. Curr Heart Fail Rep. 12(3): 215-222). In recent years, emerging research has demonstrated that endothelial dysfunction is a major contributor to cardiovascular disease, including hypertension, atherosclerosis, and congestive heart failure (Gutierrez et al. 2013. European Heart Journal 34: 3175-3181 ⁇ .
  • edema e.g., pulmonary edema
  • permeability to water low molecular weight solutes
  • Endothelial dysfunction can result from and/or contribute to several disease processes, as occurs in hypertension, hypercholesterolaemia, diabetes or septic shock. Endothelial dysfunction is a major pathophysiological mechanism that leads towards coronary artery disease, and other atherosclerotic diseases.
  • the pharmaceutical formulation when administered i.v., due to its size cannot cross the endothelial barrier into the interstitium but remains in the blood circulation.
  • ADM as a small peptide, can freely diffuse across the endothelial barrier.
  • the antibody when administered in a vast molar excess over the endogenous ADM, binds virtually all ADM in the plasma and, as a simple consequence of reaching binding equilibrium, leads to a translocation of ADM from the interstitium to the blood circulation. Interstitially located ADM can bind to vascular smooth muscle cells and induces relaxation resulting in vasodilation. This is reduced by administration of the antibody.
  • ADM in plasma binds to endothelial cells and thereby stabilizes or even restores vascular integrity.
  • this function is strengthened, when plasma ADM levels increase as a consequence of administration of the antibody, which is a non-neutralizing antibody.
  • binding of the antibody to ADM reduces the proteolytic decay of ADM.
  • said pharmaceutical formulation is for use in intervention and therapy of congestion in a patient according to any embodiment of the invention, wherein said patient is resistant against diuretics or is a non-responder to diuretics therapy.
  • Another specific embodiment of the invention relates to said pharmaceutical formulation for use in intervention and therapy of congestion in a patient in need thereof and wherein said patient is resistant against diuretics or is a non-responder to diuretics therapy.
  • diuretic resistance is defined in general as failure to decrease the extracellular fluid volume despite liberal use of diuretics (Ravnan et al. 2002. CHF 8:80-85).
  • Epstein et al. defined diuretic resistance as a failure to excrete at least 90 mmol of sodium within 72 hours of a 160-mg oral furosemide dose given twice daily (Epstein et al. 1977. Curr TherRes. 21:656-667).
  • Adaptation to diuretic drugs and diuretic resistance may be caused by similar mechanisms.
  • Diuretic adaptations can be classified as those that occur during diuretic action, those that cause sodium retention in the short term (causing 'post-diuretic NaCl retention'), and those that increase sodium retention chronically (the 'braking phenomenon').
  • Ways in which kidneys adapt to chronic diuretic treatment are: First, nephron segments downstream from the site of diuretic action increase NaCl reabsorption during diuretic administration because delivered NaCl load is increased. Second, when diuretic concentrations in the tubule decline, the kidney tubules act to retain Na until the next dose of diuretic is administered.
  • diuretic resistance is thought to occur in one of three patients with congestive HF. Heart failure represents the most common clinical situation in which diuretic resistance is observed. In mild congestive HF, diuretic resistance is not commonly encountered, as long as renal function is preserved. However, in moderate and severe congestive HF patients, diuretic resistance occurs more frequently and often becomes a clinical problem (Brater 1985. Drugs 30:427-443: Taylor 2000 Cardiol Rev. 8:104-114).
  • Subject matter of the present invention is a pharmaceutical formulation for use in therapy or prevention comprising:
  • pre-pro-Adrenomedullin selected from the group comprising Midregional Proadrenomedullin (MR-proADM), C-terminal Proadrenomedullin (CT-proADM), Bio-ADM, ADM-gly or Proadrenomedullin N-terminal 20 peptide (PAMP) or fragments thereof prior to drug administration in a bodily fluid obtained from said subject; and
  • pre-pro-Adrenomedullin selected from the group comprising MR-proADM, CT-proADM, PAMP, Bio-ADM or ADM-gly to a predefined threshold or to a previously determined level of said fragment
  • an elevated level of said fragment of pre-pro-Adrenomedullin selected from the group comprising MR-proADM, CT-proADM, PAMP, Bio-ADM or ADM-gly or fragments thereof above a certain threshold or above a previously determined level is used for patient stratification for a therapeutic use according to the present invention.
  • PAMP comprises both circulating forms of PAMP, namely a biologically inactive C-terminally Glycine-extended PAMP (PAMP-Gly) and a biologically active C-terminally amidated PAMP (PAMP-amide).
  • Bio-ADM and “ADM-NH2” are to be used synonymously and both refer to the circulating bioactive Adrenomedullin.
  • fragments of pre-pro-Adrenomedullin that may be determined in a bodily fluid is/are selected from the group comprising:
  • SEQ ID No. 10 (Proadrenomedullin N-20 terminal peptide, PAMP): amino acids 22 -41 ofpreproADM ARLDVASEF RKKWNKWALS R
  • SEQ ID No. 12 C-terminal proAdrenomedullin, CT-proADM: amino acids 148 - 185 of preproADM RRR RRSLPEAGPG RTLVSSKPQA HGAPAPPSGS APHFL
  • SEQ ID No. 13 (mature human Adrenomedullin (mature ADM); amidated ADM; bio-ADM; ADM- NH2): amino acids 1-52 or amino acids 95 — 146 of pro-ADM
  • said fragment of pre- proAdrenomedullin having at least 5 amino acids is/are selected from the group comprising MR-proADM (SEQ ID No. 11), CT- proADM (SEQ ID No. 12) and/or PAMP (SEQ ID No. 10).
  • the level of the fragments of pre-proADM and/or fragments thereof is determined by using at least one binder, wherein said binder binds to a region comprised within the sequence of MR-proADM (SEQ ID No. 11).
  • the level of the fragments of pre-pro-ADM and/or fragments thereof is determined by using at least one binder, wherein said binder binds to a region comprised within the sequence of CT-proADM (SEQ ID No. 12).
  • the level of the fragments of pre-proADM and/or fragments thereof is determined by using at least one binder, wherein said binder binds to a region comprised within the sequence of PAMP (SEQ ID No. 10).
  • Subject matter in a particular embodiment of the present application is a method, wherein said fragment may be selected from MR-proADM according to SEQ ID No.: 11 and/or CT-proADM according to SEQ ID No.: 12 and/or PAMP according to SEQ ID No.: 10.
  • said proADM and/or fragments thereof having at least 5 amino acids is/are selected from the group comprising mature ADM-NH2 (SEQ ID No. 13), ADM 1-52-Gly (SEQ ID No. 14), MR-proADM (SEQ ID No. 11) and CT-proADM (SEQ ID No. 12).
  • the level of mature ADM-NH2 (SEQ ID No. 13) and/or ADM 1-52-Gly (SEQ ID No. 14) - immunoreactivity or the level of MR-proADM (SEQ ID No. 11) immunoreactivity or the level of CT-proADM (SEQ ID No. 12) immunoreactivity is determined and correlated with the need of said patient for therapy or intervention, wherein said patient is identified as having such a need if the level of mature ADM-NH2 (SEQ ID No. 13) and/or ADM 1-52-Gly (SEQ ID No. 14) - immunoreactivity or the level of MR- proADM (SEQ ID No.
  • the level of proADM and/or fragments thereof is determined by using at least one binder selected from the group: a binder that binds to a region comprised within the following sequence of mature DM-NH2 (SEQ ID No. 13) and/or ADMl-52-Gly (SEQ ID No. 14) and a second binder that binds to a region comprised within the sequence of mature ADM-NH2 (SEQ ID NO. 13) and/or ADM 1-52-Gly
  • the level of proADM and/or fragments thereof is determined by using at least one binder selected from the group: a binder that binds to a region comprised within the sequence of MR-proADM (SEQ ID No. 11) and a second binder that binds to a region comprised within the sequence of MR-proADM
  • the level of pro-ADM and/or fragments thereof is determined by using at least one binder selected from the group: a binder that binds to a region comprised within the sequence of CT-proADM (SEQ ID No. 12) and a second binder that binds to a region comprised within the sequence of CT-pro-ADM
  • Subject matter in a particular embodiment of the present diagnostic method is a method, according to the present invention wherein said fragment may be selected from MR-proADM according to SEQ ID No.: 1 lor mature ADM-NH2 according to SEQ ID No.: 13.
  • the threshold is within a threshold range for plasma MR- proADM that is between 0.5 and 1.5 nmol/L, preferably between 0.7 and 1 nmol/L, most preferred a threshold of 0.8 nmol/L is applied.
  • the predetermined threshold of Bio-ADM in a sample of bodily fluid of said subject is between 40 and 100 pg/mL, more preferred between 50 and 90 pg/mL, even more preferred between 60 and 80 pg/mL, most preferred said threshold is 70 pg/mL.
  • the threshold is within a threshold range for plasma CT- proADM that is between 85 and 350 pmol/L, preferably between 100 and 250 pmol/L, most preferred a threshold of 150 pmol/L is applied.
  • a threshold for plasma PAMP-amide that is between 0.3 and 1.2 pmol/L, preferably between 0.4 and 1.0 pmol/L, most preferred a threshold of 0.8 pmol/L is applied.
  • a threshold for plasma PAMP-glycine that is between 0.5 and 2.0 pmol/L, preferably between 0.7 and 1.8 pmol/L, most preferred a threshold of 1.5 pmol/L is applied.
  • the threshold is within a threshold range for plasma ADM- NEL that is between 50 and 100 pg/ml, preferably between 60 and 90 pg/ml, most preferred a threshold of 70 pg/ml is applied.
  • a threshold for plasma Bio-ADM is the 5fold median concentration, preferably the 4fold median concentration, more preferred the 3 fold median concentration, most preferred the 2fold median concentration of a normal healthy population.
  • a threshold for plasma MR-proADM is the 5fold median concentration, preferably the 4fold median concentration, more preferred the 3 fold median concentration, most preferred the 2fold median concentration of a normal healthy population.
  • a threshold for plasma CT-proADM is the 5fold median concentration, preferably the 4fold median concentration, more preferred the 3 fold median concentration, most preferred the 2fold median concentration of a normal healthy population.
  • a threshold for plasma ADM-Gly is the 5fold median concentration, preferably the 4fold median concentration, more preferred the 3 fold median concentration, most preferred the 2fold median concentration of a normal healthy population.
  • a threshold for plasma PAMP is the 5fold median concentration, preferably the 4fold median concentration, more preferred the 3 fold median concentration, most preferred the 2fold median concentration of a normal healthy population.
  • Threshold levels can be obtained for instance from a Kaplan-Meier analysis, where the occurrence of a disease is correlated with the quartiles of the biomarker in the population. According to this analysis, subjects with biomarker levels above the 75th percentile have a significantly increased risk for getting the diseases according to the invention. This result is further supported by Cox regression analysis with full adjustment for classical risk factors: The highest quartile versus all other subjects is highly significantly associated with increased risk for getting a disease according to the invention.
  • cut-off values are for instance the 90th, 95th or 99th percentile of a normal population.
  • a higher percentile than the 75th percentile one reduces the number of false positive subjects identified, but one might miss to identify subjects, who are at moderate, albeit still increased risk.
  • the above-mentioned threshold values might be different in other assays, if these have been calibrated differently from the assay system used in the present invention. Therefore, the above-mentioned threshold shall apply for such differently calibrated assays, accordingly, taking into account the differences in calibration.
  • One possibility of quantifying the difference in calibration is a method comparison analysis (correlation) of the assay in question (e.g., bio-ADM assay) with the respective biomarker assay used in the present invention by measuring the respective biomarker (e.g., bio-ADM) in samples using both methods.
  • Subject matter of the present diagnostic method is a method according to the diagnostic method invention, wherein the level of Pro-Adrenomedullin or fragments thereof of at least 5 amino acids is determined by using a binder to Pro-Adrenomedullin or fragments thereof of at least 5 amino acids.
  • Subject matter of the present invention is a pharmaceutical formulation for use in therapy or prevention for use in therapy of a patient with shock, in particular septic shock, wherein said patient:
  • ADM Anti-adrenomedullin
  • ADM Anti-adrenomedullin
  • the term “admission to ICU” refers to patients admitted to intensive care are patients who have, or are likely to have, one or several acute, directly life-threatening malfunctions which require the use of organ supporting methods. Criteria for admitting patients to intensive care units have been developed which are well documented in the art (Nates et al. (2016), Critical care medicine 44: 1553- 1602). The term “admission to ICU” shall encompass admissions under these criteria.
  • Types of organ support include:
  • comprising advanced respiratory support therapy such as tracheal intubation and mechanical ventilation support
  • ⁇ basic respiratory support therapy such as use of supplemental oxygen, the use of an incentive spirometer, chest percussion nebulization, etc.
  • Circulatory support therapy such as mechanical circulatory support (e.g., the use of an intraaortic balloon pump and a ventricular assist device) and the medical therapy including the use of an angiotensin converting enzyme, beta blockers, etc.
  • Renal support therapy such as hemodialysis and peritoneal dialysis
  • Hemodynamic monitoring or support therapy such as measuring the pressure, flow and oxygen content of the blood, fluid resuscitation or blood transfusion and the use of vasoactive drugs 8e.g. nitroglycerine, nitric oxide, etc.
  • Neurological monitoring or support such as an intraventricular catheter.
  • adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is for use in therapy of a patient with shock, in particular septic shock, wherein said patient:
  • ADM Anti-adrenomedullin
  • ADM Anti-adrenomedullin
  • ADM Anti-adrenomedullin
  • ADM Anti-adrenomedullin
  • YRQSMNNFQGLRSFGCRFGTC SEQ ID No.
  • the starting point of treatment with said Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is the shortest of a) and b).
  • the starting point of treatment with the Anti- adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is the shortest of a) and c).
  • the starting point of treatment with the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is the shortest of b) and c).
  • the starting point of treatment with the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is the shortest of a), b) and c).
  • the invention relates to an adrenomedullin (ADM) antibody or an anti- adrenomedullin antibody fragment or anti-ADM non-Ig scaffold for use in therapy of a patient with shock, in particular septic shock, wherein said patient:
  • ADM adrenomedullin
  • ADM Anti- adrenomedullin
  • ADM Anti-adrenomedullin
  • ADM Anti-adrenomedullin
  • the patient has suffered from shock, in particular from a septic shock, not longer than 9, preferably 8.4, preferably 8.26 (0.344days), preferably 8, preferably 7, preferably 6, preferably 5,76 (0.25 days), preferably 5,75 (0.24 days), 5, preferably 4, preferably 3 hours at the starting point of treatment with said Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold.
  • ADM Anti-adrenomedullin
  • the patient has suffered from shock, in particular from a septic shock, not longer than 8.4, preferably 8.26 (0.344days) at the starting point of treatment with said Anti- adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold.
  • shock in particular from a septic shock, not longer than 8.4, preferably 8.26 (0.344days) at the starting point of treatment with said Anti- adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold.
  • ADM Anti- adrenomedullin
  • the patient has been admitted to ICU not longer than 9, preferably 8.4, preferably 8.26 (0.344 days), preferably 8, preferably 7, preferably 6, preferably 5,76 (0.25 days), preferably 5,75 (0.24 days) preferably 5, preferably 4, preferably 3 hours at the starting point of treatment with said Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold.
  • ADM Anti-adrenomedullin
  • the patient has been admitted to ICU not longer than 8.4, preferably no longer than 8.26 (0.344 days), at the starting point of treatment with said Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold.
  • ADM Anti-adrenomedullin
  • the patient has received organ support not longer than 9, preferably 8.4, preferably 8.26 (0.344 days), preferably 8, preferably 7, preferably 6, preferably 5,76 (0.25 days), preferably 5,75 (0.24 days), preferably 5, preferably 4, preferably 3 hours at the starting point of treatment with said Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold.
  • ADM Anti-adrenomedullin
  • the patient has received organ support not longer than 8.4, preferably no longer than 8.26 (0.344 days at the starting point of treatment with said Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold
  • the anti-Adrenomedullin -adrenomedullin (ADM) antibody or an anti- adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is for use in therapy of a patient suffering from shock, in particular septic shock, wherein said Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered
  • the anti-Adrenomedullin -adrenomedullin (ADM) antibody or an anti- adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is for use in therapy of a patient suffering from shock, in particular septic shock, wherein said Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered
  • the anti-Adrenomedullin -adrenomedullin (ADM) antibody or an anti- adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is for use in therapy of a patient suffering from shock, in particular septic shock, wherein said Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered
  • the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold can be administered a) within 10 hours after occurrence of shock in said patient and b) within 10 hours after admission of said patient to ICU, the Anti- adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non- Ig scaffold is administered at the shortest of a) and b).
  • the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold can be administered a) within 10 hours after occurrence of shock in said patient and c) before the patient has received organ support or not longer than lOh of organ support
  • the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered at the shortest of a) and c).
  • the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold can be administered b) within 10 hours after admission of said patient to ICU and c) before the patient has received organ support or not longer than lOh of organ support
  • the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered at the shortest of b) and c).
  • the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti- ADM non-Ig scaffold can be administered a) within 10 hours after occurrence of shock in said patient and b) within 10 hours after admission of said patient to ICU and c) before the patient has received organ support or not longer than 10 hours of organ support, the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered at the shortest of a), b) and c).
  • the anti-Adrenomedullin -adrenomedullin (ADM) antibody or an anti- adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is for use in therapy of a patient suffering from shock, in particular septic shock, wherein said Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered
  • the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered within 9, preferably 8.4, preferably 8.26 (0.344 days), preferably 8, preferably 7, preferably 6, preferably 5,76 (0.25 days), preferably 5,75 (0.25 days), preferably 5, preferably 4, preferably 3 hours after occurrence of shock and/or sepsis in said patient.
  • ADM Anti-adrenomedullin
  • the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered within 8.4, preferably 8.26 (0.344 days) hours after occurrence of shock and/or sepsis in said patient.
  • the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered within 9, preferably 8.4, preferably 8.26 (0.344 days), preferably 8, preferably 7, preferably 6, preferably 5,76 (0.25 days), preferably 5,75 (0.25 days), preferably 5, preferably 4, preferably 3 hours after admission of said patient to ICU.
  • ADM Anti-adrenomedullin
  • the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered 8.4, preferably 8.26 (0.344 days) hours after admission of said patient to ICU.
  • the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered within 9, preferably 8.4, preferably 8.26 (0.344 days), preferably 8, preferably 7, preferably 6, preferably 5,76 (0.25 days), preferably 5,75 (0.25 days), preferably 5, preferably 4, preferably 3 hours after the patient has received organ support at the starting point of treatment with said Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold.
  • the Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is administered 8.4, preferably 8.26 (0.344 days) hours after the patient has received organ support at the starting point of treatment with said Anti- adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold.
  • said shock is selected from the group comprising shock due to hypovolemia, cardiogenic shock, obstructive shock and distributive shock, in particular cardiogenic or septic shock.
  • said shock is selected from the group comprising:
  • said patient has suffered an acute coronary syndrome (e.g., acute myocardial infarction) or has heart failure (e.g., acute decompensated heart failure), myocarditis, arrhythmia, cardiomyopathy, valvular heart disease, aortic dissection with acute aortic stenosis, traumatic chordal rupture or massive pulmonary embolism, or
  • said patient may have suffered a hemorrhagic disease including gastrointestinal bleed, trauma, vascular etiologies (e.g. ruptured abdominal aortic aneurysm, tumor eroding into a major blood vessel) and spontaneous bleeding in the setting of anticoagulant use or a non-hemorrhagic disease including vomiting, diarrhea, renal loss, skin losses/insensible losses (e.g. bums, heat stroke) or third-space loss in the setting of pancreatitis, cirrhosis, intestinal obstruction, trauma, or
  • the shock is a septic shock, shock due to Covid- 19, shock due to bums or a traumatic shock.
  • the invention relates to an anti-ADM antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy of a patient in shock, in particular septic shock, wherein said patient has been in shock not longer than 10 hours at the starting point of treatment with said an anti-ADM antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold and/or patient who has been admitted to ICU not longer than 10 hours at the starting point of said treatment and/or has not received organ support at all or not longer than 10 hours of organ support at the starting point of treatment with said Anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold, wherein a sample of bodily fluid taken said patient exhibits a level of bioADM > 70 pg/rnL, and wherein said bodily fluid is selected from the group comprising whole blood, plasma, serum.
  • ADM Anti-adrenomedullin
  • Subject matter of the present invention is a pharmaceutical formulation for use in therapy or prevention for use in therapy wherein said patient has shock that is selected from the group comprising shock due to hypovolemia, cardiogenic shock, obstructive shock and distributive shock, in particular cardiogenic shock, septic shock, shock due to Covid- 19, shock due to bums and traumatic shock.
  • a further embodiment of the invention is a pharmaceutical formulation for use in therapy or prevention for use in therapy wherein said patient has shock due chemical contamination with acidic, basic or oxidative reagents and chemicals in solid, liquid or gaseous form.
  • shock is characterized by decreased oxygen delivery and/or increased oxygen consumption or inadequate oxygen utilization leading to cellular and tissue hypoxia. It is a life- threatening condition of circulatory failure and most commonly manifested as hypotension (systolic blood pressure less than 90 mm Hg or MAP less than 65 mmHg). Shock is divided into four main types based on the underlying cause: hypovolemic, cardiogenic, obstructive, and distributive shock (Vincent and De Backer 2014. N. Engl. J. Med. 370(6): 583).
  • cardiogenic shock refers to shock where the patient may have suffered an acute coronary syndrome (e.g., acute myocardial infarction) or wherein said patient has heart failure (e.g., acute decompensated heart failure), myocarditis, arrhythmia, cardiomyopathy, valvular heart disease, aortic dissection with acute aortic stenosis, traumatic chordal rupture or massive pulmonary embolism.
  • Cardiogenic shock CS is defined as a state of critical endorgan hypoperfusion due to reduced cardiac output. Notably, CS forms a spectrum that ranges from mild hypoperfusion to profound shock.
  • Established criteria for the diagnosis of CS are: (i) systolic blood pressure, ⁇ 90 mmHg for >30 min or vasopressors required to achieve a blood pressure >90 mmHg; (ii) pulmonary congestion or elevated left-ventricular filling pressures; (iii) signs of impaired organ perfusion with at least one of the following criteria: (a) altered mental status; (b) cold, clammy skin; (c) oliguria ( ⁇ 0.5 mL/kg/h or ⁇ 30 mL/h); (d) increased serum-lactate (Reynolds and Hochman 2008. Circulation 117: 686-697).
  • AMI Acute myocardial infarction
  • Non-AMI-related CS may be caused by decompensated valvular heart disease, acute myocarditis, arrhythmias, etc. with heterogeneous treatment options. This translates in 40 000 to 50 000 patients per year in the USA and 60 000 to 70 000 in Europe.
  • hypovolemic shock refers to a shock where the patient may have suffered a hemorrhagic disease including gastrointestinal bleed, trauma, vascular etiologies (e.g. ruptured abdominal aortic aneurysm, tumor eroding into a major blood vessel) and spontaneous bleeding in the setting of anticoagulant use or a non-hemorrhagic disease including vomiting, diarrhea, renal loss, skin losses/insensible losses (e.g. bums, heat stroke) or third-space loss in the setting of pancreatitis, cirrhosis, intestinal obstruction, trauma.
  • a hemorrhagic disease including gastrointestinal bleed, trauma, vascular etiologies (e.g. ruptured abdominal aortic aneurysm, tumor eroding into a major blood vessel) and spontaneous bleeding in the setting of anticoagulant use or a non-hemorrhagic disease including vomiting, diarrhea, renal loss, skin losses/insensible losses (e.g. bum
  • Hypovolemic shock is characterized by decreased intravascular volume and can be divided into two broad subtypes: hemorrhagic and non-hemorrhagic.
  • hemorrhagic hypovolemic shock include gastrointestinal bleed, trauma, vascular etiologies (e.g., ruptured abdominal aortic aneurysm, tumor eroding into a major blood vessel) and spontaneous bleeding in the setting of anticoagulant use.
  • Common causes of non-hemorrhagic hypovolemic shock include vomiting, diarrhea, renal loss, skin losses/insensible losses (e.g., bums, heat stroke) or third-space loss in the setting of pancreatitis, cirrhosis, intestinal obstruction, trauma.
  • Statitis cirrhosis
  • intestinal obstruction e.g., cirrhosis
  • obstructive shock refers to a shock where the patient may have suffered a cardiac tamponade, tension pneumothorax, pulmonary embolism or aortic stenosis.
  • Obstructive shock is due to a physical obstruction of the great vessels or the heart itself.
  • Several conditions can result in this form of shock (e.g., cardiac tamponade, tension pneumothorax, pulmonary embolism, aortic stenosis).
  • cardiac tamponade tension pneumothorax
  • pulmonary embolism aortic stenosis
  • distributed shock refers to a shock where the patient may have septic shock, neurogenic shock, anaphylactic shock or shock due to adrenal crisis. According to the cause, there are four types of distributive shock: neurogenic shock (decreased sympathetic stimulation leading to decreased vasal tone), anaphylactic shock, septic shock and shock due to adrenal crisis. In addition to sepsis, distributive shock can be caused by systemic inflammatory response syndrome (SIRS) due to conditions other than infection such as pancreatitis, bums or trauma.
  • SIRS systemic inflammatory response syndrome
  • TSS toxic shock syndrome
  • anaphylaxis a sudden, severe allergic reaction
  • adrenal insufficiency acute worsening of chronic adrenal insufficiency, destruction or removal of the adrenal glands, suppression of adrenal gland function due to exogenous steroids, hypopituitarism and metabolic failure of hormone production
  • reactions to drugs or toxins heavy metal poisoning
  • hepatic liver insufficiency and damage to the central nervous system.
  • Refractory shock has been defined as requirement of noradrenaline infusion of >0.5 pg/kg/min despite adequate volume resuscitation. Mortality in these patients may be as high as 94% and the assessment and management of these patients requires a much more aggressive approach for survival.
  • the term is used when the tissue perfusion cannot be restored with the initial corrective measures employed (e.g., vasopressors) and may therefore be referred to as locallyhigh vasopressor-dependent" or expedivasopressor-resistant“ shock (Udupa and Shetty 2018. Indian JRespir Care 7: 67-72).
  • Patients with refractory shock may have features of inadequate perfusion such as hypotension (mean arterial blood pressure ⁇ 65 mmHg), tachycardia, cold peripheries, prolonged capillary refill time, and tachypnea consequent to the hypoxia and acidosis. Fever may be seen in septic shock. Other signs of hypoperfusion such as altered sensorium, hyperlactatemia, and oliguria may also be seen. These well-known signs of shock are not helpful in identifying whether the problem is at the pump (heart) or circuitry (vessels and tissues). Different types of shock can coexist, and all forms of shock can become refractory, as evidenced by unresponsiveness to high-dose vasopressors (Udupa and Shetty 2018. Indian JRespir Care 7: 67-72).
  • Subject matter of the present invention is a pharmaceutical formulation for use in therapy or prevention for use in therapy wherein said patient has shock, wherein said patient is characterized by having a level of dipeptidyl peptidase 3 (DPP3) in a sample of bodily fluid below a threshold prior to drug administration and said anti- ADM antibody or anti-ADM fragment or anti-ADM non-Ig scaffold binds to the N-terminal part (amino acid 1-21) of ADM: YRQSMNNFQGLRSFGCRFGTC (SEQ ID No. 1).
  • DPP3 dipeptidyl peptidase 3
  • Subject matter of the present invention is a pharmaceutical formulation for use in therapy or prevention wherein said threshold of DPP3 in a sample of bodily fluid of said patient is between 20 and 120 ng/mL, more preferred between 30 and 80 ng/mL, even more preferred between 40 and 60 ng/mL, most preferred said threshold is 50 ng/mL.
  • Subject matter of the present invention is a pharmaceutical formulation for use in therapy or prevention wherein the level of DPP3 is determined by contacting said sample of bodily fluid with a capture binder that binds specifically to DPP3.
  • One embodiment of the present application relates to an anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of shock in a patient, wherein said shock is selected from the group comprising shock due to hypovolemia, cardiogenic shock, obstructive shock and distributive shock, in particular cardiogenic shock or septic shock.
  • Another embodiment of the present application relates to an anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of shock in a patient, wherein
  • said patient may have suffered an acute coronary syndrome (e.g., acute myocardial infarction) or wherein said patient has heart failure (e.g., acute decompensated heart failure), myocarditis, arrhythmia, cardiomyopathy, valvular heart disease, aortic dissection with acute aortic stenosis, traumatic chordal rupture or massive pulmonary embolism, or
  • said patient may have suffered a hemorrhagic disease including gastrointestinal bleed, trauma, vascular etiologies (e.g. ruptured abdominal aortic aneurysm, tumor eroding into a major blood vessel) and spontaneous bleeding in the setting of anticoagulant use or a non-hemorrhagic disease including vomiting, diarrhea, renal loss, skin losses/insensible losses (e.g. bums, heat stroke) or third-space loss in the setting of pancreatitis, cirrhosis, intestinal obstruction, trauma, or
  • said patient may have septic shock, neurogenic shock, anaphylactic shock or shock due to adrenal crisis.
  • One preferred embodiment of the present application relates to an anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of shock in a patient, wherein said threshold of DPP3 in a sample of bodily fluid of said patient is between 20 and 120 ng/mL, more preferred between 30 and 80 ng/mL, more preferred between 40 and 90 ng/mL, even more preferred between 40 and 60 ng/mL, most preferred said threshold is 50 ng/mL.
  • One specific embodiment of the present application relates to an anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of shock in a patient, wherein the level of DPP3 is determined by contacting said sample of bodily fluid with a capture binder that binds specifically to DPP3.
  • Another embodiment of the present application relates to an anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of shock in a patient, wherein either the level of DPP3 protein and/or the level of active DPP3 is determined and compared to a predetermined threshold.
  • One embodiment of the present application relates to an anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of shock in a patient, wherein said patient is additionally characterized by having a level of ADM-NH2 above a threshold.
  • the level of ADM -NH2 is measured in order to identify patients in shock.
  • One preferred embodiment of the present application relates to an anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of shock in a patient, wherein said threshold of ADM-NH2 in a sample of bodily fluid of said patient is between 40 and 100 pg/rnL, more preferred between 50 and 90 pg/mL, even more preferred between 60 and 80 pg/mL, most preferred said threshold is 70 pg/mL.
  • Another embodiment of the present application relates to an anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of shock in a patient, wherein the level of ADM-NH2 is determined by contacting said sample of bodily fluid with a capture binder that binds specifically to ADM-NH2.
  • Another preferred embodiment of the present application relates to an anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold for use in therapy or prevention of shock in a patient, wherein the sample of bodily fluid of said patient is selected from the group of blood, serum, plasma, urine, cerebrospinal fluid (CSF), and saliva.
  • the sample of bodily fluid of said patient is selected from the group of blood, serum, plasma, urine, cerebrospinal fluid (CSF), and saliva.
  • Another embodiment of the present application relates to a method of treatment or prevention of shock in a patient, the method comprising administering an anti-adrenomedullin (ADM) antibody or an anti- adrenomedullin antibody fragment or anti-ADM non-Ig scaffold to said patient, the method comprising the steps:
  • ADM anti-adrenomedullin
  • Another specific embodiment of the present application relates to a method of treatment or prevention of shock in a patient, the method comprising administering an anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold to said patient, wherein the method is additionally comprising the steps of
  • ADM anti-adrenomedullin
  • either the level of DPP3 protein and/or the level of active DPP3 is determined and compared to a threshold level.
  • a threshold of DPP3 in a sample of bodily fluid of said patient is between 20 and 120 ng/rnL, more preferred between 40 and 90 ng/mL, more preferred between 30 and 80 ng/mL, even more preferred between 40 and 60 ng/mL, most preferred said threshold is 50 ng/mL.
  • a threshold for the level of DPP3 is the 5fold median concentration, preferably the 4fold median concentration, more preferred the 3fold median concentration, most preferred the 2fold median concentration of a normal healthy population.
  • the level of DPP3 as the amount of DPP3 protein and/ or DPP3 activity in a sample of bodily fluid of said subject may be determined by different methods, e.g., immunoassays, activity assays, mass spectrometric methods etc.
  • any types of binding assays immunoassays and analogous assays, which use other types of antigen-specific binders instead of antibodies
  • DPP3 enzyme activity assays which are specific for DPP3 by specifically capturing DPP3 from a sample using a specific binder (anti-DPP3 antibody or other type of binder) prior to determination of enzyme activity) can be used.
  • DPP3 activity can be measured by detection of cleavage products of DPP3 specific substrates.
  • Known peptide hormone substrates include Leu-enkephalin, Met-enkephalin, endomorphin 1 and 2, valorphin, 0-casomorphin, dynorphin, proctolin, ACTH (Adrenocorticotropic hormone) and MSH (melanocytestimulating hormone; Abramic et al. 2000, Barsun et al. 2007, Dhanda et al. 2008).
  • the cleavage of mentioned peptide hormones as well as other untagged oligopeptides e.g., Ala-Ala-Ala-Ala, Dhanda et al.
  • Detection methods include, but are not limited to, HPLC analysis (e.g., Lee & Snyder 1982), mass spectrometry (e.g., Abramic et al. 2000), Hl-NMR analysis (e.g., Vandenberg et al. 1985), capillary zone electrophoresis (CE; e.g. Barsun et al. 2007), thin layer chromatography (e.g. Dhanda et al. 2008) or reversed phase chromatography (e.g. Mazocco et al. 2006).
  • HPLC analysis e.g., Lee & Snyder 1982
  • mass spectrometry e.g., Abramic et al. 2000
  • Hl-NMR analysis e.g., Vandenberg et al. 1985
  • CE capillary zone electrophoresis
  • thin layer chromatography e.g. Dhanda et al. 2008
  • reversed phase chromatography e.g. Mazocco et al. 2006
  • Detection of fluorescence due to hydrolysis of Anorogenic substrates by DPP3 is a standard procedure to monitor DPP3 activity.
  • Those substrates are specific di- or tripeptides (Arg- Arg, Ala- Ala, Ala-Arg, Ala-Phe, Asp-Arg, Gly-Ala, Gly-Arg, Gly-Phe, Leu-Ala, Leu-Gly, Lys-Ala, Phe-Arg, Suc-Ala-Ala- Phe) coupled to a fhiorophore.
  • Fluorophores include but are not limited to 0-naphtylamide (2- naphtylamide, 0NA, 2NA), 4-methoxy-0-naphtylamide
  • DPP3 carrying samples can be immobilized and divided on a gel by electrophoresis, gels stained with fluorogenic substrate (e.g., Arg-Arg-PNA) and Fast Garnet GBC and fluorescent protein bands detected by a fluorescence reader (Ohkubo et al. 1999).
  • fluorogenic substrate e.g., Arg-Arg-PNA
  • Leu-Gly, Lys-Ala, Phe-Arg, Suc-Ala-Ala-Phe can be coupled to chromophores, such as p-nitroanilide diacetate. Detection of color change due to hydrolysis of chromogenic substrates can be used to monitor DPP3 activity.
  • DPP3 activity is a Protease-GioTM Assay (commercially available at Promega).
  • DPP3 specific di- or tripeptides (Arg- Arg, Ala- Ala, Ala- Arg, Ala-Phe, Asp-Arg, Gly-Ala, Gly-Arg, Gly-Phe, Leu-Ala, Leu-Gly, Lys-Ala, Phe-Arg, Sue-Ala- Ala-Phe) are coupled to aminoluciferin.
  • aminoluciferin Upon cleavage by DPP3, aminoluciferin is released and serves as a substrate for a coupled luciferase reaction that emits detectable luminescence.
  • DPP3 activity is measured by addition of the fluorogenic substrate Arg-Arg- PNA and monitoring fluorescence in real time.
  • said capture binder reactive with DPP3 is immobilized on a solid phase.
  • solid phase may be used to include any material or vessel in which or on which the assay may be performed and includes, but is not limited to: porous materials, nonporous materials, test tubes, wells, slides, agarose resins
  • the level of DPP3 is determined by contacting said sample of bodily fluid with a capture binder that binds specifically to DPP3.
  • said capture binder for determining the level of DPP3 may be selected from the group of antibodies, antibody fragment or non-IgG scaffold.
  • said capture binder is an antibody.
  • the amount of DPP3 protein and/ or DPP3 activity in a sample of bodily fluid of said subject may be determined for example by one of the following methods: 1. Luminescence immunoassay for the quantification of DPP3 protein concentrations (LIA) (Rehfeld et al., 2019 JALM 3(6): 943-953).
  • LIA Luminescence immunoassay for the quantification of DPP3 protein concentrations
  • the LIA is a one-step chemiluminescence sandwich immunoassay that uses white high-binding polystyrene microtiter plates as solid phase. These plates are coated with monoclonal anti-DPP3 antibody AK2555 (capture antibody).
  • the tracer anti-DPP3 antibody AK2553 is labeled with MA70- acridinium-NHS-ester and used at a concentration of 20 ng per well. Twenty microliters of samples (e.g., serum, heparin-plasma, citrate-plasma or EDTA-plasma derived from patients’ blood), and calibrators are pipetted into coated white microtiter plates.
  • the microtiter plates are incubated for 3 h at room temperature and 600 rpm. Unbound tracer is then removed by 4 washing steps (350 pL per well). Remaining chemiluminescence is measured for Is per well by using a microtiter plate luminometer. The concentration of DPP3 is determined with a 6-point calibration curve. Calibrators and samples are preferably run in duplicate.
  • Enzyme capture activity assay for the quantification of DPP3 activity (ECA) (Rehfeld et al., 2019 JALM 3(6): 943-953).
  • the ECA is a DPP3-specific activity assay that uses black high-binding polystyrene microtiter plates as solid phase. These plates are coated with monoclonal anti-DPP3 antibody AK2555 (capture antibody). Twenty microliters of samples (e.g., serum, heparin-plasma, citrate-plasma, EDTA-plasma, cerebrospinal fluid and urine) and calibrators are pipetted into coated black microtiter plates. After adding assay buffer (200 pL), the microtiter plates are incubated for 2 h at 22°C and 600 rpm. DPP3 present in the samples is immobilized by binding to the capture antibody. Unbound sample components are removed by 4 washing steps (350 pL per well).
  • samples e.g., serum, heparin-plasma, citrate-plasma, EDTA-plasma, cerebrospinal fluid and urine
  • calibrators are pipetted into coated black microtiter plates. After adding assay buffer (
  • the specific activity of immobilized DPP3 is measured by the addition of the fluorogenic substrate, Arg-Arg- - Naphthylamide (Arg2-PNA), in reaction buffer followed by incubation at 37 °C for 1 h. DPP3 specifically cleaves Arg2- NA into Arg-Arg dipeptide and fluorescent P-naphthylamine. Fluorescence is measured with a fluorometer using an excitation wavelength of 340 run and emission is detected at 410 nm. The activity of DPP3 is determined with a 6-point calibration curve. Calibrators and samples are preferably run in duplicates.
  • samples e.g., serum, heparin-plasma, citrate-plasma
  • calibrators are pipetted into non-bind
  • an assay is used for determining the level of DPP3, wherein the assay sensitivity of said assay is able to quantify the DPP3 of healthy subjects and is ⁇ 20 ng/ml, preferably ⁇ 30 ng/ml and more preferably ⁇ 40 ng/ml.
  • the IB 10 sphingotest® DPP3 is a rapid point-of-care (POC) immunoassay for the in vitro quantitative determination of Dipeptidyl Peptidase 3 (DPP3) in human EDTA whole blood and plasma.
  • POC point-of-care
  • the Nexus IB 10 immunochemistry system combines chemistry with microfluidics and centrifugal flow to rapidly prepare a cell free plasma from whole blood that can then be moved through a channel to rehydrate, solubilize, and mix with freeze dried immunoconjugates
  • said binder exhibits a binding affinity to DPP3 of at least 10 7 M 1 , preferred 10 8 M' 1 , more preferred affinity is greater than 10 9 M' 1 , most preferred greater than IO 10 M' 1 .
  • a person skilled in the art knows that it may be considered to compensate lower affinity by applying a higher dose of compounds and this measure would not lead out-of-the-scope of the invention.
  • said sample of bodily fluid is selected from the group of whole blood, plasma, and serum.
  • ADM Mature ADM, bio-ADM and ADM-NH2 is used synonymously throughout this application and is a molecule according to SEQ ID No.: 13.
  • a bodily fluid according to the present invention is in one particular embodiment a blood sample.
  • a blood sample may be selected from the group comprising whole blood, serum and plasma.
  • said sample is selected from the group comprising human citrate plasma, heparin plasma and EDTA plasma.
  • an assay is used for determining the level ADM-NH2, wherein the assay sensitivity of said assay is able to quantify the mature ADM-NH2 of healthy subjects and is ⁇ 70 pg/ml, preferably ⁇ 40 pg/ml and more preferably ⁇ 10 pg/ml.
  • the threshold for ADM-NH2 is between 40 and 100 pg/mL, more preferred between 50 and 90 pg/rnL, even more preferred between 60 and 80, most preferred a threshold of 70 pg/ml is applied.
  • a threshold for plasma ADM-NH2 is the 5fold median concentration, preferably the 4fold median concentration, more preferred the 3fold median concentration, most preferred the 2fold median concentration of a normal healthy population.
  • said binder exhibits a binding affinity to ADM-NH2 of at least 10 7 M 1 , preferred 10 8 M 1 , preferred affinity is greater than 10 9 M 1 , most preferred greater than 10 10 M 1 .
  • a person skilled in the art knows that it may be considered to compensate lower affinity by applying a higher dose of compounds and this measure would not lead out-of-the-scope of the invention.
  • the kinetics of binding of Adrenomedullin to immobilized antibody was determined by means of label-free surface plasmon resonance using a Biacore 2000 system (GE Healthcare Europe GmbH, Freiburg, Germany). Reversible immobilization of the antibodies was performed using an anti-mouse Fc antibody covalently coupled in high density to a CM5 sensor surface according to the manufacturer's instructions (mouse antibody capture kit; GE Healthcare), (.Lorenz et al. 2011. Antimicrob Agents Chemother. 55 (1): 165-173 ⁇ .
  • binding affinity refers to the affinity of the proteins described in the present invention to their binding targets and is expressed numerically using “Kd” values.
  • Kd is intended to refer to the dissociation constant of an antibody-antigen interaction. If two or more proteins are indicated to have comparable binding affinities towards their binding targets, then the Kd values for binding of the respective proteins towards their binding targets, are within ⁇ 2-fold of each other. If two or more proteins are indicated to have comparable binding affinities towards single binding target, then the Kd values for binding of the respective proteins towards said single binding target, are within ⁇ 2-fold of each other.
  • the Kd values for binding of said protein to the two or more targets are within ⁇ 2-fold of each other. In general, a higher Kd value corresponds to a weaker binding.
  • the “Kd” is measured by a radiolabeled antigen binding assay (MA) or surface plasmon resonance assays using a BIAcoreTM-2000 or a BIAcoreTM-3000 (BIAcore, Inc., Piscataway, N.J.).
  • said binder is selected from the group comprising an antibody or an antibody fragment or a non-Ig scaffold binding to ADM-NH2.
  • an assay is used for determining the level of ADM-NH2, wherein such assay is a sandwich assay, preferably a fully automated assay.
  • such assay for determining the level of the biomarkers is a sandwich immunoassay using any kind of detection technology including but not restricted to enzyme label, chemiluminescence label, electrochemiluminescence label, preferably a fully automated assay.
  • such an assay is an enzyme labeled sandwich assay.
  • Examples of automated or fully automated assay comprise assays that may be used for one of the following systems: Roche Elecsys®, Abbott Architect®, Siemens Centauer®, Brahms Kryptor®, BiomerieuxVidas®, Alere Triage®.
  • immunoassays are known and may be used for the assays and methods of the present invention, these include: radioimmunoassays ("RIA”), homogeneous enzyme-multiplied immunoassays (“EMIT”), enzyme linked immunoadsorbent assays (“ELISA”), apoenzyme reactivation immunoassay (“ARIS”), dipstick immunoassays and immuno-chromatography assays.
  • RIA radioimmunoassays
  • EMIT homogeneous enzyme-multiplied immunoassays
  • ELISA enzyme linked immunoadsorbent assays
  • ARIS apoenzyme reactivation immunoassay
  • dipstick immunoassays dipstick immunoassays and immuno-chromatography assays.
  • such an assay is a sandwich immunoassay using any kind of detection technology including but not restricted to enzyme label, chemiluminescence label, electrochemiluminescence label, preferably a fully automated assay.
  • such an assay is an enzyme labeled sandwich assay. Examples of automated or fully automated assay comprise assays that may be used for one of the following systems: Roche Elecsys®, Abbott Architect®, Siemens Centauer®, Brahms Kryptor®, Biomerieux Vidas®, Alere Triage®.
  • it may be a so-called POC-test (point-of-care) that is a test technology, which allows performing the test within less than 1 hour near the patient without the requirement of a fully automated assay system.
  • POC-test point-of-care
  • One example for this technology is the immunochromatographic test technology.
  • said label is selected from the group comprising chemiluminescent label, enzyme label, fluorescence label, radioiodine label.
  • the assays can be homogenous or heterogeneous assays, competitive and non-competitive assays.
  • the assay is in the form of a sandwich assay, which is a non-competitive immunoassay, wherein the molecule to be detected and/or quantified is bound to a first antibody and to a second antibody.
  • the first antibody may be bound to a solid phase, e.g., a bead, a surface of a well or other container, a chip or a strip
  • the second antibody is an antibody which is labeled, e.g., with a dye, with a radioisotope, or a reactive or catalytically active moiety.
  • the amount of labeled antibody bound to the analyte is then measured by an appropriate method.
  • the general composition and procedures involved with “sandwich assays” are well-established and known to the skilled person (The Immunoassay Handbook, Ed. David Wild, Elsevier LTD, Oxford; 3rd ed. (May 2005), ISBN-13: 978-0080445267; Hultschig C et aL, Curr Opin Chem Biol. 2006 Feb;10(l):4-10. PMID: 16376134).
  • the assay comprises two capture molecules, preferably antibodies which are both present as dispersions in a liquid reaction mixture, wherein a first labelling component is attached to the first capture molecule, wherein said first labelling component is part of a labelling system based on fluorescence- or chemiluminescence-quenching or amplification, and a second labelling component of said marking system is attached to the second capture molecule, so that upon binding of both capture molecules to the analyte a measurable signal is generated that allows for the detection of the formed sandwich complexes in the solution comprising the sample.
  • said labeling system comprises rare earth cryptates or rare earth chelates in combination with fluorescence dye or chemiluminescence dye, in particular a dye of the cyanine type.
  • fluorescence based assays comprise the use of dyes, which may for instance be selected from the group comprising FAM (5 -or
  • 6-carboxyfluorescein 6-carboxyfluorescein
  • VIC Trigger Chemical C
  • NED Fluorescein
  • Fluoresceinisothiocyanate FITC
  • IRD-700/800 Cyanine dyes, such as CY3, CY5, CY3.5, CY5.5, Cy7, Xanthen, 6-Carboxy-2’,4’,7’,4,7- hexachlorofluorescein (HEX), TET, 6-Carboxy-4’,5’-dichloro-2’,7’-dimethodyfluorescein (JOE), N,N,N’,N’-Tetramethyl-6-carboxyrhodamine (TAMRA),
  • 6-Carboxy-X-rhodamine ROX
  • 5-Carboxyrhodamine-6G R6G5
  • 6-carboxyrhodamine-6G RG6
  • Rhodamine Rhodamine Green
  • Rhodamine Red Rhodamine 110
  • BODIPY dyes such as BODIPY TMR, Oregon Green
  • Coumarines such as Umbelliferone
  • Benzimides such as Hoechst 33258
  • Phenanthridines such as Texas Red, Yakima Yellow, Alexa Fluor, PET, Ethidiumbromide, Acridinium dyes, Carbazol dyes, Phenoxazine dyes, Porphyrine dyes, Polymethin dyes, and the like.
  • chemiluminescence based assays comprise the use of dyes, based on the physical principles described for chemiluminescent materials in (Kirk-Othmer, Encyclopedia of chemical technology, 4th ed., executive editor, J. I. Kroschwitz; editor, M. Howe-Grant, John Wiley & Sons, 1993, vol,15, p. 518-562, incorporated herein by reference, including citations on pages 551-562).
  • Preferred chemiluminescent dyes are acridiniumesters.
  • an “assay” or “diagnostic assay” can be of any type applied in the field of diagnostics. Such an assay may be based on the binding of an analyte to be detected to one or more capture probes with a certain affinity. Concerning the interaction between capture molecules and target molecules or molecules of interest, the affinity constant is preferably greater than 10 8 M 1 .
  • At least one of said two binders is labeled in order to be detected.
  • the ADM-NH2 levels of the present invention have been determined with the described ADM-NH2 assay (Weber et al. 2017. JALM 2(2):l-4).
  • the DPP3 levels of the present invention have been determined with the described DPP3 -assays as outlined in the examples (Rehfeld et al. 2019. JALM 3(6): 943-953).
  • the mentioned threshold values above might be different in other assays, if these have been calibrated differently from the assay systems used in the present invention. Therefore, the mentioned cut-off values above shall apply for such differently calibrated assays, accordingly, taking into account the differences in calibration.
  • One possibility of quantifying the difference in calibration is a method comparison analysis (correlation) of the assay in question with the respective biomarker assay used in the present invention by measuring the respective biomarker (e.g., bio-ADM, DPP3) in samples using both methods.
  • Another possibility is to determine with the assay in question, given this test has sufficient analytical sensitivity, the median biomarker level of a representative normal population, compare results with the median biomarker levels as described in the literature and recalculate the calibration based on the difference obtained by this comparison.
  • the level of ADM -NH2 is therefore measured in order to identify patients having an increased risk of running into shock.
  • prevention or any grammatical variation thereof (e.g., prevent, preventing, and prevention etc.), as used herein, includes but is not limited to, delaying the onset of symptoms, preventing relapse to a disease, increasing latency between symptomatic episodes, or a combination thereof. Prevention, as used herein, does not require the complete absence of symptoms.
  • Adrecizumab an N-terminal anti- ADM antibody
  • Adrecizumab a humanized version of an N-terminal anti- ADM antibody
  • beneficial effects of Adrecizumab on vascular barrier function and survival were recently demonstrated in preclinical models of systemic inflammation and sepsis (Geven et al. 2018. Shock 50(61:648-654).
  • pre-treatment with Adrecizumab attenuated renal vascular leakage in endotoxemic rats as well as in mice with CLP-induced sepsis, which coincided with increased renal expression of the protective peptide Ang-1 and reduced expression of the detrimental peptide vascular endothelial growth factor.
  • Adrecizumab pre-treatment with Adrecizumab improved 7-day survival in CLP-induced sepsis in mice from 10 to 50% for single and from 0 to 40% for repeated dose administration. Moreover, in a phase I study, excellent safety and tolerability was demonstrated (see Example 6): no serious adverse events were observed, no signal of adverse events occurring more frequently in Adrecizumab-treated subjects was detected and no relevant changes in other safety parameters were found (Geven et al. 2017. Intensive Care Med Exp 5 (Suppl 2): 0427). Of particular interest is the proposed mechanism of action of Adrecizumab. Both animal and human data reveal a potent, dose-dependent increase of circulating ADM following administration of this antibody. Based on pharmacokinetic data and the lack of an increase in MR-proADM (an inactive peptide fragment derived from the same prohormone as ADM), the higher circulating ADM levels cannot be explained by an increased production.
  • MR-proADM an inactive peptide fragment derived from the same prohormone
  • a mechanistic explanation for this increase could be that the excess of antibody in the circulation may drain ADM from the interstitium to the circulation, since ADM is small enough to cross the endothelial barrier, whereas the antibody is not (Geven et al. 2018. Shock. 50(2):132-140 and Voors et al (J. Eur J Heart Fail. 2019 Feb;21(2): 163-171)). In addition, binding of the antibody to ADM leads to a prolongation of ADM’s half-life.
  • NT-ADM antibodies partially inhibit ADM-mediated signalling, a significant increase of circulating ADM results in an overall “net” increase of ADM activity in the blood compartment, where it exerts beneficial effects on ECs (predominantly barrier stabilization), whereas ADMs detrimental effects on VSMCs (vasodilation) in the interstitium are reduced.
  • Adrecizumab specifically. There is no reason to doubt that what is true for Adrecizumab will also be true for antibodies sharing main essential features (in particular affinity and epitope specificity) Antibodies that target the same region must be expected to have the same technical effect, provided they have the same affinity and same or very comparable structural features (size, shape, etc).
  • antibody generally comprises monoclonal and polyclonal antibodies and binding fragments thereof, in particular Fc-fragments as well as so called “single-chain-antibodies” (Bird et al. 1988), chimeric, humanized, in particular CDR-grafted antibodies, and dia or tetrabodies (Holliger et al. 1993). Also comprised are immunoglobulin-like proteins that are selected through techniques including, for example, phage display to specifically bind to the molecule of interest contained in a sample. In this context the term “specific binding” refers to antibodies raised against the molecule of interest or a fragment thereof.
  • An antibody is considered to be specific, if its affinity towards the molecule of interest or the aforementioned fragment thereof is at least preferably 50-fold higher, more preferably 100-fold higher, most preferably at least 1000-fold higher than towards other molecules comprised in a sample containing the molecule of interest. It is well known in the art how to make antibodies and to select antibodies with a given specificity.
  • the anti-Adrenomedullin (ADM) antibody or anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold is monospecific.
  • Monospecific anti-adrenomedullin (ADM) antibody or monospecific anti-adrenomedullin antibody fragment or monospecific anti-ADM non-Ig scaffold means that said antibody or antibody fragment or non-Ig scaffold binds to one specific region encompassing at least 5 amino acids within the target ADM.
  • Monospecific anti-Adrenomedullin (ADM) antibody or monospecific anti-adrenomedullin antibody fragment or monospecific anti-ADM non-Ig scaffold are anti-adrenomedullin (ADM) antibodies or anti-adrenomedullin antibody fragments or anti-ADM non- Ig scaffolds that all have affinity for the same antigen.
  • Monoclonal antibodies are monospecific, but monospecific antibodies may also be produced by other means than producing them from a common germ cell.
  • Said anti-ADM antibody or antibody fragment binding to ADM or non-Ig scaffold binding to ADM may be a non-neutralizing anti-ADM antibody or antibody fragment binding to ADM or non-Ig scaffold binding to ADM.
  • said anti-ADM antibody, anti-ADM antibody fragment or anti-ADM non-Ig scaffold is a non-neutralizing antibody, fragment or non-Ig scaffold.
  • a neutralizing anti-ADM antibody, anti-ADM antibody fragment or anti-ADM non-Ig scaffold would block the bioactivity of ADM to nearly 100%, to at least more than 90%, preferably to at least more than 95%.
  • a non-neutralizing anti-ADM antibody, or anti-ADM antibody fragment or anti-ADM non- Ig scaffold blocks the bioactivity of ADM less than 100%, preferably to less than 95%, preferably to less than 90%, more preferred to less than 80 % and even more preferred to less than 50 %.
  • bioactivity of ADM is reduced to less than 100%, to 95 % or less but not more, to 90 % or less but not more , to 80 % or less but not more , to 50 % or less but not more
  • residual bioactivity of ADM bound to the non-neutralizing anti-ADM antibody, or anti-ADM antibody fragment or anti-ADM non-Ig scaffold would be more than 0%, preferably more than 5 %, preferably more than 10 % , more preferred more than 20 %, more preferred more than 50 %.
  • molecule(s) being it an antibody, or an antibody fragment or a non-Ig scaffold with “non-neutralizing anti-ADM activity”, collectively termed here for simplicity as “non-neutralizing” anti-ADM antibody, antibody fragment, or non-Ig scaffold, that e.g., blocks the bioactivity of ADM to less than 80 %, is defined as a molecule or molecules binding to ADM, which upon addition to a culture of an eukaryotic cell line, which expresses functional human recombinant ADM receptor composed of CRLR (calcitonin receptor like receptor) and RAMP3 (receptor-activity modifying protein 3), reduces the amount of cAMP produced by the cell line through the action of parallel added human synthetic ADM peptide, wherein said added human synthetic ADM is added in an amount that in the absence of the non-neutralizing antibody to be analyzed, leads to half-maximal stimulation of cAMP synthesis, wherein the reduction of cAMP by said molecule(s)
  • An antibody or fragment according to the present invention is a protein including one or more polypeptides substantially encoded by immunoglobulin genes that specifically binds an antigen.
  • the recognized immunoglobulin genes include the kappa, lambda, alpha (IgA), gamma (IgGi, IgG2, IgGs, IgG 4 ), delta (IgD), epsilon (IgE) and mu (IgM) constant region genes, as well as the myriad immunoglobulin variable region genes.
  • Full-length immunoglobulin light chains are generally about 25 Kd or 214 amino acids in length.
  • Full-length immunoglobulin heavy chains are generally about 50 Kd or 446 amino acids in length.
  • Light chains are encoded by a variable region gene at the NH -terminus (about 110 amino acids in length) and a kappa or lambda constant region gene at the COOH-terminus.
  • Heavy chains are similarly encoded by a variable region gene (about 116 amino acids in length) and one of the other constant region genes.
  • the basic structural unit of an antibody is generally a tetramer that consists of two identical pairs of immunoglobulin chains, each pair having one light and one heavy chain. In each pair, the light and heavy chain variable regions bind to an antigen, and the constant regions mediate effector functions.
  • Immunoglobulins also exist in a variety of other forms including, for example, Fv, Fab, and (Fab')2, as well as bifunctional hybrid antibodies and single chains (e.g..Lanzavecchia et al. 1987. Eur. J. Immunol. 17:105; Huston et al. 1988. Proc. Natl. Acad. Sci. U.S.A., 85:5879-5883; Bird et al. 1988.
  • An immunoglobulin light or heavy chain variable region includes a framework region interrupted by three hypervariable regions, also called complementarity determining regions (CDR's) (see, Sequences of Proteins of Immunological Interest, E. Kabat et al. 1983, U.S. Department of Health and Human Services' ⁇ . As noted above, the CDRs are primarily responsible for binding to an epitope of an antigen.
  • CDR's complementarity determining regions
  • An immune complex is an antibody, such as a monoclonal antibody, chimeric antibody, humanized antibody or human antibody, or functional antibody fragment, specifically bound to the antigen.
  • Chimeric antibodies are antibodies whose light and heavy chain genes have been constructed, typically by genetic engineering, from immunoglobulin variable and constant region genes belonging to different species.
  • the variable segments of the genes from a mouse monoclonal antibody can be joined to human constant segments, such as kappa and gamma 1 or gamma 3.
  • a therapeutic chimeric antibody is thus a hybrid protein composed of the variable or antigen-binding domain from a mouse antibody and the constant or effector domain from a human antibody, although other mammalian species can be used, or the variable region can be produced by molecular techniques.
  • a "humanized” immunoglobulin is an immunoglobulin including a human framework region and one or more CDRs from a non-human (such as a mouse, rat, or synthetic) immunoglobulin.
  • the non-human immunoglobulin providing the CDRs is termed a "donor” and the human immunoglobulin providing the framework is termed an "acceptor.”
  • all the CDRs are from the donor immunoglobulin in a humanized immunoglobulin.
  • Constant regions need not be present, but if they are, they must be substantially identical to human immunoglobulin constant regions, i.e., at least about 85- 90%, such as about 95% or more identical.
  • all parts of a humanized immunoglobulin, except possibly the CDRs are substantially identical to corresponding parts of natural human immunoglobulin sequences.
  • a "humanized antibody” is an antibody comprising a humanized light chain and a humanized heavy chain immunoglobulin.
  • a humanized antibody binds to the same antigen as the donor antibody that provides the CDR’s.
  • the acceptor framework of a humanized immunoglobulin or antibody may have a limited number of substitutions by amino acids taken from the donor framework.
  • Humanized or other monoclonal antibodies can have additional conservative amino acid substitutions, which have substantially no effect on antigen binding or other immunoglobulin functions.
  • exemplary conservative substitutions are those such as gly, ala; val, ile, leu; asp, glu; asn, gin; ser, thr; lys, arg; and phe, tyr.
  • Humanized immunoglobulins can be constructed by means of genetic engineering (e.g. , see U.S. Patent No. 5,585,089).
  • a human antibody is an antibody wherein the light and heavy chain genes are of human origin. Human antibodies can be generated using methods known in the art. Human antibodies can be produced by immortalizing a human B cell secreting the antibody of interest.
  • Immortalization can be accomplished, for example, by EBV infection or by fusing a human B cell with a myeloma or hybridoma cell to produce a trioma cell.
  • Human antibodies can also be produced by phage display methods (see, e.g., WO91/17271; WQ92/001047; WO92/2Q791) or selected from a human combinatorial monoclonal antibody library (see the Morphosys website). Human antibodies can also be prepared by using transgenic animals carrying a human immunoglobulin gene (for example, see WO93/12227; WO 91/10741').
  • the anti-ADM antibody may have the formats known in the art.
  • Examples are human antibodies, monoclonal antibodies, humanized antibodies, chimeric antibodies, CDR-grafted antibodies.
  • antibodies according to the present invention are recombinantly produced antibodies as e.g. IgG, a typical full-length immunoglobulin, or antibody fragments containing at least the F-variable domain of heavy and/or light chain as e.g. chemically coupled antibodies (fragment antigen binding) including but not limited to Fab-fragments including Fab minibodies, single chain Fab antibody, monovalent
  • Fab antibody with epitope tags e.g. Fab-V5Sx2; bivalent Fab (mini-antibody) dimerized with the CH3 domain; bivalent Fab or multivalent Fab, e.g. formed via multimerization with the aid of a heterologous domain, e.g. via dimerization of dHLX domains, e.g. Fab-dHLX-FSx2; F(ab‘)2-fragments, scFv- fragments, multimerized multivalent or/and multi-specific scFv-fragments, bivalent and/or bispecific diabodies, BITE® (bispecific T-cell engager), trifunctional antibodies, polyvalent antibodies, e.g. from a different class than G; single-domain antibodies, e.g. nanobodies derived from camelid or fish immunoglobulins and numerous others.
  • biopolymer scaffolds are well known in the art to complex a target molecule and have been used for the generation of highly target specific biopolymers. Examples are aptamers, spiegelmers, anticalins and conotoxins. For illustration of antibody formats please see Fig. la, lb and lc.
  • the anti-ADM antibody format is selected from the group comprising Fv fragment, scFv fragment, Fab fragment, scFab fragment, F(ab)z fragment and scFv-Fc Fusion protein.
  • the antibody format is selected from the group comprising scFab fragment, Fab fragment, scFv fragment and bioavailability optimized conjugates thereof, such as PEGylated fragments.
  • One of the most preferred formats is the scFab format.
  • Non-Ig scaffolds may be protein scaffolds and may be used as antibody mimics as they are capable to bind to ligands or antigens.
  • Non-Ig scaffolds may be selected from the group comprising tetranectinbased non-Ig scaffolds (e.g. described in US 2010/0028995), fibronectin scaffolds (e.g. described in EP 1 266 025; lipocalin-based scaffolds (e.g. described in WO 2011/154420); ubiquitin scaffolds (e.g. described in WO 2011/073214), transferrin scaffolds (e.g. described in US 2004/0023334), protein A scaffolds (e.g. described in
  • EP 2 231 860 ankyrin repeat based scaffolds (e.g. described in WO 2010/060748), microproteins preferably microproteins forming a cysteine knot) scaffolds (e.g. described in EP 2314308), Fyn SH3 domain based scaffolds (e.g. described in WO 2011/023685)
  • anti-ADM antibodies according to the present invention may be produced as outlined in Example 1 by synthesizing fragments of ADM as antigens. Thereafter, binder to said fragments are identified using the below described methods or other methods as known in the art.
  • Humanization of murine antibodies may be conducted according to the following procedure:
  • the antibody sequence is analyzed for the structural interaction of framework regions (FR) with the complementary determining regions (CDR) and the antigen. Based on structural modelling an appropriate FR of human origin is selected and the murine CDR sequences are transplanted into the human FR. Variations in the amino acid sequence of the CDRs or FRs may be introduced to regain structural interactions, which were abolished by the species switch for the FR sequences. This recovery of structural interactions may be achieved by random approach using phage display libraries or via directed approach guided by molecular modelling (Almagro and Fransson 2008. Humanization of antibodies. Front Biosci. 2008 Jan 1:13:1619-33).
  • the ADM antibody format is selected from the group comprising Fv fragment, scFv fragment, Fab fragment, scFab fragment, F(ab)2 fragment and scFv-Fc Fusion protein.
  • the antibody format is selected from the group comprising scFab fragment, Fab fragment, scFv fragment and bioavailability optimized conjugates thereof, such as PEGylated fragments.
  • One of the most preferred formats is scFab format.
  • the anti-ADM antibody, anti-ADM antibody fragment, or anti-ADM non-Ig scaffold is a full-length antibody, antibody fragment, or non-Ig scaffold.
  • the anti-ADM antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold is directed to and can bind to an epitope of at least 5 amino acids in length contained in ADM.
  • the anti-ADM antibody or an anti-ADM antibody fragment or anti- ADM non-Ig scaffold is directed to and can bind to an epitope of at least 4 amino acids in length contained in ADM.
  • the anti-ADM antibody or anti-ADM antibody fragment binding to adrenomedullin or anti-ADM non-Ig scaffold binding to adrenomedullin is provided for use in therapy or prevention of shock in a patient, wherein said antibody or fragment or scaffold is not ADM- binding-Protein-1 (complement factor H).
  • the anti-Adrenomedullin (ADM) antibody or anti-ADM antibody fragment binding to adrenomedullin or anti-ADM non-Ig scaffold binding to adrenomedullin is provided for use in therapy or prevention of shock in a patient, wherein said antibody or fragment or scaffold binds to a region of preferably at least 4, or at least 5 amino acids within the sequence of amino acid 1-21 of mature human ADM: YRQSMNNFQGLRSFGCRFGTC SEQ ID No.: 1
  • said anti-ADM antibody or anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold binds to a region or epitope of ADM that is located in the N-terminal part (amino acid 1-21) of adrenomedullin.
  • said anti-ADM-antibody or anti-ADM antibody fragment or anti- ADM non-Ig scaffold recognizes and binds to a region or epitope within amino acids 1-14 of adrenomedullin: YRQSMNNFQGLRSF (SEQ ID No.: 15) that means to the N-terminal part (amino acid 1-14) of adrenomedullin.
  • said anti-ADM-antibody or anti-adrenomedullin antibody fragment or anti-ADM non-Ig scaffold recognizes and binds to a region or epitope within amino acids 1-10 of adrenomedullin: YRQSMNNFQG (SEQ ID No.: 16); that means to the N-terminal part (amino acid 1- 10) of adrenomedullin.
  • said anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold recognizes and binds to a region or epitope within amino acids 1-6 of adrenomedullin: YRQSMN (SEQ ID No.: 17); that means to the N-terminal part (amino acid 1-6) of adrenomedullin.
  • said region or epitope comprises preferably at least 4 or at least 5 amino acids in length.
  • said anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold recognizes and binds to the N-terminal end (amino acid 1) of adrenomedullin.
  • N- terminal end means that the amino acid 1, that is “Y” of SEQ ID No. 13, or 18 (SEQ ID No.: 18 (1-42 of human ADM): YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVA), respectively and is mandatory for binding.
  • the antibody or fragment or scaffold would neither bind N-terminal extended nor N-terminal modified Adrenomedullin nor N-terminal degraded adrenomedullin.
  • said anti-ADM-antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold binds only to a region within the sequence of mature ADM if the N-terminal end of ADM is free.
  • the anti-ADM antibody or anti-ADM antibody fragment or non-Ig scaffold would not bind to a region within the sequence of mature ADM if said sequence is e.g., comprised within pro-ADM.
  • the numbers in brackets for specific regions of ADM like “N-terminal part (amino acid 1-21)” is understood by a person skilled in the art that the N-terminal part of ADM consists of amino acids 1-21 of the mature ADM sequence.
  • anti-ADM antibody or anti- ADM antibody fragment or anti-ADM non-Ig scaffold does not bind to the C-terminal portion of ADM, i.e., the amino acid 43 - 52 of ADM: PRSKISPQGY-NH 2 (SEQ ID No.: 19).
  • An epitope also known as antigenic determinant, is the part of an antigen that is recognized by the immune system, specifically by antibodies.
  • the epitope is the specific piece of the antigen to which an antibody binds.
  • the part of an antibody that binds to the epitope is called a paratope.
  • the epitopes of protein antigens are divided into two categories, conformational epitopes, and linear epitopes, based on their structure and interaction with the paratope.
  • Conformational and linear epitopes interact with the paratope based on the 3-D conformation adopted by the epitope, which is determined by the surface features of the involved epitope residues and the shape or tertiary structure of other segments of the antigen.
  • a conformational epitope is formed by the 3-D conformation adopted by the interaction of discontinuous amino acid residues.
  • a linear or a sequential epitope is an epitope that is recognized by antibodies by its linear sequence of amino acids, or primary structure and is formed by the 3-D conformation adopted by the interaction of contiguous amino acid residues.
  • an anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold according to the present invention, wherein said anti-ADM antibody or said anti-ADM antibody fragment or anti-ADM non-Ig scaffold leads to an increase of the ADM level or ADM immunoreactivity in serum, blood, plasma of at least 10 %, preferably at least 50 %, more preferably >50 %, most preferably >100%.
  • an anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold according to the present invention, wherein said anti-ADM antibody or said anti-ADM antibody fragment or anti-ADM non-Ig scaffold is an ADM stabilizing antibody or an ADM stabilizing antibody fragment or an ADM stabilizing non-Ig scaffold that enhances the half-life (ti/2; half retention time) of adrenomedullin in serum, blood, plasma at least 10 %, preferably at least 50 %, more preferably >50 %, most preferably >100%.
  • the half-life (half retention time) of ADM may be determined in human serum, blood or plasma in absence and presence of an ADM stabilizing antibody or an ADM stabilizing antibody fragment or an ADM stabilizing non-Ig scaffold, respectively, using an immunoassay for the quantification of ADM.
  • the following steps may be conducted:
  • ADM may be diluted in human citrate plasma in absence and presence of an ADM stabilizing antibody or an adrenomedullin stabilizing antibody fragment or an adrenomedullin stabilizing non-Ig scaffold, respectively, and may be incubated at 24 °C.
  • Aliquots are taken at selected time points (e.g., within 24 hours) and degradation of ADM may be stopped in said aliquots by freezing at -20 °C.
  • the quantity of ADM may be determined by a hADM immunoassay directly if the selected assay is not influenced by the stabilizing antibody.
  • the aliquot may be treated with denaturing agents (like HC1) and, after clearing the sample (e.g., by centrifugation) the pH can be neutralized and the ADM-quantified by an ADM immunoassay.
  • denaturing agents like HC1
  • nonimmunoassay technologies e.g., RP-HPLC can be used for ADM-quantification.
  • ADM half-life of ADM is calculated for ADM incubated in absence and presence of an ADM stabilizing antibody or an adrenomedullin stabilizing antibody fragment or an adrenomedullin stabilizing non-Ig scaffold, respectively.
  • the enhancement of half-life is calculated for the stabilized ADM in comparison to ADM that has been incubated in absence of an ADM stabilizing antibody or an adrenomedullin stabilizing antibody fragment or an adrenomedullin stabilizing non-Ig scaffold.
  • a two-fold increase of the half-life of ADM is an enhancement of half-life of 100%.
  • Half-life is defined as the period over which the concentration of a specified chemical or drug takes to fall to half its baseline concentration in the specified fluid or blood.
  • Example 3 An assay that may be used for the determination of the half-life (half retention time) of adrenomedullin in serum, blood, plasma is described in Example 3.
  • said anti-ADM antibody, anti-ADM antibody fragment or anti-ADM non-Ig scaffold is a non-neutralizing antibody, fragment, or scaffold.
  • a neutralizing anti-ADM antibody, anti- ADM antibody fragment or anti-ADM non-Ig scaffold would block the bioactivity of ADM to nearly 100%, to at least more than 90%, preferably to at least more than 95%.
  • said non-neutralizing anti-ADM antibody, anti-ADM antibody fragment or anti-ADM non-Ig scaffold blocks the bioactivity of ADM to less than 100 %, preferably less than 95% preferably less than 90%.
  • non-neutralizing anti-ADM antibody, anti-ADM antibody fragment or anti-ADM non-Ig scaffold blocks the bioactivity of ADM to less than 95% an anti-ADM antibody, anti- ADM antibody fragment or anti-ADM non-Ig scaffold that would block the bioactivity of ADM to more than 95 % would be outside of the scope of said embodiment.
  • the bioactivity is reduced to 95 % or less but not more, preferably to 90 % or less, more preferably to 80 % or less, more preferably to 50 % or less but not more.
  • the non-neutralizing antibody is an antibody binding to a region of at least 5 amino acids within the sequence of amino acid 1-21 of mature human ADM (SEQ ID No.: 1).
  • the non-neutralizing antibody is an antibody binding to a region of at least 4 amino acids within the sequence of amino acid 1-21 of mature human ADM (SEQ ID No.: 1).
  • a non-neutralizing anti-ADM antibody or anti- ADM antibody fragment or ADM non-Ig scaffold is used, wherein said anti-ADM antibody or an anti-ADM antibody fragment blocks the bioactivity of ADM to less than 80 %, preferably less than 50% (of baseline values).
  • said limited blocking of the bioactivity (meaning reduction of the bioactivity) of ADM occurs even at excess concentration of the antibody, fragment or scaffold, meaning an excess of the antibody, fragment or scaffold in relation to ADM.
  • Said limited blocking is an intrinsic property of the ADM binder itself in said specific embodiment. This means that said antibody, fragment or scaffold has a maximal inhibition of 80% or 50% respectively.
  • said anti-ADM antibody, anti-ADM antibody fragment or anti-ADM non-Ig scaffold would block the bioactivity / reduce the bioactivity of anti-ADM to at least 5 %.
  • the stated above means that approximately 20% or 50% or even 95% residual ADM bioactivity remains present, respectively.
  • the provided anti-ADM antibodies, anti-ADM antibody fragments, and anti-ADM non-Ig scaffolds do not neutralize the respective ADM bioactivity.
  • bioactivity is defined as the effect that a substance takes on a living organism or tissue or organ or functional unit in vivo or in vitro (e.g., in an assay) after its interaction.
  • ADM bioactivity this may be the effect of ADM in a human recombinant ADM receptor cAMP functional assay.
  • bioactivity is defined via an ADM receptor cAMP functional assay. The following steps may be performed in order to determine the bioactivity of ADM in such an assay:
  • Dose response curves are performed with ADM in said human recombinant ADM receptor cAMP functional assay.
  • the ADM concentration of half-maximal cAMP stimulation may be calculated.
  • dose response curves are performed by an ADM stabilizing antibody or ADM stabilizing antibody fragment or ADM stabilizing non-Ig scaffold, respectively.
  • a maximal inhibition in said ADM bioassay of 50% means that said anti-ADM antibody or said anti- ADM antibody fragment or said anti-ADM non-Ig scaffold, respectively, blocks the bioactivity of ADM to 50% of baseline values.
  • a maximal inhibition in said ADM bioassay of 80% means that said anti- ADM antibody or said anti-adrenomedullin antibody fragment or said anti-adrenomedullin non-Ig scaffold, respectively, blocks the bioactivity of ADM to 80%. This is in the sense of blocking the ADM bioactivity to not more than 80%. This means approximately 20% residual ADM bioactivity remains present.
  • the expression “blocks the bioactivity of ADM” in relation to the herein disclosed anti-ADM antibodies, anti-ADM antibody fragments, and anti- ADM non-Ig scaffolds should be understood as mere decreasing the bioactivity of ADM from 100% to 20% remaining ADM bioactivity at maximum, preferably decreasing the ADM bioactivity from 100% to 50% remaining ADM bioactivity; but in any case there is ADM bioactivity remaining that can be determined as detailed above.
  • the bioactivity of ADM may be determined in a human recombinant Adrenomedullin receptor cAMP functional assay (Adrenomedullin Bioassay) according to Example 2.
  • a modulating anti-ADM antibody or a modulating anti-ADM antibody fragment or a modulating anti-ADM non-Ig scaffold is used in therapy or prevention of shock in a patient.
  • a “modulating” anti-ADM antibody or a modulating anti-ADM antibody fragment or a modulating anti- ADM non-Ig scaffold is an antibody or antibody fragment or non-Ig scaffold that enhances the half-life (ti ⁇ half retention time) of adrenomedullin in serum, blood, plasma at least 10 %, preferably at least, 50 %, more preferably >50 %, most preferably >100% and blocks the bioactivity of ADM to less than 80 %, preferably less than 50 % and said anti-ADM antibody, anti-ADM antibody fragment or anti-ADM non-Ig scaffold would block the bioactivity of ADM to at least 5 %.
  • Such a modulating anti-ADM antibody or modulating anti-ADM antibody fragment or a modulating anti-ADM non-Ig scaffold offers the advantage that the dosing of the administration is facilitated.
  • the combination of partially blocking or partially reducing ADM bioactivity and increase of the in vivo halflife (increasing the ADM bioactivity) leads to beneficial simplicity of anti-ADM antibody or an anti- ADM antibody fragment or anti-ADM non-Ig scaffold dosing.
  • the activity lowering effect is the major impact of the antibody or fragment or scaffold, limiting the (negative) effect of ADM.
  • the biological effect of anti-ADM antibody or anti- ADM antibody fragment or anti-ADM non-Ig scaffold is a combination of lowering (by partially blocking) and increase by increasing the ADM half-life.
  • the non-neutralizing and modulating anti- ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold acts like an ADM bioactivity buffer in order to keep the bioactivity of ADM within a certain physiological range.
  • pharmaceutical formulation refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
  • the present invention also relates to a pharmaceutical formulation comprising a therapeutically effective dose of the active ingredient, in combination with at least one pharmaceutically acceptable excipient.
  • “Pharmaceutically acceptable excipient” refers to an excipient that does not produce an adverse, allergic, or other untoward reaction when administered to a subject. It includes in addition to a therapeutic protein, carriers, various diluents, fillers, salts, buffers, stabilizers, solubilizers, and other materials well known in the art. The characteristics of the carrier will depend on the route of administration.
  • the formulation of the present invention can be administered directly into the blood stream, into muscle, into tissue, into fat or into an internal organ of a patient.
  • Suitable means for parenteral administration include intravenous, intraarterial, intraperitoneal, intrathecal, intraventricular, intraurethral, intrastemal, intracranial, intramuscular, intra-ossial, intradermal and subcutaneous.
  • Suitable devices for parenteral administration include needle (including microneedle, micro projections, soluble needles and other micropore formation techniques) injectors, needle-free injectors, and infusion techniques.
  • the formulation of the present invention is administered to the subject subcutaneously.
  • the aqueous pharmaceutical composition can be administered to a subject in need of treatment, in accordance with known methods of administration.
  • methods of administration can further include shock dose injection or infusion over a certain period of time, intracerebrospinal, transdermal, oral, topical application or inhalation.
  • the administration pattern of the aqueous formulation according to the present invention comprises administration of a dose of the formulation once every week, once every two weeks, once every three weeks, once every four weeks, once every five weeks, once every six weeks, once every seven weeks, once every eight weeks, once every nine weeks, once every ten weeks, once every fifteen weeks, once every twenty weeks or once every twenty-four weeks.
  • the aqueous formulation according to the present invention is administered once every month, once every two months, once every three months, once every four months, once every five months, or once every six months.
  • the volume of a dose in the formulation is less than or equal to about 20 ml, about 15 ml, about 10 ml, about 5 ml, about 2.5 ml, about 1 .5 ml, about 1 .0 ml, about 0.75 ml, about 0.5 ml, about 0.25 ml or about 0.01 ml.
  • the volume of a dose in the formulation is about 20 ml, about 19 ml, about 18 ml, about 17 ml, about 16 ml, about 15 ml, about 14 ml, about 13 ml, about 12 ml, about 1 1 ml, about 10 ml, about 9 ml, about 8 ml, about 7 ml, about 6 ml, about 5 ml, about 4 ml, about 3 ml, about 2 ml or about 1 ml.
  • the volume of the dose in a formulation is about 1 .0 ml.
  • Dosage regimens may depend on the pattern of pharmacokinetic decay that the practitioner wishes to achieve. For example, in some embodiments, dosing from one-four times a week is contemplated. Even less frequent dosing may be used.
  • the dose is administered once every 1 week, every 2 weeks, every 3 weeks, every 4 weeks, every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks, every 10 weeks, every 15 weeks, every 20 weeks, every 25 weeks, or longer.
  • the dose is administered once every 1 month, every 2 months, every 3 months, every 4 months, every 5 months, every 6 months, or longer. The progress of this therapy is easily monitored by conventional techniques and assays.
  • the dosing regimen can vary over time.
  • the dose of the formulation of the present invention is administered at 1-10 mg/ kg body weight every other week (e.g., by intravenous injection). In some embodiments, the dose of the formulation of the present invention is administered 1-10 mg/ kg body weight every other week (e.g., by intravenous injection). In some embodiments, the dose of the formulation of the present invention is administered at an initial dose of four 1-10 mg/ kg body weight intravenous injections in one day (at day 1) or two 1-10 mg/kg body weight injections per day for two consecutive days (at days 1 and 2), followed by a second dose two weeks later (at day 15) at 1-10 mg/ kg body weight, and followed by a maintenance dose of 1-10 mg/ kg body weight every other week.
  • the dose of the formulation of the present invention is administered at an initial dose of 1-10 mg/ kg body weight (e.g., intravenous injection), followed by 1-10 mg/kg body weight every other week starting one week after initial dose.
  • the appropriate dosage of the medicament will depend on the antibody employed, the type and severity of the disorder to be treated, whether the agent is administered for preventative or therapeutic purposes, previous therapy, the patient's clinical history and response to the agent, and the discretion of the attending physician.
  • the clinician will administer the medicament, until a dosage is reached that achieves the desired result. Dosages may be determined empirically. For example, individuals are given incremental dosages to assess efficacy of the medicament, blood glucose levels may be followed.
  • Dose and/or frequency can vary over course of treatment. Empirical considerations, such as the antibody half-life, generally will contribute to the determination of the dosage. Frequency of administration may be determined and adjusted over the course of therapy, and is generally, but not necessarily, based on treatment and/or suppression and/or amelioration and/or delay of one or more symptoms of autoimmune disease. In some individuals, more than one dose may be required. Frequency of administration may be determined and adjusted over the course of therapy. For example, without limitation, for repeated administrations over several days or longer, depending on the disease and its severity, the treatment is sustained until a desired suppression of symptoms occurs or until sufficient therapeutic levels are achieved.
  • Administration of the formulation of the present invention can be continuous or intermittent, depending, for example, upon the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners.
  • the administration of the formulation of the present invention can be essentially continuous over a preselected period of time or may be in a series of spaced dose.
  • the administration of the dose is a parenteral administration preferably selected from intravenous, intraarterial, intraperitoneal, intrathecal, intraventricular, intraurethral, intrastemal, intracranial, intramuscular, intra-ossial, intradermal and subcutaneous.
  • parenteral administration preferably selected from intravenous, intraarterial, intraperitoneal, intrathecal, intraventricular, intraurethral, intrastemal, intracranial, intramuscular, intra-ossial, intradermal and subcutaneous.
  • parenteral administration e.g., subcutaneous administration.
  • Pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment wherein said antibody or fragment binds to the N-terminal part (aa 1-21) of ADM: YRQSMNNFQGLRSFGCRFGTC (SEQ ID No. 1), wherein said antibody or antibody fragment is present in a concentration of 1 mg/ml to 100 mg/ml, preferably 2 mg/ml to 50 mg/ml, more preferably 10 mg/ml to 30 mg/ml, more preferably 15 mg/ml to 25 mg/ml and most preferably 20 mg/ml and wherein said pharmaceutical aqueous formulation is further comprising:
  • compositions comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to embodiment 1, wherein said antibody or fragment is a human monoclonal antibody or fragment that binds to the N-terminal region (aa 1-21) of ADM (SEQ ID No. 1) or an antibody fragment thereof wherein the heavy chain comprises the sequences:
  • CDR2 SEQ ID NO: 3
  • TEGYEYDGFDY and wherein the light chain comprises the sequences:
  • CDR2 SEQ ID NO: 6
  • compositions comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 2, comprising an Anti-Adrenomedullin antibody directed to the N-terminal end of Adrenomedullin comprising the following sequence as a heavy chain: SEQ ID NO: 8
  • compositions comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 3, wherein said surfactant is Poloxamer.
  • ADM anti-adrenomedullin
  • compositions comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 4, wherein said formulation is essentially free of NaCl and/or Glycine.
  • ADM anti-adrenomedullin
  • aqueous formulation comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 5, wherein Arginine is present in a range of 1 g/L to 100 g/L, preferably 15 g/L to 60 g/L, preferably 13.1 g/L to 52.2 g/L, preferably 11.2 g/L to 44.4 g/L and more preferably 26.1 g/L .
  • ADM human or humanized anti-adrenomedullin
  • aqueous formulation comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 6, wherein Trehalose is present in a range of 1 g/L to 100 g/L, preferably 32.6 g/L to 97.8 g/L, preferably 28.4 g/L to 85.1 g/L, preferably 24.1 g/L to 72.4 g/L and more preferably 56.7 g/L.
  • ADM human or humanized anti-adrenomedullin
  • aqueous formulation comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 7, wherein Poloxamer is present in a range of 0.01 g/L to 5 g/L, preferably 0.115 g/L to 1.15 g/L, preferably 0.1 g/L to 1.0 g/L, preferably 0.085 g/L to 0.85 g/L and more preferably 0.5 g/L.
  • ADM human or humanized anti-adrenomedullin
  • aqueous formulation comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 8, wherein Histidine is present in a range of 0.1 g/L to 6.4 g/L, preferably 0.22 g/L to 6.88 g/L, preferably 0.8 g/L to 3.2 g/L, preferably 0.68 g/L to 3.68 g/L and more preferably 1.6 g/L.
  • ADM human or humanized anti-adrenomedullin
  • compositions comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 9, wherein the pH of the formulation is in the range of 4.0 to 8.0 preferably 5.0 to 7.0, more preferably 6.0.
  • Pharmaceutical aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 10, wherein said formulation comprises an Anti-Adrenomedullin antibody directed to the N- terminal end of Adrenomedullin comprising the following sequence: SEQ ID No.
  • aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 11, wherein said formulation is stable after storage for at least 4 weeks at 2 to 8°C and wherein less than 5 wt/wt-%, preferably 4 wt/wt-%, more preferably 3 wt/wt-%, more preferably 2 wt/wt-%, more preferably 1 wt/wt-%, more preferably 0.05 % -mol or most preferably 0.01 wt/wt-%of the total antibody is aggregated as measured by size exclusion High performance liquid chromatography (SEC-HPLC) and wherein said antibody is present at a concentration of 1 mg/ml to 100 mg/ml, preferably 2 mg/ml to 50 mg/ml, more preferably 10 mg/ml to 30 mg/ml, more preferably 15 mg/ml to 25 mg/ml and most preferably
  • compositions comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 12, wherein said formulation is stable after storage for at least 4 weeks at 2 to 8°C and wherein stable means that said formulation remains free from visible particles.
  • Pharmaceutical aqueous formulation comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 13, wherein said formulation is stable after storage for at least 4 weeks at 2 to 8°C and wherein stable means that said formulation remains free from subvisible particles.
  • aqueous formulation comprising an human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 14, wherein the activity of said antibody or antibody fragment in said formulation is stable after stress and wherein stress is induced by storing said formulation for at least 4 weeks at 45 °C, preferably 42 °C, more preferably, 38 °C, more preferably 36 °C and most preferably 40 °C and 85% rH, preferably 80 rH, preferably 70% rH, and most preferably 75% rH and/or by storing said formulation for at least 3 months of storage at 29 °C, preferably 27 °C, more preferably, 22 °C, more preferably 20°C and most preferably 25 °C and/or 70% rH, preferably 65% rH, preferably 55% rH, more preferably 50% rH and most preferably 60% rH and/or by storing said formulation for at least 6 months of storage
  • aqueous formulation comprising a human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment according to any of embodiments 1 to 15, wherein said antibody is present in a concentration of 1 mg/ml to 100 mg/ml, preferably 2 mg/ml to 50 mg/ml, more preferably 10 mg/ml to 30 mg/ml, more preferably 15 mg/ml to 25 mg/ml and most preferably 20 mg/ml.
  • Pharmaceutical lyophilized formulation obtainable from a pharmaceutical aqueous formulation according to any of embodiments 1 to 16.
  • Method of making a ready-for-application solution comprising the steps: a. Providing a pharmaceutical aqueous formulation according to embodiments 1 to 16 b.
  • Adjusting the pharmaceutical aqueous formulation from step a) in a physiological acceptable solution by optionally diluting the volume of the pharmaceutical formulation from step a) with a physiological acceptable solution and by optionally aliquoting the pharmaceutical formulation from step a) wherein the diluted or adjusted aqueous pharmaceutical formulation is suitable for the administration in a patient.
  • Method of making a ready-for-application solution comprising the steps: a. Providing a lyophilized formulation obtained from the aqueous formulation according to any of embodiments 1 to 16 by freeze drying optionally without adding any other bulk reagent b. Reconstitution of the lyophilizate from step a) in water and/or a physiological acceptable solution for injection c.
  • Adjusting the reconstituted formulation from step b) in a physiological acceptable solution by optionally diluting the volume of the reconstituted formulation from step b) with a physiological acceptable solution and by optionally aliquoting the reconstituted formulation from step b) wherein the diluted or adjusted aqueous pharmaceutical formulation is suitable for the administration in a patient.
  • Ready-for-application aqueous pharmaceutical formulation obtainable by a method according to embodiment 18 or 19 comprising said human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment in a dose of 1 to 10 mg/kg body weight.
  • Ready-for-application aqueous pharmaceutical formulation obtainable by a method according to embodiment 18 or 19 comprising said human or humanized anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment in a dose of 2 to 8 mg/kg body weight, preferred 2 or 4 or 8 mg/kg body weight.
  • ADM anti-adrenomedullin
  • an acute disease or acute condition selected from the group comprising: SIRS, a severe infection, sepsis, shock selected from the group comprising shock due to hypovolemia, cardiogenic shock, obstructive shock and distributive shock, in particular cardiogenic shock, septic shock, shock due to Covid- 19, shock due to bums and traumatic shock.
  • an acute disease or acute condition selected from the group comprising: SIRS, a severe infection, sepsis, shock selected from the group comprising shock due to hypovolemia, cardiogenic shock, obstructive shock and distributive shock, in particular cardiogenic shock, s
  • a disease that is selected from the group comprising SIRS, sepsis, diabetes, cancer, acute vascular diseases as e.g. heart failure, shock as e.g. septic shock and organ dysfunction as e.g. kidney dysfunction.
  • SIRS systemic inflammatory Response-Syndrome
  • a disease or condition selected from the group comprising: congestive high blood pressure, swelling or water retention (edema), heart failure in particular acute heart failure, kidney, or liver disease.
  • composition for use in therapy or prevention according to any of the embodiments 1 to 16, and 20 to 27, comprising:
  • MR-proADM, CT-proADM, PAMP, Bio- ADM or ADM-gly to a predefined threshold or to a previously determined level of said fragment, and wherein for the correlation an elevated level of said fragment of pre-pro-Adrenomedullin selected from the group comprising MR-proADM, CT-proADM, PAMP, Bio- ADM or ADM-gly or fragments thereof above a certain threshold or above a previously determined level is used for patient stratification for a therapeutic use according to the present invention.
  • ADM Anti-adrenomedullin
  • composition for use in therapy or prevention according to any of the embodiments 1 to 17, 20 to 29 wherein said patient is characterized by having a level of dipeptidyl peptidase 3 (DPP3) in a sample of bodily fluid of said patient below a threshold prior to drug administration.
  • DPP3 dipeptidyl peptidase 3
  • Figure 1 A-C Relative area [%] of Main Peak (A), HMWS (B) and LMWS (C) as determined by SEC- HPLC of unstressed and stressed anti-ADM antibody (HAM8101) samples. Graphs show mean value of two replicates measured each two times.
  • Figure 3 A-C Relative area [%] of Main Peak (A), Acidic Peaks (B) and Basic Peaks (C) as determined by CEX-HPLC of unstressed and stressed anti-ADM antibody (HAM8101) samples. Graphs show mean value of two replicates measured each two times.
  • Figure 5 Results of DLS measurement of unstressed and stressed ant- ADM antibody (HAM8101) samples.
  • Figure 6 A-B Results of non-reduced CE SDS after accelerated Aging (A), Mechanical stress (B) and Freeze and Thaw show mean value and SD of two replicates measured each two times.
  • Figure 7 A-B Results of reduced CE SDS after accelerated Aging (A), Mechanical stress (B) and Freeze and Thaw show mean value and SD of two replicates measured each two times.
  • Figure 8 DLS results of formulations 1-5 after storage at 40 °C and after mechanical stress.
  • Figure 9 DLS results of formulations 6-11 after storage at 40 °C and after mechanical stress.
  • Figure 10 DLS results of formulation 11-15 after storage at 40 °C and after mechanical stress.
  • Figure 11 DLS results of formulation 16-21 after storage at 40 °C and after mechanical stress.
  • Figure 12 A-B Relative area [%] Monomer of SEC-HPLC of formulated anti-ADM antibody (HAM8101) stored for up to 2 weeks at 40 °C ⁇ 2 °C / 75 % rH ⁇ 5 % rH (A) and after mechanical stress and freeze & Thaw (B), graphs show mean.and SD of two replicates measured each twice.
  • Figure 13 A-B Relative area [%] HMWS of SEC-HPLC of formulated anti-ADM antibody (HAM8101) stored for up to 2 weeks at 40 °C ⁇ 2 °C / 75 % rH ⁇ 5 % rH (A) and after mechanical stress and freeze & Thaw (B), graphs show mean and SD of two replicates measured each twice.
  • Figure 14 A-B Relative area [%] LMWS of SEC-HPLC of formulated anti-ADM antibody (HAM8101) stored for up to 2 weeks at 40 °C ⁇ 2 °C / 75 % rH ⁇ 5 % rH (A) and after mechanical stress and freeze & Thaw (B) graphs show mean and SD of two replicates measured each twice.
  • Figure 15 A-D Particle content below 5 pm (A), from 5 to 10 pm (B), above or equal to 10 pm (C) and above or equal to 25 pm (D) after 2 weeks of storage at 40 °C.
  • Figure 16 A-D Subvisible Particle content below 5 pm (A), from 5 to 10 pm (B), above or equal to 10 pm (C) and above or equal to 25 pm (D) after mechanical stress.
  • Figure 17 A-C Relative area [%] Monomer (A), HMWS (B) and LMWS (C) content of SEC-HPLC of formulated anti-ADM antibody (HAM8101) stored for up to 4 weeks at 40 °C ⁇ 2 °C / 75 % rH ⁇ 5 % rH. Graphs shows mean and SD of two replicates measured each twice.
  • Figure 18 A-C Relative area [%] Monomer (A), HMWS (B) and LMWS (C) content of SEC-HPLC of formulated anti-ADM antibody (HAM8101) after mechanical stress and 5 Freeze & Thaw cycles. Graphs shows mean and SD of two replicates measured each twice.
  • Figure 19 Relative Monomer content after external analysis via analytical ultracentrifugation.
  • Figure 20 A-B DLS results after storage at 40 °C (A) and after mechanical stress (B).
  • Figure 21 A-D Particles after thermal stress, Particle content below 5 pm (A), from 5 to 10 pm (B), above or equal to 10 pm (C) and above or equal to 25 pm (D) after 2 weeks of storage at 40 °C.
  • Figure 22 A-D Particles after mechanical stress, Particle content below 5 pm (A), from 5 to 10 pm (B), above or equal to 10 pm (C) and above or equal to 25 pm (D) after mechanical stress.
  • Figure 23 A-C Relative area [%] of Main (A), acidic (B) and basic (C) species of CEX-HPLC of formulated anti-ADM antibody (HAM8101) stored for up to 3.5 weeks at 40 °C ⁇ 2 °C / 75 % rH ⁇ 5 % rH. Graphs show mean and SD of two replicates measured each twice.
  • Figure 24 A-C Relative area [%] of Main (A), acidic (B) and basic (C) species of CEX-HPLC of formulated anti-ADM antibody (HAM8101) after mechanical stress and 5 Freeze & Thaw cycles. Graphs show mean and SD of two replicates measured each twice Examples
  • HAM8101 All excipients used for the formulation of HAM8101 were sourced in Unites States Pharmacopoeia (USP) and/or European Pharmacopeia (Ph. Eur.) compliant quality. All chemicals used for analytical methods were sourced in a quality adequate for the individual method (e.g., p.a.). Drug substance (DS) samples of HAM8101 in basic buffer and current formulation were provided by the manufacturer. All samples were stored at -80 °C with internal monitoring.
  • USP Unites States Pharmacopoeia
  • Ph. Eur. European Pharmacopeia
  • osmolality was performed by freezing point depression in an Osmometer (Osmomat 030-D RS, Gonotec). Each measurement was performed in 15 pl aliquots after calibration with sodium chloride standard (600 mOsmol/kg) and purified water.
  • the buffer exchange of the DS for re-formulation was performed by dialysis in Slide-A-Lyzer Cassettes (Thermo) with a nominal cut-off of 20 kDa. Samples were dialyzed three times each for at least 2 hours slowly stirred at 2 - 8 °C in a freezer, from which one step was performed overnight (>12 h). After dialysis, HAM8101 concentration was adjusted to the target value 20 g/L ⁇ 2 g/L with corresponding buffer, if necessary.
  • the concentration of the drug substance was measured by absorption at 280 nm using the Spark Plate Reader (Tecan, Sau). To do so, placebo and DS samples were measured in one 96 well plate under the same conditions. Then, adsorption of placebo was subtracted from corresponding DS samples. 6. Vial filling
  • samples were sterile filtered with 0.1 pm PES-filters.
  • a volume of 2 ml of each formulation with 20 mg/ml ⁇ 2 mg/mL DS were inserted into sterile, particle- free 2R-vials (provided by Rentschler) under a laminar air flow, he vials were closed with sterile stoppers (provided by Rentschler) and crimped with suitable aluminum caps.
  • the samples stored at 5 ⁇ 3 °C were kept in refrigerators with external temperature monitoring.
  • DS in original formulation was stored at -80 °C in a freezer with internal monitoring of temperature.
  • Samples subjected to an accelerated aging were stored in ICH cabinets (Memmert) with controlled humidity at 25 ⁇ 2 °C / 60 ⁇ 5 % rH, 30 ⁇ 2 °C / 65 ⁇ 5 % rH and 40 ⁇ 2 °C / 75 ⁇ 5 % rH, respectively.
  • the temperature was additionally monitored independently during the complete storage period. Freeze/thaw stress was performed in cooling cells with alternating storages at -80 °C and +25 °C, for at least 2 hours each. The freezing and thawing result was visually controlled and adapted accordingly.
  • Shear stress was applied by over-head rotation (Over-Head shaker, Hei-Mix Reax 2, Heidolph / VWR) at 30 rpm for 24 h or orbital shaking (Dual Plate Shaker PSU-2T, Kisker) at 400 rpm for the indicated time periods, at uncontrolled room temperature. For all storage time points for up to one month, samples were pulled within +/- 1 day of target pull date and for two, three- and six-months stability duration within +/- 3 days from the target pull date.
  • SE-HPLC method was based on the SOP provided by the manufacturer for HAM8101.
  • the stored samples (20 ⁇ 2 mg/ml HAM8101) were separated on a TSKgel G3000SWXL column (5 pm, 7.8 x 300 mm, Tosoh Bioscience, No: 0008541) using a Thermo Ultimate 3000 HPLC system with an isocratic flow of 0.5 ml/min at 20 ⁇ 5 °C (50 mM Sodium phosphate, 300 mM Sodium chloride, pH 7.0). Data were recorded at 214 and 280 nm by UV detector. Per injection, 20 pg DS diluted in 20 pl mobile phase were loaded.
  • CEX-HPLC method was based on the SOP provided by Rentschler for HAM8101.
  • the stored samples (20 ⁇ 2 mg/ml HAM8101) were separated on a MAbPac SCX-10 column (5 pm, 4 mm x 150 mm; Thermo Scientific, No.: 085198) on a Thermo Ultimate 3000 HPLC system.
  • a gradient (see Table 1) with Diluent A: 100 % 20 mM 2-(N-morpholino) ethanesulfonic acid (MES) and Diluent B: 100 % 20 mM MES with 200 mM sodium chloride with pH 6.0 over 40 minutes was used to separate the antibody charged variants at a constant flow rate of 0.5 ml/min at 25 ⁇ 5 °C.
  • Per injection 60 pg DS diluted in Eluent A in 30 pl were loaded. Data were recorded at 280 nm and 214 nm by UV detector. Data analysis was performed with Chromeleon 7.2.6.10049 software.
  • Example 3 all turbid samples (e.g., FT and 2w 40 °C samples, F01 and F06) and from Example 4 (WP4b) onwards all samples and all placebos were filtered with 0.1 PES filters (Sartorius, 16553).
  • the eluent was prepared according to the SOP, the samples were diluted, and the sequence runs were also performed corresponding to the SOP but the results with sample buffer pH 6.8 were not comparable to the results provided by the manufacturer. Thus, samples were diluted with sample buffer pH 9.0 and the sequence run was repeated. Using the pH 9.0 sample buffer, the results were comparable, and the instrument settings and sample preparation was used for further WPs of this project
  • Dynamic light scattering was performed in a DynaPro Plate Reader III (Wyatt) in 384 well plates (Aurora) at 25 °C.
  • samples were measured undiluted with 20 mg/ml and diluted to different concentrations (0.25 mg/mL, 0.5 mg/mL, 0.75 mg/mL and 1 mg/mL) with placebo measured alongside the samples. All subsequent measurements were performed with 35 pL of undiluted samples and 35 pL of all placebos measured under the same conditions. After sample filling, the plates were sealed with sealing tape and shortly centrifuged before being put into the DLS Plate Reader at 25 °C. Analysis was performed with Dynamics, version 7.9.14. For each replicate, 10 individual acquisitions for 5 s each were recorded, as indicated in Figure 1.
  • Results are reported as mean value of two biological replicates with three technical replicates each. All measurements were reported as intensity weighted results.
  • DLS particles having hydrodynamic radii in the nanometer scale are monitored.
  • Degradation products can be either fragments with smaller radii than the radius of the monomer DS or aggregates with higher radii that each appear as additional population.
  • the results can be visualized as e.g., histograms of particle size populations.
  • Category type plots of DLS peaks containing D50-values and peak radii in combination with a histogram-based intensity weighting were applied.
  • DLS data were presented as D50-values over radius scatter plots of all measured peaks with intensity weighted symbol size in order to allow for easier comparison of the different formulations during storage time.
  • the radii for each population (x-axis) and the D50 value of all particles measured (y-axis) of each measurement are plotted within a log-log scatter plot.
  • each peak is proportional to the relative intensity of the respective peak (%Intensity weighted).
  • the overlay of replicate measurements using transparent color in addition enables the evaluation of the reproducibility of each signal by color intensity being useful in main peak determination.
  • each measurement consists of at least 2x100 single measurements. Parameters derive from a volume distribution and from an intensity distribution, which is itself obtained from a correlation function. Overall, the D50 value over peak radius plots with intensity weighted symbol size are used for qualitative comparison of the formulations at the applied time points within the different study arms of the stability study.
  • Turbidity of samples was analyzed by nephelometry or by measuring the absorption at 350 nm, 510 nm and 550 nm. Turbidity by absorption at 350 nm, 510 nm and 550 nm was measured using the Spark Plate Reader (Tecan, Sau). To do so, placebo and DS samples were measured in one 96 well plate under the same conditions.
  • turbidity of formulated drug substance was measured in cuvettes (HACH-Lange) with an inner diameter of 11 mm on a calibrated turbidimeter LAB 2100 AN (HACH-Lange) by comparing the measured turbidity to standards with known turbidity ( ⁇ 0.1, 3, 6, 18, 20 and 30 NTU, acc. to European Pharmacopeia 6.0 as described in the StablCal®-Kit user manual; HACH-Lange).
  • Micron-sized protein aggregates and particles are important quality attributes of therapeutic protein formulations due to their risk of enhancing an immunogenic response. Quantification of subvisible particles larger than 10 pm and 25 pm is therefore required by the pharmacopoeias and is commonly performed using light obscuration (LO) techniques.
  • LO light obscuration
  • the acceptance criteria for SVP are 6000 NMT > 10 pm / container and 600 NMT > 25 pm / container. SVPs ⁇ 10 pm have to be monitored, acceptance criteria are not defined.
  • quantification and characterization of particles with a size below 10 pm is of increasing interest and are in the meanwhile a regulatory expectation. In this study, measurements were performed by microfluid imaging using a FlowCam (Fluid Imaging Technologies) according to the Software settings below.
  • the software visual spreadsheet (version 4.12.3, Fluid Imaging Technologies) was used for analysis.
  • the data were size grouped ace. to Ph. Eur./USP into subvisible particles (SVPs) below 5 pm, 5 - 10 pm, above or equal to 10 pm and above or equal to 25 pm.
  • Sample and placebo measurements were performed undiluted. After every technical replicate at least one cleaning and washing step with 4 % Hellmanex III (Sigma- Aldrich) and water was performed. Only if a SST measurement with water exhibited no particle pollution, the sample measurement was performed.
  • MFI is supposed to deliver higher particle counts if compared to LO due to a higher sensitivity for particles with a refractive index similar to the solvent Huang et al., 2009). This especially applies to proteinaceous particles.
  • Appearance testing of formulated DS was performed regarding color according to Ph. Eur. method 2.2.2. Visible particles, (Ph. Eur. method 2.9.20) clarity and degree of opalescence (Ph. Eur. method 2.2.) were analyzed according to Ph. Eur. method 2.9.20 and 2.2.1 respectively. Above assessments were performed using an inspection light box equipped with non-flickering fluorescent lamps and a black and a white background plate. For color assessment, samples were compared to Ph. Eur. reference solutions and freshly prepared water. The samples were evaluated for 5 s without magnification to assess number and shape of visual particles and clarity in front of black and white background.
  • Results of SEC-HPLC were analyzed as relative peak area [%], mean values of two replicates measured each two times were calculated and displayed in Figure 1.
  • the samples were stressed by overhead rotation, Orbital shaking at room temperature and 5 freeze / thaw (F/T) cycles.
  • the SEC-HPLC results of mechanical and freeze/thaw stress are shown in Figure 2.
  • the key results of the SEC Analysis are: 1. Temperature dependent increase of LMWS during thermal storage (strongest increase at 40°C) 2. Increase of HMWS in SEC after 5 F&T cycles:
  • CE-SDS red./non-red
  • CE-SDS were expressed as mean relative peak areas derived from two replicates measured in duplicates (see Figures 6 and 7). The key results of the CE-SDS Analysis are: 1. Rising LMWS at 40 °C after 7 days and beyond 2. No effect of mechanical stress detected 3. CE-SDS data fit to the SEC data Example 3: Design, test and optimization of formulations to stabilize an anti- ADM antibody (HAM8101) and reduce particle formation in liquid formulation during two rounds of accelerated aging- Screening DoE design
  • the purpose of this screening round was to investigate the influence of the different parameters of screening DoE, as shown in Table 5.
  • the reference of anti- ADM antibody (HAM8101) was formulated in current buffer (20mM His/HCL, 300mM Glycine, pH 6.0).
  • Results of SEC-HPLC were expressed as mean relative peak area [%], derived from two replicates measured in duplicates and displayed in Figures 12 to 14.
  • Example 4 Design, test and optimization of formulations to stabilize an anti- ADM antibody (HAM8101) and reduce particle formation in liquid formulation during two rounds of accelerated aging- Screening DoE design - Optimization round
  • Example 3 Based on the results of Example 3, 10 formulations were selected additional to the current formulation (Fl 1) and subjected to a second round of forced degradation. Stress conditions for Example 4 were identical to those used for Example 3. The composition of the different formulations is shown in Table 9.
  • Results of SEC-HPLC were expressed as mean relative peak area [%], derived from two replicates measured in duplicates and displayed in Figures 17 and 18. Overall a pronounced fragmentation is detected after 4 weeks at 40 °C and an effect of rising HMW levels in Formulation 11 after 5 Freeze and Thaw cycles.
  • results of CE-SDS non-reduced (Table 12) and reduced (Table 13) were expressed as mean relative peak area derived from two replicates measured in duplicates and displayed in Table 12 and Table 13 respectively.
  • the results of CE-SDS (non-reduced) indicated that no distinct aggregation effect detectable, but a pronounced fragmentation was visible after 3.5 weeks at 40 °C.
  • the lowest fragmentation level could be observed for F01 and F02, whereas the highest fragmentation level was observed for F08 and Fl l.
  • the results of CE-SDS (reduced) indicated that no distinct aggregation and fragmentation effect was detectable.
  • pronounced fragmentation was detectable after 3.5 weeks at 40 °C and the lowest fragmentation level was observed for F02, F03 and F09.
  • Table 4 Visual appearance (color, clarity and visible particles) after stress and subsequent freezing at - 80 °C and aliquotation for analytics and further cycle of freezing at -80 °C
  • Table 6 Composition of DoE based formulations g/t
  • Table 7 Measured Osmolality in mOsmol/L (in Vial A, B and Placebo) and concentration in g/L (mean
  • Table 10 Measured osmolality in mOsmol/L (in vial A, B) and concentration in g/L (mean + SD) after manufacturing and storage
  • Table 11 Results of the analytical ultracentrifugation

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Peptides Or Proteins (AREA)
PCT/EP2023/056663 2022-03-15 2023-03-15 Stable aqueous formulation of an anti-adrenomedullin (adm) antibody or anti-adm antibody fragment Ceased WO2023175035A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
CN202380036069.7A CN119072492A (zh) 2022-03-15 2023-03-15 抗肾上腺髓质素(adm)抗体或抗adm抗体片段的稳定水性制剂
JP2024553456A JP2025509304A (ja) 2022-03-15 2023-03-15 抗アドレノメデュリン(adm)抗体又は抗adm抗体フラグメントの安定な水性製剤
IL315632A IL315632A (en) 2022-03-15 2023-03-15 Stable aqueous formulation of an anti-adrenomedullin (adm) antibody or anti-adm antibody fragment
EP23711082.0A EP4493588A1 (en) 2022-03-15 2023-03-15 Stable aqueous formulation of an anti-adrenomedullin (adm) antibody or anti-adm antibody fragment
AU2023233838A AU2023233838A1 (en) 2022-03-15 2023-03-15 Stable aqueous formulation of an anti-adrenomedullin (adm) antibody or anti-adm antibody fragment
US18/844,746 US20250304671A1 (en) 2022-03-15 2023-03-15 Stable aqueous formulation of an anti-adrenomedullin (adm) antibody or anti-adm antibody fragment
CA3254142A CA3254142A1 (en) 2022-03-15 2023-03-15 STABLE AQUEOUS FORMULATION OF AN ANTI-ADRENOMEDULLIN (ADM) ANTIBODY OR AN ANTI-ADM ANTIBODY FRAGMENT
MX2024010899A MX2024010899A (es) 2022-03-15 2024-09-05 Formulación acuosa estable de un anticuerpo anti-adrenomedulina (adm) o fragmento de anticuerpo anti-adm.

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP22162271 2022-03-15
EP22162271.5 2022-03-15

Publications (1)

Publication Number Publication Date
WO2023175035A1 true WO2023175035A1 (en) 2023-09-21

Family

ID=80780591

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2023/056663 Ceased WO2023175035A1 (en) 2022-03-15 2023-03-15 Stable aqueous formulation of an anti-adrenomedullin (adm) antibody or anti-adm antibody fragment

Country Status (9)

Country Link
US (1) US20250304671A1 (cg-RX-API-DMAC7.html)
EP (1) EP4493588A1 (cg-RX-API-DMAC7.html)
JP (1) JP2025509304A (cg-RX-API-DMAC7.html)
CN (1) CN119072492A (cg-RX-API-DMAC7.html)
AU (1) AU2023233838A1 (cg-RX-API-DMAC7.html)
CA (1) CA3254142A1 (cg-RX-API-DMAC7.html)
IL (1) IL315632A (cg-RX-API-DMAC7.html)
MX (1) MX2024010899A (cg-RX-API-DMAC7.html)
WO (1) WO2023175035A1 (cg-RX-API-DMAC7.html)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025056807A1 (en) * 2023-09-15 2025-03-20 Basf Se Stabilized biopolymer composition, their manufacture and use
WO2025133235A1 (en) * 2023-12-22 2025-06-26 Pam Theragnostics Gmbh Adm-gly as marker for early predicting sepsis
WO2026046978A1 (en) * 2024-08-26 2026-03-05 Pam Theragnostics Gmbh Anti-adm antibodies, anti-adm antibody fragment or anti-adm non-ig scaffold for therapy or prevention of immune effector cell therapy side effects

Citations (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992020791A1 (en) 1990-07-10 1992-11-26 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1993012227A1 (en) 1991-12-17 1993-06-24 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US20020045571A1 (en) * 2000-10-12 2002-04-18 Genentech, Inc. Reduced-viscosity concentrated protein formulations
EP1266025A1 (en) 2000-02-29 2002-12-18 Compound Therapeutics, Inc. Protein scaffolds for antibody mimics and other binding proteins
US20040023334A1 (en) 2001-08-30 2004-02-05 Biorexis Pharmaceutical Corporation Modified transferrin fusion proteins
WO2004097423A1 (en) 2003-04-25 2004-11-11 Genova Ltd. Secreted polypeptide species reduced cardiovascular disorders
WO2005040229A2 (en) 2003-10-24 2005-05-06 Avidia, Inc. Ldl receptor class a and egf domain monomers and multimers
WO2006027147A2 (en) 2004-09-09 2006-03-16 Bayer Healthcare Ag Diagnostics and therapeutics for diseases associated with adrenomedullin receptor (amdr)
US20100028995A1 (en) 2004-02-23 2010-02-04 Anaphore, Inc. Tetranectin Trimerizing Polypeptides
WO2010060748A1 (en) 2008-11-03 2010-06-03 Molecular Partners Ag Binding proteins inhibiting the vegf-a receptor interaction
EP2231860A1 (en) 2007-12-19 2010-09-29 Affibody AB Polypeptide derived from protein a and able to bind pdgf
WO2011023685A1 (en) 2009-08-27 2011-03-03 Covagen Ag Il-17 binding compounds and medical uses thereof
EP2314308A1 (en) 2004-09-21 2011-04-27 BioNTech AG Use of microproteins as tryptase inhibitors
WO2011073214A2 (en) 2009-12-14 2011-06-23 Scil Proteins Gmbh A method for identifying hetero-multimeric modified ubiquitin proteins with binding capability to ligands
WO2011154420A2 (en) 2010-06-08 2011-12-15 Pieris Ag Tear lipocalin muteins binding il-4 r alpha
WO2013072512A1 (en) 2011-11-16 2013-05-23 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or an anti-adm non-ig scaffold for use in therapy
WO2013072510A1 (en) 2011-11-16 2013-05-23 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for reducing the risk of mortality in a patient having a chronic or acute disease or acute condition
WO2013072514A1 (en) 2011-11-16 2013-05-23 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for regulating the fluid balance in a patient having a chronic or acute disease
WO2013072511A1 (en) 2011-11-16 2013-05-23 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for prevention or reduction of organ dysfunction or organ failure in a patient having a chronic or acute disease or acute condition
WO2013072513A1 (en) 2011-11-16 2013-05-23 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy of an acute disease or acute condition of a patient for stabilizing the circulation
WO2017182561A1 (en) 2016-04-21 2017-10-26 Sphingotec Therapeutics Gmbh Methods for determining dpp3 and therapeutic methods
WO2018109228A1 (en) 2016-12-16 2018-06-21 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in intervention and therapy of congestion in a patient in need thereof
WO2019077082A1 (en) * 2017-10-18 2019-04-25 Adrenomed Ag SURVEILLANCE OF THERAPY UNDER TREATMENT WITH ANTI-ADRENOMEDULIN BINDER (ADM)
WO2021170876A1 (en) * 2020-02-27 2021-09-02 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy or prevention of shock

Patent Citations (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992020791A1 (en) 1990-07-10 1992-11-26 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1993012227A1 (en) 1991-12-17 1993-06-24 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
EP1266025A1 (en) 2000-02-29 2002-12-18 Compound Therapeutics, Inc. Protein scaffolds for antibody mimics and other binding proteins
US20020045571A1 (en) * 2000-10-12 2002-04-18 Genentech, Inc. Reduced-viscosity concentrated protein formulations
US20040023334A1 (en) 2001-08-30 2004-02-05 Biorexis Pharmaceutical Corporation Modified transferrin fusion proteins
WO2004097423A1 (en) 2003-04-25 2004-11-11 Genova Ltd. Secreted polypeptide species reduced cardiovascular disorders
WO2005040229A2 (en) 2003-10-24 2005-05-06 Avidia, Inc. Ldl receptor class a and egf domain monomers and multimers
US20100028995A1 (en) 2004-02-23 2010-02-04 Anaphore, Inc. Tetranectin Trimerizing Polypeptides
WO2006027147A2 (en) 2004-09-09 2006-03-16 Bayer Healthcare Ag Diagnostics and therapeutics for diseases associated with adrenomedullin receptor (amdr)
EP2314308A1 (en) 2004-09-21 2011-04-27 BioNTech AG Use of microproteins as tryptase inhibitors
EP2231860A1 (en) 2007-12-19 2010-09-29 Affibody AB Polypeptide derived from protein a and able to bind pdgf
WO2010060748A1 (en) 2008-11-03 2010-06-03 Molecular Partners Ag Binding proteins inhibiting the vegf-a receptor interaction
WO2011023685A1 (en) 2009-08-27 2011-03-03 Covagen Ag Il-17 binding compounds and medical uses thereof
WO2011073214A2 (en) 2009-12-14 2011-06-23 Scil Proteins Gmbh A method for identifying hetero-multimeric modified ubiquitin proteins with binding capability to ligands
WO2011154420A2 (en) 2010-06-08 2011-12-15 Pieris Ag Tear lipocalin muteins binding il-4 r alpha
WO2013072512A1 (en) 2011-11-16 2013-05-23 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or an anti-adm non-ig scaffold for use in therapy
WO2013072510A1 (en) 2011-11-16 2013-05-23 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for reducing the risk of mortality in a patient having a chronic or acute disease or acute condition
WO2013072514A1 (en) 2011-11-16 2013-05-23 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for regulating the fluid balance in a patient having a chronic or acute disease
WO2013072511A1 (en) 2011-11-16 2013-05-23 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for prevention or reduction of organ dysfunction or organ failure in a patient having a chronic or acute disease or acute condition
WO2013072513A1 (en) 2011-11-16 2013-05-23 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy of an acute disease or acute condition of a patient for stabilizing the circulation
WO2017182561A1 (en) 2016-04-21 2017-10-26 Sphingotec Therapeutics Gmbh Methods for determining dpp3 and therapeutic methods
WO2018109228A1 (en) 2016-12-16 2018-06-21 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in intervention and therapy of congestion in a patient in need thereof
WO2019077082A1 (en) * 2017-10-18 2019-04-25 Adrenomed Ag SURVEILLANCE OF THERAPY UNDER TREATMENT WITH ANTI-ADRENOMEDULIN BINDER (ADM)
WO2021170876A1 (en) * 2020-02-27 2021-09-02 Adrenomed Ag Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy or prevention of shock

Non-Patent Citations (66)

* Cited by examiner, † Cited by third party
Title
"The Immunoassay Handbook", May 2005, ELSEVIER LTD
ALISON SHEPHERD, NURSING TOMES, vol. 107, no. 28, pages 12 - 16
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BRATER, DRUGS, vol. 30, pages 427 - 443
CHRISTOPHER GEVEN ET AL: "A double-blind, placebo-controlled, randomised, multicentre, proof-of concept and dose-finding phase II clinical trial to investigate the safety, tolerability and efficacy of adrecizumab in patients with septic shock and elevated adrenomedullin concentration (AdrenOSS-2)", BMJ OPEN, vol. 9, no. 2, 1 February 2019 (2019-02-01), London, UK, pages e024475, XP055721200, ISSN: 2044-6055, DOI: 10.1136/bmjopen-2018-024475 *
CHRISTOPHER GEVEN ET AL: "Vascular Effects of Adrenomedullin and the Anti-Adrenomedullin Antibody Adrecizumab in Sepsis :", SHOCK, vol. 50, no. 2, 1 August 2018 (2018-08-01), US, pages 132 - 140, XP055700172, ISSN: 1073-2322, DOI: 10.1097/SHK.0000000000001103 *
COHEN ET AL., BMJ, vol. 33, no. 7, 2008, pages 718
COLOMBO ET AL., CURR HEART FAIL REP, vol. 12, no. 3, 2015, pages 215 - 222
DE BRUYNE, POST-ARAD MED J, vol. 79, 2003, pages 268 - 271
DEAN FIELD ET AL., J HYPERTENS, vol. 23, no. 1, 2005, pages 7 - 17
DIENER ET AL., NAT REV NEUROL, vol. 8, no. 3, 2012, pages 162 - 71
E. KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1983, U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES
EHLENZ K. ET AL., EXP CLIN ENDOCRINOL DIABETES, vol. 105, 1997, pages 156 - 162
ELLISON, SEMIN NEPHROL, vol. 19, no. 6, 1999, pages 581 - 97
EPSTEIN ET AL., CURR THER RES, vol. 21, 1977, pages 656 - 667
FERREIRA FLBOTA DPBROSS AMELOT CVINCENT JL: "Serial evaluation of the SOFA score to predict outcome in critically ill patients", JAMA, vol. 286, no. 14, 10 October 2001 (2001-10-10), pages 1754 - 8, XP055392278, DOI: 10.1001/jama.286.14.1754
FRANSSON: "Humanization of antibodies", FRONT BIOSCI, vol. 13, 1 January 2008 (2008-01-01), pages 1619 - 33
GEVEN ET AL., INTENSIVE CARE MED EXP, vol. 5, 2017, pages 0427
GEVEN ET AL., SHOCK, vol. 50, no. 2, 2018, pages 132 - 140
GOADSBY ET AL., N. ENJ!L. J. MED., vol. 346, 2002, pages 257 - 270
GOLDBERG ET AL., CIRCULATION, vol. 119, 2009, pages 1211 - 1219
GUTIERREZ ET AL., EUROPEAN HEART JOURNAL, vol. 34, 2013, pages 3175 - 3181
HINSON ET AL., ENDOCRINE REVIEWS, vol. 21, no. 2, 2000, pages 138 - 167
HIRATA ET AL., JOURNAL OF CLINICAL ENDOCRINOLOGY AND METABOLISM, vol. 81, no. 4, 1996, pages 1449 - 1453
HOCHMAN ET AL., J AM COLL CARDIOL, vol. 36, 2000, pages 1063 - 1070
HOOD ET AL.: "Immunology", 1984
HULTSCHIG C ET AL., CURR OPIN CHEM BIOL, vol. 10, no. 1, February 2006 (2006-02-01), pages 4 - 10
HUNKAPILLERHOOD, NATURE, vol. 323, 1986, pages 15 - 16
HUSTON ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 5879 - 5883
ICU MANAGEMENT & PRACTICE, vol. 18, 2018
JONES AETRZECIAK SKLINE JA: "The Sequential Organ Failure Assessment score for predicting outcome in patients with severe sepsis and evidence of hypoperfusion at the time of emergency department presentation", CRIT CARE MED, vol. 37, no. 5, May 2009 (2009-05-01), pages 1649 - 54
KANG JICHAO ET AL: "Rapid Formulation Development for Monoclonal Antibodies", vol. 14, no. 4, 12 April 2016 (2016-04-12), pages 40, 42, 44, 46, XP009532716, ISSN: 1542-6319, Retrieved from the Internet <URL:https://bioprocessintl.com/manufacturing/formulation/rapid-formulation-development-for-monoclonal-antibodies/> *
KIRK-OTHMER: "Encyclopedia of chemical technology", vol. 15, 1993, JOHN WILEY & SONS, pages: 518 - 562
KITAMURA K. ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 244, no. 2, 1998, pages 551 - 555
KITAMURA K. ET AL., BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 192, no. 2, 1993, pages 553 - 560
KOYAPAUL: "Shock. Stat Pearls [Internet]", 27 October 2018, STAT PEARLS PUBLISHING
KYRIAKIDES ET AL., EUROPEAN JOURNAL OF NEUROLOGY, vol. 20, 2013, pages 997 - 1005
LANZAVECCHIA ET AL., EUR. J. IMMUNOL., vol. 17, 1987, pages 105
LATERRE PIERRE-FRANÇOIS ET AL: "Safety and tolerability of non-neutralizing adrenomedullin antibody adrecizumab (HAM8101) in septic shock patients: the AdrenOSS-2 phase 2a biomarker-guided trial", INTENSIVE CARE MEDICINE, SPRINGER BERLIN HEIDELBERG, BERLIN/HEIDELBERG, vol. 47, no. 11, 4 October 2021 (2021-10-04), pages 1284 - 1294, XP037598456, ISSN: 0342-4642, [retrieved on 20211004], DOI: 10.1007/S00134-021-06537-5 *
LORENZ ET AL., ANTIMICROB AGENTS CHEMOTHER, vol. 55, no. 1, 2011, pages 165 - 173
MARINO ET AL., CRITICAL CARE, vol. 18, 2014, pages R34
MARTINEZ ET AL.: "Mapping of the Adrenomedullin-Binding domains in Human Complement factor H", HYPERTENS RES, vol. 26, pages 56 - 59
METZ A., AUSTRALIAN FAMILY PHYSICIAN, vol. 36, no. 9, 2017, pages 688 - 692
METZ A., AUSTRALIAN FAMILY PHYSICIAN, vol. 36, no. 92, 2017, pages 688 - 692
NATES ET AL., CRITICAL CARE MEDICINE, vol. 44, 2016, pages 1553 - 1602
OLESON, FUNCTIONAL NEUROLOGY, vol. 20, no. 2, 2005, pages 61 - 68
PIO ET AL.: "Identification, characterization, and physiological actions of factor H as an Adrenomedullin binding Protein present in Human Plasma", MICROSCOPY RES. AND TECHNIQUE, vol. 55, 2002, pages 23 - 27
PIO R. ET AL., THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 2 76, no. 15, 2001, pages 12292 - 12300
RAVNAN ET AL., CHF, vol. 8, 2002, pages 80 - 85
REHFELD ET AL., JALM, vol. 3, no. 6, 2019, pages 943 - 953
REYNOLDSHOCHMAN, CIRCULATION, vol. 117, 2008, pages 686 - 697
ROCKER ET AL., THORAX, vol. 42, 1987, pages 620 - 23
SHARMA V K ET AL: "The fomulation and delivery of monoclonal antibodies", 1 January 2009, THERAPEUTIC MONOCLONAL ANTIBODIES : FROM BENCH TO CLINIC, WILEY, HOBOKEN, NJ, PAGE(S) 675 - 711, ISBN: 978-0-470-11791-0, XP009143115 *
SINGER ET AL., JAMA, vol. 315, no. 8, 2016, pages 801 - 10
TAYLOR, CARDIOL REV, vol. 8, 2000, pages 104 - 114
TOMODA Y. ET AL.: "Adrenomedullin and cardiovascular responses in sepsis", PEPTIDES, vol. 22, 2001, pages 1835 - 1840
UDUPASHETTV, INDIAN JRESPIR CARE, vol. 7, 2018, pages 67 - 72
UEDA S. ET AL., AM. J. RESPIR. CRIT. CARE MED., vol. 160, 1999, pages 132 - 136
VINCENT JLMORENO RTAKALA JWILLATTS SDE MENDONGA ABRUINING HREINHART CKSUTER PMTHIJS LG: "The SOFA (Sepsis-related Organ Failure Assessment) score to describe organ dysfunction/failure. On behalf of the Working Group on Sepsis-Related Problems of the European Society of Intensive Care Medicine", INTENSIVE CARE MED, vol. 22, no. 7, July 1996 (1996-07-01), pages 707 - 10
VINCENTDE BACKER, N. ENGL. J. MED., vol. 370, no. 6, 2014, pages 583
VOORS ET AL., J. EUR J HEART FAIL., vol. 21, no. 2, February 2019 (2019-02-01), pages 163 - 171
WAGNER ET AL., INTENSIVE CARE MED EXLL, vol. 1, no. 1, 2013, pages 21
WALDMAN ET AL., J YOGA PHYS THER, vol. 4, 2014, pages 1
WANG W ET AL: "ANTIBODY STRUCTURE, INSTABILITY, AND FORMULATION", JOURNAL OF PHARMACEUTICAL SCIENCES, AMERICAN CHEMICAL SOCIETY AND AMERICAN PHARMACEUTICAL ASSOCIATION, US, vol. 96, no. 1, 1 January 2007 (2007-01-01), pages 1 - 26, XP009084505, ISSN: 0022-3549, DOI: 10.1002/JPS.20727 *
WASNER ET AL., INTENSIVE CARE MED EXP, vol. 1, no. 1, 2013, pages 21
WEBER ET AL., JALM, vol. 2, no. 2, 2017, pages 222 - 233

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025056807A1 (en) * 2023-09-15 2025-03-20 Basf Se Stabilized biopolymer composition, their manufacture and use
WO2025133235A1 (en) * 2023-12-22 2025-06-26 Pam Theragnostics Gmbh Adm-gly as marker for early predicting sepsis
WO2026046978A1 (en) * 2024-08-26 2026-03-05 Pam Theragnostics Gmbh Anti-adm antibodies, anti-adm antibody fragment or anti-adm non-ig scaffold for therapy or prevention of immune effector cell therapy side effects

Also Published As

Publication number Publication date
IL315632A (en) 2024-11-01
CA3254142A1 (en) 2023-09-21
AU2023233838A1 (en) 2024-09-26
JP2025509304A (ja) 2025-04-11
MX2024010899A (es) 2024-12-06
EP4493588A1 (en) 2025-01-22
US20250304671A1 (en) 2025-10-02
CN119072492A (zh) 2024-12-03

Similar Documents

Publication Publication Date Title
US20250304671A1 (en) Stable aqueous formulation of an anti-adrenomedullin (adm) antibody or anti-adm antibody fragment
US12012448B2 (en) High concentration anti-C5 antibody formulations
EP4488295A2 (en) Anti-adrenomedullin (adm) binder for use in therapy or prevention of symptoms of illness
KR20220019656A (ko) 경쇄 아밀로이드증 치료 방법
BR112021003093A2 (pt) tratamento de câncer de mama triplo negativo que visa a inibição de tgf-beta
WO2022017468A1 (zh) Pd-l1/lag-3双特异性抗体制剂及其制备方法和用途
JP2023507795A (ja) 第XI/XIa因子抗体の医薬製剤および投薬レジメン
KR20250016223A (ko) 항인슐린 수용체 항체를 위한 제형 및 이의 용도
WO2021052472A1 (zh) 抗pcsk9抗体用于预防或治疗胆固醇相关疾病的方法
KR20240133743A (ko) Al 아밀로이드증 치료 방법
US20230357418A1 (en) Results of empacta: a randomized, double-blind, placebo-controlled, multicenter study to evaluate the efficacy and safety of tocilizumab in hospitalized patients with covid-19 pneumonia
JP2024505923A (ja) Alアミロイドーシスを処置する方法
WO2021207667A1 (en) Compositions and methods for treating lung injury or acute respiratory distress syndrome (ards)
US20260022197A1 (en) Methods of reversing ticagrelor activity
US20260103512A1 (en) Method of treating bone cancers
US20250011411A1 (en) Anti-SOST Antibody Pharmaceutical Composition and Use Thereof
HK40058594A (en) Anti-adrenomedullin (adm) binder for use in therapy or prevention of symptoms of illness
KR20260057482A (ko) 항인슐린 수용체 항체에 대한 고농도 제형 및 그의 용도
US20230250166A1 (en) Anti-adrenomedullin (adm) binder for use in therapy of patients in shock
AU2024343373A1 (en) Antibody formulation
WO2025179012A1 (en) Compositions and uses of tumor activated antibodies targeting egfr and effector cell antigens
WO2025061145A1 (zh) 抗her3抗体药物偶联物治疗肿瘤的用途和方法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23711082

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: MX/A/2024/010899

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2024553456

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 814449

Country of ref document: NZ

Ref document number: AU2023233838

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 315632

Country of ref document: IL

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024018333

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2023233838

Country of ref document: AU

Date of ref document: 20230315

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2023711082

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2023711082

Country of ref document: EP

Effective date: 20241015

WWE Wipo information: entry into national phase

Ref document number: 202380036069.7

Country of ref document: CN

WWE Wipo information: entry into national phase

Ref document number: 11202406184T

Country of ref document: SG

ENP Entry into the national phase

Ref document number: 112024018333

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240905

WWP Wipo information: published in national office

Ref document number: 18844746

Country of ref document: US