WO2023164638A1 - Combination therapy for colorectal carcinoma - Google Patents

Combination therapy for colorectal carcinoma Download PDF

Info

Publication number
WO2023164638A1
WO2023164638A1 PCT/US2023/063254 US2023063254W WO2023164638A1 WO 2023164638 A1 WO2023164638 A1 WO 2023164638A1 US 2023063254 W US2023063254 W US 2023063254W WO 2023164638 A1 WO2023164638 A1 WO 2023164638A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
lag
seq
aspects
set forth
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2023/063254
Other languages
English (en)
French (fr)
Other versions
WO2023164638A8 (en
Inventor
Rebecca Anne MOSS
Paul Andrew BASCIANO
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bristol Myers Squibb Co
Original Assignee
Bristol Myers Squibb Co
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Bristol Myers Squibb Co filed Critical Bristol Myers Squibb Co
Priority to JP2024550304A priority Critical patent/JP2025507694A/ja
Priority to EP23713540.5A priority patent/EP4482866A1/en
Priority to IL314713A priority patent/IL314713A/en
Priority to US18/841,061 priority patent/US20250179174A1/en
Priority to AU2023226078A priority patent/AU2023226078A1/en
Priority to KR1020247031403A priority patent/KR20240153583A/ko
Priority to CA3251366A priority patent/CA3251366A1/en
Priority to MX2024010310A priority patent/MX2024010310A/es
Priority to CN202380023726.4A priority patent/CN118765284A/zh
Publication of WO2023164638A1 publication Critical patent/WO2023164638A1/en
Publication of WO2023164638A8 publication Critical patent/WO2023164638A8/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present disclosure provides a method of treating human subjects afflicted with colorectal carcinoma (CRC) comprising an anti -lymphocyte activation gene-3 (LAG-3) antibody and an anti-programmed death- 1 (PD-1) or anti-programmed death ligand- 1 (PD- L1) antibody.
  • CRC colorectal carcinoma
  • CRC is the second most common form of cancer in women per year and the third most common form of cancer in men. This disease predominately occurs in developed regions with the highest rates being found in Australia/New Zealand and Western Europe and to a lesser extent in Africa and South-Central Asia. Each year, there are about 880,800 deaths from CRC, which is approximately 9% of all cancer deaths, making CRC the second most common cause of cancer death. At initial diagnosis, approximately 25% of patients present with metastatic disease and almost 50% of patients will develop metastasis, which contributes to the high mortality rate reported in CRC patients. [0005] There is a need for improved methods for treating human subjects afflicted with CRC.
  • the present disclosure is directed to a method of treating a human subject afflicted with colorectal carcinoma (CRC), the method comprising administering to the subject: (a) about 480 mg of an anti -LAG-3 antibody, and (b) about 480 mg of an anti-PD-1 or anti- PD-L1 antibody.
  • CRC colorectal carcinoma
  • the anti-LAG-3 antibody is a full-length antibody.
  • the anti-LAG-3 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a dual-affinity re-targeting antibody (DART), a DVD-Ig, or bispecific antibody.
  • the anti-LAG-3 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-LAG-3 antibody is BMS-986016 (relatlimab), IMP731 (H5L7BW), MK4280 (28G-10, favezelimab), REGN3767 (fianlimab), GSK2831781, humanized BAP050, IMP-701 (LAG525, ieramilimab), aLAG3(0414), aLAG3(0416), Sym022, TSR-033, TSR-075, XmAb841 (XmAb22841), MGD013 (tebotelimab), BI754111, FS118, P 13B02-30, AVA-017, 25F7, AGEN1746, RO7247669, INCAGN02385, IBI-110, EMB-02, IBI-323, LBL-007, ABL501, or comprises an antigen binding portion thereof.
  • the anti-LAG-3 antibody comprises CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4.
  • the anti-LAG-3 antibody comprises: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:5; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:6; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 7; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:8; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:9; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 10.
  • the anti-LAG-3 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:3 and 4, respectively.
  • the anti-LAG-3 antibody comprises heavy and light chains comprising the sequences set forth in SEQ ID NOs: 1 and 2, respectively.
  • the anti-LAG-3 antibody comprises heavy and light chains comprising the sequences set forth in SEQ ID NOs:21 and 2, respectively.
  • the anti-PD-1 antibody is a full-length antibody.
  • the anti-PD-1 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-PD-1 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, PDR001 (spartalizumab), MEDI-0680, TSR-042, cemiplimab, JS001, PF-06801591, BGB-A317, BI 754091, INCSHR1210, GLS-010, AM-001, STI-1110, AGEN2034, MGA012, BCD-100, IBI308, SSI-361, or comprises an antigen binding portion thereof.
  • the anti-PD-1 antibody comprises CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14.
  • the anti-PD-1 antibody comprises: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO: 15; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 16; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 17; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO: 18; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 19; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:20. [0021] In some aspects, the anti-PD-1 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 13 and 14, respectively.
  • the anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs: 11 and 12, respectively.
  • the anti-PD-L1 antibody is a full-length antibody.
  • the anti-PD-L1 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-PD-L1 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-PD-L1 antibody is BMS-936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, CK-301, or comprises an antigen binding portion thereof.
  • the anti-LAG-3 antibody is formulated for intravenous administration and/or the anti-PD-1 antibody or anti-PD-L1 antibody is formulated for intravenous administration.
  • the anti-LAG-3 antibody and/or the anti-PD-1 antibody or anti- PD-L1 antibody is administered once about every one week, once about every two weeks, once about every three weeks, once about every four weeks, once about every five weeks, once about every six weeks, once about every seven weeks, once about every eight weeks, once about every nine weeks, once about every ten weeks, once about every eleven weeks, or once about every twelve weeks.
  • the anti-PD-1 antibody or anti-PD-L1 antibody is administered before the anti-LAG-3 antibody.
  • the anti-LAG-3 antibody is administered before the anti-PD-1 antibody or anti-PD-L1 antibody.
  • the anti-LAG-3 antibody and the anti-PD-1 antibody or anti-PD- L1 antibody are administered concurrently.
  • the anti-LAG-3 antibody and the anti-PD-1 antibody or anti-PD- L1 antibody are formulated separately.
  • the anti -LAG-3 antibody and the anti-PD-1 antibody or anti-PD- L1 antibody are formulated together.
  • the present disclosure is directed to a method of treating a human subject afflicted with colorectal carcinoma (CRC), the method comprising administering to the subject: (a) about 480 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14.
  • CRC colorectal carcinoma
  • the anti-LAG-3 antibody is a full-length antibody. In some aspects, the anti-LAG-3 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody. In some aspects, the multispecific antibody is a dual-affinity re-targeting antibody (DART), a DVD-Ig, or bispecific antibody.
  • DART dual-affinity re-targeting antibody
  • DVD-Ig DVD-Ig
  • the anti-LAG-3 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-LAG-3 antibody is BMS-986016 (relatlimab) or comprises an antigen binding portion thereof.
  • the anti-LAG-3 antibody comprises: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:5; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:6; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 7; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:8; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:9; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 10.
  • the anti-LAG-3 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:3 and 4, respectively.
  • the anti-LAG-3 antibody comprises heavy and light chains comprising the sequences set forth in SEQ ID NOs: 1 and 2, respectively. [0041] In some aspects, the anti-LAG-3 antibody comprises heavy and light chains comprising the sequences set forth in SEQ ID NOs:21 and 2, respectively.
  • the anti-PD-1 antibody is a full-length antibody.
  • the anti-PD-1 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-PD-1 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-PD-1 antibody is nivolumab or comprises an antigen binding portion thereof.
  • the anti-PD-1 antibody comprises: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO: 15; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 16; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 17; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO: 18; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 19; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:20.
  • the anti-PD-1 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 13 and 14, respectively.
  • the anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs: 11 and 12, respectively.
  • the anti-LAG-3 antibody and/or the anti-PD-1 antibody is formulated for intravenous administration.
  • the anti-LAG-3 antibody and/or the anti-PD-1 antibody is administered once about every one week, once about every two weeks, once about every three weeks, once about every four weeks, once about every five weeks, once about every six weeks, once about every seven weeks, once about every eight weeks, once about every nine weeks, once about every ten weeks, once about every eleven weeks, or once about every twelve weeks.
  • the anti-PD-1 antibody is administered before the anti -LAG-3 antibody.
  • the anti -LAG-3 antibody is administered before the anti-PD-1 antibody.
  • the anti -LAG-3 antibody and the anti-PD-1 antibody are administered concurrently.
  • the anti -LAG-3 antibody and the anti-PD-1 antibody or anti-PD- L1 antibody are formulated separately.
  • the anti -LAG-3 antibody and the anti-PD-1 antibody or anti-PD- L1 antibody are formulated together
  • the method is a first line therapy.
  • the method is a second line therapy.
  • the method is a third line therapy.
  • the subject has progressed on or is intolerant of a prior therapy.
  • the prior therapy comprises a fluoropyrimidine, oxaliplatin, irinotecan, anti- vascular endothelial growth factor (VEGF) therapy, anti-epidermal growth factor receptor (EGFR) therapy for CRC comprising a Kristen Rat Sarcoma Viral Oncogene Homologue (KRAS) mutation, regorafenib, TAS-102, or any combination thereof.
  • the subject is naive to prior systemic therapy for advanced and/or metastatic CRC.
  • the subject is naive to prior immuno-oncology therapy, the subject is naive to prior immuno-oncology therapy for CRC, or the CRC is naive to prior immuno- oncology therapy.
  • the CRC comprises adenocarcinoma histology.
  • the CRC is unresectable, advanced, and/or metastatic.
  • the CRC is microsatellite stable (MSS) CRC.
  • the MSS CRC comprises high T cell activation and LAG-3 upregulation.
  • the CRC is high microsatellite instable (MSI-H) CRC.
  • the CRC comprises a KRAS mutation.
  • the CRC comprises wild-type KRAS.
  • one or more immune cells in tumor tissue from the subject express LAG-3.
  • at least about 1%, at least about 3%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% of the immune cells express LAG-3.
  • at least about 1% of the immune cells express LAG-3.
  • the immune cells are tumor-infiltrating lymphocytes.
  • the tumor-infiltrating lymphocytes are CD8 + cells.
  • At least about 1%, at least about 3%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% of nucleated cells in tumor tissue from the subject express LAG-3. In some aspects, at least about 1% of the nucleated cells express LAG-3.
  • the tumor tissue comprises a PD-L1 tumor proportion score (TPS) and/or combined positive score (CPS) of at least about 1%, at least about 3%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% of the tumor cells, wherein the TPS is the percentage of tumor cells in the tumor tissue that express PD-L1, and the CPS is the number of tumor and immune cells in the tumor tissue that express PD-L1 as a percentage of the total number of viable tumor cells. In some aspects, the tumor tissue comprises a PD-L1 TPS and/or CPS of at least about 1%.
  • TPS tumor proportion score
  • CPS combined positive score
  • the tumor tissue comprises a PD-L1 TPS and/or CPS of at least about 1%.
  • the CRC is a colon cancer.
  • the CRC is a rectal cancer.
  • any of the above methods further comprise administering to the subject an additional therapeutic agent.
  • the additional therapeutic agent comprises an anti-cancer agent.
  • the anti-cancer agent comprises a tyrosine kinase inhibitor, a checkpoint inhibitor, a checkpoint stimulator, a chemotherapeutic agent, an immunotherapeutic agent, a platinum agent, an alkylating agent, a taxane, a nucleoside analog, an antimetabolite, a topoisomerase inhibitor, an anthracycline, a vinca alkaloid, or any combination thereof.
  • the checkpoint inhibitor comprises a cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) inhibitor, a T cell immunoglobulin and ITIM domain (TIGIT) inhibitor, a T cell immunoglobulin and mucin-domain containing-3 (TIM- 3) inhibitor, a TIM-1 inhibitor, a TIM-4 inhibitor, a B7-H3 inhibitor, a B7-H4 inhibitor, a B and T cell lymphocyte attenuator (BTLA) inhibitor, a V-domain Ig suppressor of T cell activation (VISTA) inhibitor, an indoleamine 2,3-dioxygenase (IDO) inhibitor, a nicotinamide adenine dinucleotide phosphate oxidase isoform 2 (N0X2) inhibitor, a killer- cell immunoglobulin-like receptor (KIR) inhibitor, an adenosine A2a receptor (A2aR) inhibitor, a transforming growth factor beta (TGF- ⁇ ) inhibitor,
  • the checkpoint inhibitor comprises a CTLA-4 inhibitor.
  • the CTLA-4 inhibitor is an anti-CTLA-4 antibody.
  • the anti-CTLA-4 antibody is a full-length antibody.
  • the anti-CTLA-4 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-CTLA-4 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-CTLA-4 antibody is ipilimumab, tremelimumab, MK-1308, AGEN-1884, or comprises an antigen binding portion thereof. DETAILED DESCRIPTION OF THE INVENTION
  • the present disclosure provides a method of treating a human subject afflicted with colorectal carcinoma (CRC), the method comprising administering to the subject an anti- LAG-3 antibody and an anti-PD-1 or anti-PD-L1 antibody.
  • CRC colorectal carcinoma
  • Some aspects of the present disclosure are directed to a method of treating a human subject afflicted with CRC, wherein the method is a first, second, or third line therapy, and/or wherein the subject has progressed on or is intolerant to a prior therapy.
  • Some aspects of the present disclosure are directed to a method of treating a human subject afflicted with unresectable, advanced, and/or metastatic CRC.
  • Some aspects of the present disclosure are directed to a method of treating a human subject afflicted with microsatellite stable CRC. Some aspects of the present disclosure are directed to a method of treating a human subject afflicted with high microsatellite instable CRC. Some aspects of the present disclosure are directed to a method of treating a human subject afflicted with CRC, the method comprising administering to the subject an additional therapeutic agent (e.g., an anti-cancer agent).
  • an additional therapeutic agent e.g., an anti-cancer agent
  • a or “an” entity refers to one or more of that entity; for example, “a nucleotide sequence,” is understood to represent one or more nucleotide sequences.
  • the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
  • the terms "about” or “comprising essentially of refer to a value or composition that is within an acceptable error range for the particular value or composition as determined by one of ordinary skill in the art, which will depend in part on how the value or composition is measured or determined, i. e., the limitations of the measurement system.
  • “about” or “comprising essentially of can mean within 1 or more than 1 standard deviation per the practice in the art.
  • “about” or “comprising essentially of can mean a range of up to 10% or 20% (i.e., ⁇ 10% or ⁇ 20%).
  • about 3 mg can include any number between 2.7 mg and 3.3 mg (for 10%) or between 2.4 mg and 3.6 mg (for 20%).
  • the terms can mean up to an order of magnitude or up to 5-fold of a value.
  • the meaning of "about” or “comprising essentially of should be assumed to be within an acceptable error range for that particular value or composition.
  • any concentration range, percentage range, ratio range or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one-tenth and one-hundredth of an integer), unless otherwise indicated.
  • an "antagonist” shall include, without limitation, any molecule capable of blocking, reducing, or otherwise limiting an interaction or activity of a target molecule (e.g., LAG- 3).
  • the antagonist is an antibody.
  • the antagonist comprises a small molecule.
  • the terms "antagonist” and “inhibitor” are used interchangeably herein.
  • An "antibody” shall include, without limitation, a glycoprotein immunoglobulin which binds specifically to an antigen and comprises at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds.
  • Each H chain comprises a heavy chain variable region (abbreviated herein as Vzz) and a heavy chain constant region (abbreviated herein as CH).
  • the heavy chain constant region comprises three constant domains, C H1 , C H2 and C H3 .
  • Each light chain comprises a light chain variable region (abbreviated herein as V L ) and a light chain constant region (abbreviated herein as C L .
  • the light chain constant region comprises one constant domain, CL.
  • the Vzz and Vz regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDRs complementarity determining regions
  • FR framework regions
  • Each Vzz and Vz comprises three CDRs and four FRs, arranged from amino-terminus to carboxy -terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • a heavy chain can have the C-terminal lysine or not.
  • the amino acids in the variable regions are numbered using the Kabat numbering system and those in the constant regions
  • An immunoglobulin can derive from any of the commonly known isotypes, including but not limited to IgA, secretory IgA, IgG and IgM.
  • IgG subclasses are also well known to those in the art and include but are not limited to human IgGl, IgG2, IgG3 and IgG4.
  • immunotype refers to the antibody class or subclass (e.g., IgM or IgGl) that is encoded by the heavy chain constant region genes.
  • antibody includes, by way of example, both naturally occurring and non-naturally occurring antibodies; monoclonal and polyclonal antibodies; chimeric and humanized antibodies; human or nonhuman antibodies; wholly synthetic antibodies; single chain antibodies; monospecific antibodies; bispecific antibodies; and multi-specific antibodies.
  • a nonhuman antibody can be humanized by recombinant methods to reduce its immunogenicity in humans.
  • the term "antibody” also includes an antigen-binding fragment or an antigen-binding portion of any of the aforementioned immunoglobulins, and includes a monovalent and a divalent fragment or portion, that retains the ability to bind specifically to the antigen bound by the whole immunoglobulin.
  • an "antigen-binding portion” or “antigen-binding fragment” include: (1) a Fab fragment (fragment from papain cleavage) or a similar monovalent fragment consisting of the Vz, Vzz, Lc and Czzz domains; (2) a F(ab')2 fragment (fragment from pepsin cleavage) or a similar bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (3) a Fd fragment consisting of the VH and CHI domains; (4) a Fv fragment consisting of the Vz and Vzz domains of a single arm; (5) a single domain antibody (dAb) fragment (Ward et al., (1989) Nature 341 :544-46), which consists of a Vzz domain; (6) a bi-single domain antibody which consists of two Vzz domains linked by a hinge (dual-affinity re-targeting antibodies (DARTs)); or (7) a dual variable domain immuno
  • the two domains of the Fv fragment, Vz and Vzz are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the Vz and Vzz regions pair to form monovalent molecules (known as single chain Fv (scFv); see, e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
  • scFv single chain Fv
  • an "isolated antibody” refers to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that binds specifically to LAG-3 is substantially free of antibodies that do not bind specifically to LAG-3).
  • An isolated antibody that binds specifically to an antigen can, however, have cross-reactivity to other antigens (e.g., an antibody that binds specifically to LAG-3 having cross-reactivity to LAG-3 molecules from different species).
  • an isolated antibody can be substantially free of other cellular material and/or chemicals.
  • mAb monoclonal antibody
  • a mAb is an example of an isolated antibody.
  • MAbs can be produced by hybridoma, recombinant, transgenic or other techniques known to those skilled in the art.
  • a “human” antibody refers to an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region is also derived from human germline immunoglobulin sequences.
  • the human antibodies of the invention can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
  • the term "human antibody,” as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • a “humanized antibody” refers to an antibody in which some, most or all of the amino acids outside the CDR domains of a non-human antibody are replaced with corresponding amino acids derived from human immunoglobulins. In one aspect of a humanized form of an antibody, some, most or all of the amino acids outside the CDR domains have been replaced with amino acids from human immunoglobulins, whereas some, most or all amino acids within one or more CDR regions are unchanged. Small additions, deletions, insertions, substitutions or modifications of amino acids are permissible as long as they do not abrogate the ability of the antibody to bind to a particular antigen.
  • a "humanized” antibody retains an antigenic specificity similar to that of the original antibody.
  • a "chimeric antibody” refers to an antibody in which the variable regions are derived from one species and the constant regions are derived from another species, such as an antibody in which the variable regions are derived from a mouse antibody and the constant regions are derived from a human antibody.
  • an "anti-antigen” antibody refers to an antibody that binds specifically to the antigen.
  • an anti-LAG-3 antibody binds specifically to LAG-3.
  • LAG-3 refers to Lymphocyte Activation Gene-3.
  • the term “LAG-3” includes variants, isoforms, homologs, orthologs and paralogs.
  • antibodies specific for a human LAG-3 protein can, in certain cases, cross-react with a LAG-3 protein from a species other than human.
  • the antibodies specific for a human LAG-3 protein can be completely specific for the human LAG-3 protein and not exhibit species or other types of cross-reactivity, or can cross-react with LAG-3 from certain other species, but not all other species (e.g., cross-react with monkey LAG-3 but not mouse LAG-3).
  • human LAG-3 refers to human sequence LAG-3, such as the complete amino acid sequence of human LAG-3 having GenBank Accession No. NP 002277.
  • mouse LAG-3 refers to mouse sequence LAG-3, such as the complete amino acid sequence of mouse LAG-3 having GenBank Accession No. NP_032505.
  • LAG-3 is also known in the art as, for example, CD223.
  • the human LAG-3 sequence can differ from human LAG-3 of GenBank Accession No. NP_002277 by having, e.g., conserved mutations or mutations in non-conserved regions, and the LAG-3 has substantially the same biological function as the human LAG-3 of GenBank Accession No. NP 002277.
  • a biological function of human LAG-3 is having an epitope in the extracellular domain of LAG-3 that is specifically bound by an antibody of the instant disclosure or a biological function of human LAG-3 is binding to MHC Class II molecules.
  • a particular human LAG-3 sequence will generally be at least about 90% identical in amino acid sequence to human LAG-3 of GenBank Accession No. NP 002277 and contains amino acid residues that identify the amino acid sequence as being human when compared to LAG-3 amino acid sequences of other species (e.g., murine).
  • a human LAG-3 can be at least about 95%, or even at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical in amino acid sequence to LAG-3 of GenBank Accession No. NP 002277.
  • a human LAG-3 sequence will display no more than 10 amino acid differences from the LAG-3 sequence of GenBank Accession No. NP 002277.
  • the human LAG-3 can display no more than 5, or even no more than 4, 3, 2, or 1 amino acid difference from the LAG-3 sequence of GenBank Accession No. NP_002277.
  • PD-1 Programmed Death-1
  • PD-1 refers to an immunoinhibitory receptor belonging to the CD28 family. PD-1 is expressed predominantly on previously activated T cells in vivo, and binds to two ligands, PD-L1 and PD-L2.
  • the term "PD-1 " as used herein includes human PD-1 (hPD-1), variants, isoforms, and species homologs of hPD-1, and analogs having at least one common epitope with hPD-1. The complete hPD-1 sequence can be found under GenBank Accession No. U64863.
  • PD-1 and PD-1 receptor are used interchangeably herein.
  • CTLA-4 Cytotoxic T-Lymphocyte Antigen-4
  • CTLA-4 is expressed exclusively on T cells in vivo, and binds to two ligands, CD80 and CD86 (also called B7-1 and B7-2, respectively).
  • CTLA-4" as used herein includes human CTLA-4 (hCTLA-4), variants, isoforms, and species homologs of hCTLA-4, and analogs having at least one common epitope with hCTLA-4.
  • the complete hCTLA-4 sequence can be found under GenBank Accession No. AAB59385.
  • P-L1 Programmed Death Ligand- 1
  • PD-L1 is one of two cell surface glycoprotein ligands for PD-1 (the other being PD-L2) that downregulate T cell activation and cytokine secretion upon binding to PD-1.
  • the term "PD-L1” as used herein includes human PD-L1 (hPD-L1), variants, isoforms, and species homologs of hPD-L1, and analogs having at least one common epitope with hPD-L1.
  • the complete hPD-L1 sequence can be found under GenBank Accession No. Q9NZQ7.
  • P-L2 Programmed Death Ligand-2
  • PD-L2 human PD-L2 (hPD-L2), variants, isoforms, and species homologs of hPD-L2, and analogs having at least one common epitope with hPD-L2.
  • the complete hPD-L2 sequence can be found under GenBank Accession No. Q9BQ51.
  • a "patient” as used herein includes any patient who is afflicted with a CRC (e.g., metastatic CRC).
  • CRC e.g., metastatic CRC
  • subject and patient are used interchangeably herein.
  • administering refers to the physical introduction of a therapeutic agent to a subject (e.g., a composition or formulation comprising the therapeutic agent), using any of the various methods and delivery systems known to those skilled in the art.
  • routes of administration include intravenous, intramuscular, subcutaneous, intraperitoneal, spinal or other parenteral routes of administration, for example by injection or infusion.
  • parenteral administration means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrastemal injection and infusion, as well as in vivo electroporation.
  • the formulation is administered via a non-parenteral route, in some aspects, orally.
  • non-parenteral routes include a topical, epidermal or mucosal route of administration, for example, intranasally, vaginally, rectally, sublingually or topically.
  • Administering can also be performed, for example, once, a plurality of times, and/or over one or more extended periods.
  • ECOG PS Electronic Cooperative Oncology Group Performance Status
  • Example definitions for ECOG PS include: "0" for a patient who is fully active and able to carry on all pre-disease performance without restriction; "1” for a patient who is restricted in physically strenuous activity but ambulatory and able to carry out work of a light or sedentary nature; "2” for a patient who is ambulatory and capable of all self-care, up and about more than 50% of waking hours, but unable to carry out any work activities; "3” for a patient who is capable of only limited self-care and is confined to a bed or chair more than 50% of waking hours; and "4" for a patient who is completely disabled, cannot carry on any self-care, and is totally confined to bed or chair.
  • Treatment or “therapy” of a subject refers to any type of intervention or process performed on, or the administration of an active agent to, the subject with the objective of reversing, alleviating, ameliorating, inhibiting, slowing down progression, development, severity or recurrence of a symptom, complication or condition, or biochemical indicia associated with a disease.
  • Response Evaluation Criteria In Solid Tumors RECIST is a measure for treatment efficacy and are established rules that define when tumors respond, stabilize, or progress during treatment.
  • RECIST vl .1 is the current guideline to solid tumor measurement and definitions for objective assessment of change in tumor size for use in adult and pediatric cancer clinical trials.
  • effective treatment refers to treatment producing a beneficial effect, e.g., amelioration of at least one symptom of a disease or disorder.
  • a beneficial effect can take the form of an improvement over baseline, i.e., an improvement over a measurement or observation made prior to initiation of therapy according to the method.
  • a beneficial effect can also take the form of arresting, slowing, retarding, or stabilizing of a deleterious progression of a marker of solid tumor.
  • Effective treatment can refer to alleviation of at least one symptom of a solid tumor.
  • Such effective treatment can, e.g., reduce patient pain, reduce the size and/or number of lesions, can reduce or prevent metastasis of a tumor, and/or can slow tumor growth.
  • an effective amount refers to an amount of an agent that provides the desired biological, therapeutic, and/or prophylactic result. That result can be reduction, amelioration, palliation, lessening, delaying, and/or alleviation of one or more of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system.
  • an effective amount comprises an amount sufficient to cause a tumor to shrink and/or to decrease the growth rate of the tumor (such as to suppress tumor growth) or to delay other unwanted cell proliferation.
  • an effective amount is an amount sufficient to prevent or delay tumor recurrence.
  • An effective amount can be administered in one or more administrations.
  • the effective amount of the drug or composition can: (i) reduce the number of cancer cells; (ii) reduce tumor size; (iii) inhibit, retard, slow to some extent and can stop cancer cell infiltration into peripheral organs; (iv) inhibit (i.e., slow to some extent and can stop tumor metastasis; (v) inhibit tumor growth; (vi) prevent or delay occurrence and/or recurrence of tumor; and/or (vii) relieve to some extent one or more of the symptoms associated with the cancer.
  • an "effective amount” is the amount of anti -LAG-3 antibody alone or the amount of anti-LAG- 3 antibody and the amount an additional therapeutic agent (e.g., anti-PD-1 antibody), in combination, clinically proven to affect a significant decrease in cancer or slowing of progression of cancer, such as an advanced solid tumor.
  • an additional therapeutic agent e.g., anti-PD-1 antibody
  • the terms “fixed dose”, “flat dose” and “flat-fixed dose” are used interchangeably and refer to a dose that is administered to a patient without regard for the weight or body surface area (BSA) of the patient.
  • the fixed or flat dose is therefore not provided as a mg/kg dose, but rather as an absolute amount of the agent (e.g., an amount in pg or mg).
  • fixed dose combination means that two or more different inhibitors as described herein (e.g., an anti- LAG-3 antibody and an anti-PD-1 antibody) in a single composition are present in the composition in particular (fixed) ratios with each other.
  • the fixed dose is based on the weight (e.g., mg) of the inhibitors.
  • the fixed dose is based on the concentration (e.g., mg/ml) of the inhibitors.
  • the ratio is at least about 1 : 1, about 1:2, about 1 :3, about 1:4, about 1 :5, about 1 :6, about 1 :7, about 1 :8, about 1 :9, about 1 : 10, about 1 : 15, about 1 :20, about 1 :30, about 1 :40, about 1 :50, about 1:60, about 1 :70, about 1 :80, about 1 :90, about 1 : 100, about 1 : 120, about 1 : 140, about 1 :160, about 1 : 180, about 1 :200, about 200: 1, about 180: 1, about 160: 1, about 140: 1, about 120: 1, about 100: 1, about 90: 1, about 80: 1, about 70: 1, about 60: 1, about 50: 1, about 40: 1, about 30: 1, about 20: 1, about 15: 1, about 10: 1, about 9: 1, about 8: 1, about 7: 1, about 6: 1, about 5: 1, about 4: 1, about 3: 1, or about 2: 1 mg first inhibitor to mg second inhibitor.
  • the ratio is at least
  • weight based dose means that a dose that is administered to a patient is calculated based on the weight of the patient.
  • Dosing interval means the amount of time that elapses between multiple doses of a formulation disclosed herein being administered to a subject. Dosing interval can thus be indicated as ranges.
  • Dosing frequency refers to the frequency of administering doses of a formulation disclosed herein in a given time. Dosing frequency can be indicated as the number of doses per a given time, e.g., once a week or once in two weeks, etc.
  • the terms "about once a week,” “once about every week,” “once about every two weeks,” or any other similar dosing interval terms as used herein means approximate number, and "about once a week” or “once about every week” can include every seven days ⁇ two days, i.e., every five days to every nine days.
  • the dosing frequency of "once a week” thus can be every five days, every six days, every seven days, every eight days, or every nine days.
  • “Once about every three weeks” can include every 21 days ⁇ 3 days, i.e., every 25 days to every 31 days.
  • a dosing interval of once about every six weeks or once about every twelve weeks means that the first dose can be administered any day in the first week, and then the next dose can be administered any day in the sixth or twelfth week, respectively.
  • a dosing interval of once about every six weeks or once about every twelve weeks means that the first dose is administered on a particular day of the first week (e.g., Monday) and then the next dose is administered on the same day of the sixth or twelfth weeks (i.e., Monday), respectively.
  • An "adverse event” as used herein is any unfavorable and generally unintended or undesirable sign (including an abnormal laboratory finding), symptom, or disease associated with the use of a medical treatment.
  • an adverse event can be associated with activation of the immune system or expansion of immune system cells (e.g., T cells) in response to a treatment.
  • a medical treatment can have one or more associated AEs and each AE can have the same or different level of severity.
  • tumor refers to any mass of tissue that results from excessive cell growth or proliferation, either benign (non-cancerous) or malignant (cancerous), including pre-cancerous lesions.
  • the term "biological sample” as used herein refers to biological material isolated from a subject.
  • the biological sample can contain any biological material suitable for analysis, for example, by sequencing nucleic acids in the tumor (or circulating tumor cells) and identifying a genomic alteration in the sequenced nucleic acids.
  • the biological sample can be any suitable biological tissue or fluid such as, for example, tumor tissue, blood, blood plasma, and serum.
  • the biological sample can be a test tissue sample (e.g., a tissue sample comprising tumor cells and tumor-infiltrating inflammatory cells).
  • the sample is a tumor tissue biopsy, e.g., a formalin-fixed, paraffin-embedded (FFPE) tumor tissue or a fresh-frozen tumor tissue or the like.
  • the biological sample is a liquid biopsy that, in some aspects, comprises one or more of blood, serum, plasma, circulating tumor cells, exoRNA, ctDNA, and cfDNA.
  • an “anti-cancer agent” promotes cancer regression in a subject.
  • a therapeutically effective amount of the agent promotes cancer regression to the point of eliminating the cancer.
  • Promote cancer regression means that administering an effective amount of the anti-cancer agent, alone or in combination with another agent, results in a reduction in tumor growth or size, necrosis of the tumor, a decrease in severity of at least one disease symptom, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
  • the terms “effective” and “effectiveness” with regard to a treatment includes both pharmacological effectiveness and physiological safety. Pharmacological effectiveness refers to the ability of the agent to promote cancer regression in the patient.
  • Physiological safety refers to the level of toxicity, or other adverse physiological effects at the cellular, organ and/or organism level (adverse effects) resulting from administration of the agent.
  • a therapeutically effective amount of an anti-cancer agent can inhibit cell growth or tumor growth by at least about 20%, at least about 40%, at least about 60%, or at least about 80% relative to untreated subjects.
  • tumor regression can be observed and continue for a period of at least about 20 days, more preferably at least about 40 days, or at least about 60 days. Notwithstanding these measurements of therapeutic effectiveness, evaluation of immunotherapeutic drugs must also make allowance for immune-related response patterns.
  • an "immuno-oncology" therapy or an “I-O” or “IO” therapy refers to a therapy that comprises utilizing an immune response to target and treat a tumor in a subject.
  • an 1-0 therapy is a type of anti-cancer therapy.
  • an 1-0 therapy comprises administering an antibody to a subject.
  • an 1-0 therapy comprises administering to a subject an immune cell, e.g., a T cell, e.g., a modified T cell, e.g., a T cell modified to express a chimeric antigen receptor or a particular T cell receptor.
  • the 1-0 therapy comprises administering a therapeutic vaccine to a subject.
  • the 1-0 therapy comprises administering a cytokine or a chemokine to a subject. In some aspects, the 1-0 therapy comprises administering an interleukin to a subject. In some aspects, the 1-0 therapy comprises administering an interferon to a subject. In some aspects, the 1-0 therapy comprises administering a colony stimulating factor to a subject.
  • an "immune response” refers to the action of a cell of the immune system (for example, T lymphocytes, B lymphocytes, natural killer (NK) cells, macrophages, eosinophils, mast cells, dendritic cells and neutrophils) and soluble macromolecules produced by any of these cells or the liver (including antibodies, cytokines, and complement) that results in selective targeting, binding to, damage to, destruction of, and/or elimination from a vertebrate's body of invading pathogens, cells or tissues infected with pathogens, cancerous or other abnormal cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
  • a cell of the immune system for example, T lymphocytes, B lymphocytes, natural killer (NK) cells, macrophages, eosinophils, mast cells, dendritic cells and neutrophils
  • soluble macromolecules produced by any of these cells or the liver including antibodies, cytokines, and complement
  • a "tumor-infiltrating inflammatory cell” or “tumor-associated inflammatory cell” is any type of cell that typically participates in an inflammatory response in a subject and which infiltrates tumor tissue. Such cells include tumor-infiltrating lymphocytes (TILs), macrophages, monocytes, eosinophils, histiocytes and dendritic cells.
  • TILs tumor-infiltrating lymphocytes
  • macrophages macrophages
  • monocytes eosinophils
  • histiocytes histiocytes and dendritic cells.
  • LAG-3 positive refers to tumor tissue (e.g., a test tissue sample) that is scored as expressing LAG-3 based on the proportion (i.e., percentage) of immune cells (e.g., tumor-infiltrating lymphocytes such as CD8+ T cells) expressing LAG-3 (e.g., greater than or equal to 1% expression) or based on the proportion (i.e., percentage) of nucleated cells expressing LAG- 3 (i.e., the immune cells that express LAG-3 as a proportion of total nucleated cells, e.g., greater than or equal to 1% expression).
  • immune cells e.g., tumor-infiltrating lymphocytes such as CD8+ T cells
  • nucleated cells expressing LAG- 3 i.e., the immune cells that express LAG-3 as a proportion of total nucleated cells, e.g., greater than or equal to 1% expression.
  • LAG-3 negative or “LAG-3 expression negative,” refers to tumor tissue (e.g., a test tissue sample) that is not scored as expressing LAG-3 (e.g., less than 1% LAG-3 expression).
  • PD-L1 positive or "PD-L1 expression positive,” relating to cell surface PD-L1 expression, refers to tumor tissue (e.g., a test tissue sample) that is scored as expressing PD-L1 based on the tumor proportion score (TPS), which is the proportion (i.e., percentage) of tumor cells expressing PD-L1 (e.g., greater than or equal to 1% expression), or based on the combined positive score (CPS), which is the number of tumor and immune cells (e.g.
  • TPS tumor proportion score
  • CPS combined positive score
  • tumor cells, lymphocytes, and macrophages in the tumor tissue that express PD- L1 as a percentage of the total number of viable tumor cells (i.e., the number of tumor and immune cells expressing PD-L1 divided by the total number of viable tumor cells and multiplied by 100 (i.e., e.g, greater than or equal to 1%)), or based on the proportion (i.e., percentage) of nucleated cells expressing PD-L1 (i.e., the tumor cells that express PD-L1 as a proportion of total nucleated cells, e.g, greater than or equal to 1% expression).
  • PD-L1 negative or "PD-L1 expression negative” refers to tumor tissue (e.g., a test tissue sample) that is not scored as expressing PD-L1 (e.g., less than 1% expression).
  • CRC colorectal carcinoma
  • the methods comprising administering to the subject an anti-LAG-3 antibody and an anti-PD-1 or anti-PD-L1 antibody.
  • the CRC is a colon cancer, a rectal cancer, or a combination thereof.
  • Colon cancer presents in five stages: Stage 0 (Carcinoma in situ), Stage I, Stage II, Stage III and Stage IV.
  • Standard of care treatments for colon cancer include: 1) surgery, including a local excision, resection of the colon with anastomosis, or resection of the colon with colostomy; 2) radiofrequency ablation; 3) cryosurgery; 4) chemotherapy; 5) radiation therapy; and 6) targeted therapies, including monoclonal antibodies and angiogenesis inhibitors.
  • a method of the disclosure further comprises administering a standard of care therapy for the treatment of colon cancer.
  • Rectal cancer presents in five stages: Stage 0 (Carcinoma in situ), Stage I, Stage II, Stage III and Stage IV.
  • Standard of care treatments for rectal cancer include: 1) Surgery, including polypectomy, local excision, resection, radiofrequency ablation, cryosurgery, and pelvic exenteration; 2) radiation therapy; 3) chemotherapy; and 4) targeted therapy, including monoclonal antibody therapy.
  • a method of the disclosure further comprises administering a standard of care therapy for the treatment of rectal cancer.
  • the method is a first line (IL) therapy.
  • the method is a second line (2L) therapy.
  • the method is a third line (3L) therapy.
  • the subject has progressed on or is intolerant to a prior therapy
  • a standard of care therapy including a standard of care IL or 2L therapy.
  • the predominant first-line treatment options for patients with metastatic CRC are 5 -fluorouracil (5-FU) containing regimens in combination with either oxaliplatin (FOLFOX) or irinotecan (FOLFIRI) with a biologic agent such as bevacizumab.
  • FOLFOX oxaliplatin
  • FOLFIRI irinotecan
  • EGFR epidermal growth factor receptor
  • cetuximab and panitumumab are also options if Kirsten Rat Sarcoma Viral Oncogene Homologue (KRAS) status is non-mutated.
  • FOLFIRI has been used in second-line therapy for those patients who have had first- line therapy with FOLFOX or another 5-FU-containing therapy.
  • Bevacizumab, ramucirumab, and ziv-afilbercept have also been used for second-line treatment in combination with chemotherapy.
  • Regorafenib also known as STIVARGA®
  • an oral multi-kinase inhibitor also known as TAS-102
  • TAS-102 also known as LONSURF®
  • an oral combination therapy of trifluridine and tipiracil hydrochloride each have been used as a later-line therapy in patients who have been previously treated with fluoropyrimidine-, oxaliplatin-, and irinotecan-based chemotherapies, anti-vascular endothelial growth factor (VEGF) therapy, and, if KRAS WT, anti-epidermal growth factor receptor (EGFR) therapy.
  • VEGF anti-vascular endothelial growth factor
  • EGFR anti-epidermal growth factor receptor
  • the prior therapy comprises a fluoropyrimidine, oxaliplatin, irinotecan, anti-vascular endothelial growth factor (VEGF) therapy, anti-epidermal growth factor receptor (EGFR) therapy (e.g., cetuximab or panitumumab) for CRC comprising a Kristen Rat Sarcoma Viral Oncogene Homologue (KRAS) mutation, regorafenib, TAS- 102, or any combination thereof.
  • VEGF vascular endothelial growth factor
  • EGFR anti-epidermal growth factor receptor
  • KRAS Kernuximab or panitumumab
  • the subject has received one, two, three, four, or more prior therapies.
  • the subject is naive to prior systemic therapy for advanced and/or metastatic CRC.
  • the subject is naive to prior immuno-oncology (I-O) therapy.
  • the subject has never received 1-0 therapy, has received 1-0 therapy for a cancer other than CRC, or has received 1-0 therapy for a previous CRC but not a current CRC.
  • the subject is naive to prior 1-0 therapy, the subject is naive to prior 1-0 therapy for CRC, or the CRC is naive to prior 1-0 therapy.
  • the prior 1-0 therapy is an antibody.
  • the antibody binds to a checkpoint inhibitor.
  • the prior 1-0 therapy is an anti-PD-1 antibody and/or the combination of an anti-PD-1 antibody and an anti-CTLA-4 antibody.
  • a method of the disclosure increases duration of progression-free survival (PFS), objective response rate (ORR), overall survival (OS), or any combination thereof as compared to a standard of care therapy and/or a prior therapy such as disclosed herein.
  • PFS progression-free survival
  • ORR objective response rate
  • OS overall survival
  • a method of the disclosure reduces the size of a tumor, inhibits growth of a tumor, eliminates a tumor from the subject, prevents relapse of CRC, induces remission of CRC, provides a complete response or partial response, or any combination thereof.
  • the CRC comprises adenocarcinoma histology.
  • the CRC is unresectable, advanced, and/or metastatic.
  • MSI-H microsatellite instability
  • dMMR DNA mismatch repair
  • the presence of MSI-H represents phenotypic evidence of dMMR.
  • the genetic basis for MSI-H CRC is an inherited germline alteration in any one or more of the five human MMR genes: MLH1, MSH2, MSH6, PMS1, or PMS2.
  • MSS microsatellite stability
  • pMMR proficient mismatch repair
  • MSI-H is associated with increases in immune infiltration and expression of immune checkpoint regulators
  • MSS is typically associated with an immunosuppressive tumor microenvironment that blunts activation of anti-tumor immune responses.
  • a subset of MSS CRC patients displays a MSI-like tumor immune contexture, characterized by high T cell activation and LAG-3 upregulation.
  • MSI-H mCRC patients with MSI-H mCRC are less likely to benefit from conventional chemotherapy than patients with MSS mCRC. But, studies have confirmed that MSS identification can be prognostic in that MSS CRC has a worse prognosis than MSI-H CRC.
  • IHC MMR testing consists of staining of tumor tissue for loss of expression of four mismatch repair proteins known to be mutated in Lynch syndrome: MLH1, MSH2, MSH6, and PMS2. If at least one of these is not normally expressed, then the testing indicates the dMMR (MSI-H) phenotype.
  • MSI-H Polymerase chain reaction
  • MSI-Low The clinicopathologic and most molecular characteristics in MSLLow tumors do not seem to differ from MSS tumors. Therefore, unless otherwise noted, MSS CRC in a method of the disclosure includes MSI-Low CRC.
  • the CRC is MSS CRC.
  • the MSS CRC comprises high T cell activation and LAG-3 upregulation. [0152] In some aspects, the MSS CRC does not include MSI-Low CRC (i.e., the MSS CRC excludes MSI-Low CRC).
  • the CRC comprises normal expression of MMR proteins (e.g., as compared to a reference expressing the corresponding wildtype MMR proteins).
  • the MMR proteins are MLH1, MSH2, MSH6, and PMS2.
  • the MMR proteins are MLH1, MSH2, MSH6, PMS1, and PMS2.
  • the CRC is MSI-H CRC.
  • the CRC comprises reduced expression of a MMR protein (e.g., as compared to a reference expressing the corresponding wildtype MMR protein).
  • the MMR protein is MLH1, MSH2, MSH6, PMS2, or a combination thereof.
  • the MMR protein is MLH1, MSH2, MSH6, PMS1, PMS2, or a combination thereof.
  • the CRC comprises a KRAS mutation, a NRAS mutation, a B- rapidly accelerated fibrosarcoma proto-oncogene (BRAF) mutation, or a combination thereof.
  • the CRC comprises wild-type KRAS, wild-type NRAS, wild-type BRAF, or a combination thereof.
  • the methods of the disclosure comprise administering to the subject an anti-LAG-3 antibody and an anti-PD-1 or anti-PD-L1 antibody based on the subject's performance status.
  • Performance status can be indicated by any one or more systems in the art.
  • the system is Eastern Cooperative Oncology Group Performance Status (ECOG PS).
  • ECOG PS Eastern Cooperative Oncology Group Performance Status
  • the subject has an ECOG PS of 0 or 1.
  • the subject has an ECOG PS of 0, 1, or 2.
  • the subject has an ECOG PS of 0, 1, 2, or 3.
  • the subject has an ECOG PS of 0, 1, 2, 3, or 4.
  • one or more immune cells in tumor tissue from the subject express LAG-3 (i.e., tumor tissue from the subject is LAG-3 positive) and/or one or more cells in tumor tissue from the subject express PD-L1 i.e., tumor tissue from the subject is PD-L1 positive). In some aspects, one or more immune cells in tumor tissue from the subject express LAG-3.
  • At least about 1%, at least about 2%, at least about 3%, at least about 4%, at least about 5%, at least about 7%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% of the immune cells express LAG-3.
  • at least about 1% of the immune cells express LAG-3.
  • greater than about 1% of the immune cells express LAG-3.
  • at least about 5% of the immune cells express LAG-3.
  • the immune cells are tumor-infiltrating lymphocytes.
  • the tumor-infiltrating lymphocytes are CD8 + cells.
  • the tumor tissue from the subject has a PD-L1 tumor proportion score (TPS) as defined herein and/or a combined positive score (CPS) as defined herein of at least about 1%, at least about 2%, at least about 3%, at least about 4%, at least about 5%, at least about 7%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100%.
  • TPS tumor proportion score
  • CPS combined positive score
  • the tumor tissue from the subject has a PD-L1 TPS and/or CPS of at least about 1%. In some aspects, the tumor tissue from the subject has a PD-L1 TPS and/or CPS of greater than about 1%. In some aspects, the tumor tissue from the subject has a PD-L1 TPS and/or CPS of at least about 5%.
  • At least about 1% of the nucleated cells in tumor tissue from the subject express PD-L1. In some aspects, greater than about 1% of the nucleated cells in tumor tissue from the subject express PD-L1. In some aspects, at least about 5% of the nucleated cells in tumor tissue from the subject express PD-L1. In some aspects, any of the values of "at least about X%" is ">X%").
  • one or more immune cells in tumor tissue from the patient does not express LAG-3 (i.e., tumor tissue from the patient is LAG-3 negative).
  • the tumor tissue is LAG-3 negative when less than about 1% of the immune cells express LAG-3.
  • the tumor tissue is LAG-3 negative when less than about 1% of nucleated cells express LAG-3.
  • one or more cells in tumor tissue from the patient does not express PD-L1 (i.e., tumor tissue from the patient is PD-L1 negative).
  • the tumor tissue is PD-L1 negative when it has a TPS and/or CPS of less than about 1%.
  • the tumor tissue is PD-L1 negative when less than about 1% of nucleated cells express PD-L1.
  • LAG-3 and/or PD-L1 expression in the subject's tumor tissue is determined from a test tissue sample.
  • a test tissue sample includes, but is not limited to, any clinically relevant tissue sample, such as a tumor biopsy, a core biopsy, an incisional biopsy, an excisional biopsy, a surgical specimen, a fine needle aspirate, or a sample of bodily fluid, such as blood, plasma, serum, lymph, ascites fluid, cystic fluid, or urine.
  • the test tissue sample is from a primary tumor.
  • the test tissue sample is from a metastasis.
  • test tissue samples are from multiple time points, for example, before treatment, during treatment, and/or after treatment.
  • test tissue samples are from different locations in the subject, for example, from a primary tumor and from a metastasis.
  • the test tissue sample is a paraffin-embedded fixed tissue sample.
  • the test tissue sample is a formalin-fixed paraffin embedded (FFPE) tissue sample.
  • the test tissue sample is a fresh tissue (e.g., tumor) sample.
  • the test tissue sample is a frozen tissue sample.
  • the test tissue sample is a fresh frozen (FF) tissue (e.g., tumor) sample.
  • the test tissue sample is a cell isolated from a fluid.
  • the test tissue sample comprises circulating tumor cells (CTCs).
  • the test tissue sample comprises tumor- infiltrating lymphocytes (TILs).
  • the test tissue sample comprises tumor cells and tumor-infiltrating lymphocytes (TILs). In some aspects, the test tissue sample comprises circulating lymphocytes. In some aspects, the test tissue sample is an archival tissue sample. In some aspects, the test tissue sample is an archival tissue sample with known diagnosis, treatment, and/or outcome history. In some aspects, the sample is a block of tissue. In some aspects, the test tissue sample is dispersed cells. In some aspects, the sample size is from about 1 cell to about 1 x 10 6 cells or more. In some aspects, the sample size is about 1 cell to about 1 x 10 5 cells. In some aspects, the sample size is about 1 cell to about 10,000 cells. In some aspects, the sample size is about 1 cell to about 1,000 cells. In some aspects, the sample size is about 1 cells to about 100 cells. In some aspects, the sample size is about 1 cell to about 10 cells. In some aspects, the sample size is a single cell.
  • LAG-3 and/or PD-L1 expression is assessed by performing an assay to detect the presence of LAG-3 and/or PD-L1 RNA, respectively.
  • the presence of LAG-3 and/or PD-L1 RNA is detected by RT-PCR, in situ hybridization or RNase protection.
  • LAG-3 and/or PD-L1 expression is assessed by performing an assay to detect the presence of LAG-3 and/or PD-L1 polypeptide, respectively.
  • the presence of LAG-3 and/or PD-L1 polypeptide is detected by immunohistochemistry (IHC), enzyme-linked immunosorbent assay (ELISA), in vivo imaging, or flow cytometry.
  • the subject has progressed on or is intolerant to a prior therapy, and the CRC is MSS mCRC comprising adenocarcinoma histology and wild-type KRAS, and tumor tissue from the subject comprises a PD-L1 TPS and/or CPS of at least about 1%.
  • the CRC is MSS mCRC comprising adenocarcinoma histology and a KRAS mutation, and tumor tissue from the subject comprises a PD-L1 TPS and/or CPS of at least about 1%.
  • the subject has progressed on or is intolerant to a prior therapy
  • the CRC is MSS mCRC comprising adenocarcinoma histology and wild-type KRAS
  • tumor tissue from the subject comprises a PD-L1 TPS and/or CPS of less than about 1%.
  • the subject has progressed on or is intolerant to a prior therapy
  • the CRC is MSS mCRC comprising adenocarcinoma histology and a KRAS mutation
  • tumor tissue from the subject comprises a PD-L1 TPS and/or CPS of less than about 1%.
  • An exemplary LAG-3 antibody useful in the present disclosure is 25F7 (described in U.S. Publ. No. 2011/0150892).
  • An additional exemplary LAG-3 antibody useful in the present disclosure is BMS-986016 (relatlimab).
  • an anti -LAG-3 antibody useful in the present disclosure cross-competes with 25F7 or BMS-986016.
  • an anti-LAG-3 antibody useful in the present disclosure binds to the same epitope as 25F7 or BMS-986016.
  • an anti-LAG-3 antibody comprises six CDRs of 25F7 or BMS-986016.
  • These and other anti-LAG-3 antibodies useful in the claimed invention can be found in, for example: US 10,188,730, WO 2016/028672, WO 2017/106129, WO2017/062888, W02009/044273,
  • Anti-LAG-3 antibodies that can be used in the methods of the disclosure also include isolated antibodies that bind specifically to human LAG-3 and cross-compete for binding to human LAG-3 with any anti-LAG-3 antibody disclosed herein, e.g., relatlimab.
  • the anti-LAG-3 antibody binds the same epitope as any of the anti-LAG- 3 antibodies described herein, e.g., relatlimab.
  • the antibodies that cross-compete for binding to human LAG-3 with, or bind to the same epitope region as, any anti-LAG-3 antibody disclosed herein, e.g., relatlimab are monoclonal antibodies.
  • these cross- competing antibodies are chimeric antibodies, engineered antibodies, or humanized or human antibodies.
  • Such chimeric, engineered, humanized or human monoclonal antibodies can be prepared and isolated by methods well known in the art.
  • Anti-LAG-3 antibodies that can be used in the methods of the disclosure also include antigen-binding portions of any of the above full-length antibodies. It has been amply demonstrated that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
  • the anti-LAG-3 antibody is a full-length antibody.
  • the anti-LAG-3 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a dual- affinity re-targeting antibody (DART), a DVD-Ig, or bispecific antibody.
  • the anti-LAG-3 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-LAG-3 antibody is BMS-986016 (relatlimab), IMP731 (H5L7BW), MK4280 (28G-10, favezelimab), REGN3767 (fianlimab), GSK2831781, humanized BAP050, IMP-701 (LAG525, ieramilimab), aLAG3(0414), aLAG3(0416), Sym022, TSR-033, TSR-075, XmAb841 (XmAb22841), MGD013 (tebotelimab), BI754111, FS118, P 13B02-30, AVA-017, 25F7, AGEN1746, RO7247669, INCAGN02385, IBL110, EMB-02, IBI-323, LBL-007, ABL501, or comprises an antigen binding portion thereof.
  • the anti-LAG-3 antibody is relatlimab.
  • relatlimab is administered intravenously at about 80 mg, about 120 mg, about 240 mg, about 360 mg, about 480 mg, or about 960 mg once about every 2, 3, or 4 weeks.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:5; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:6; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:7; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:8; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:9; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 10.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:3 and 4, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs: l and 2, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:21 and 2, respectively.
  • the anti -LAG-3 antibody is MGD013 (tebotelimab), which is a bispecific PD-1 x LAG-3 DART.
  • tebotelimab is administered intravenously at about 300 mg or about 600 mg once about every 2, 3, or 4 weeks.
  • tebotelimab is administered intravenously at about 300 mg once about every 2 weeks.
  • tebotelimab is administered intravenously at about 600 mg once about every 3 weeks.
  • the anti-LAG-3 antibody is REGN3767 (fianlimab).
  • fianlimab is administered intravenously at about 1 mg/kg, about 3 mg/kg, about 10 mg/kg, or about 20 mg/kg once about every 3 weeks. In some aspects, fianlimab is administered intravenously at about 1600 mg once about every 3 weeks.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:25, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:26.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:27; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:28; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:29; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:30; (e) a light chain variable region CDR2 comprising the sequence DAS; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:32.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:25 and 26, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:23 and 24, respectively.
  • the anti-LAG-3 antibody is LAG525 (ieramilimab). In some aspects, ieramilimab is administered intravenously at about 300 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, or about 1300 mg once about every 2, 3, or 4 weeks.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:47, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:49.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:48, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:50.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:51; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:52; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 53; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:54; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:55; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:56.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:47 and 49, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:48 and 50, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:43 and 45, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:44 and 46, respectively.
  • the anti-LAG-3 antibody is MK4280 (favezelimab).
  • bootszelimab is administered intravenously at about 7 mg, about 21 mg, about 70 mg, about 210 mg, about 700 mg, or about 800 mg once about every 3 weeks or once about every 6 weeks.
  • favezelimab is administered intravenously at about 200 mg once about every 3 weeks.
  • favezelimab is administered intravenously at about 800 mg once about every 6 weeks.
  • favezelimab is administered intravenously at about 800 mg on Day 1, then once about every 3 weeks.
  • favezelimab is administered for up to 35 cycles.
  • favezelimab is administered intravenously at about 800 mg for about 30 minutes on Day 1 of a three-week cycle for up to 35 cycles.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 69, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:70.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:71; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:72; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:73; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:74; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:75; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:76.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:69 and 70, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:67 and 68, respectively.
  • an anti-LAG-3 antibody is used to determine LAG-3 expression.
  • an anti-LAG-3 antibody is selected for its ability to bind to LAG-3 in formalin-fixed, paraffin-embedded (FFPE) tissue specimens.
  • FFPE paraffin-embedded
  • an anti- LAG-3 antibody is capable of binding to LAG-3 in frozen tissues.
  • an anti- LAG-3 antibody is capable of distinguishing membrane bound, cytoplasmic, and/or soluble forms of LAG-3.
  • an anti-LAG-3 antibody useful for assaying, detecting, and/or quantifying LAG-3 expression in accordance with the methods disclosed herein is the 17B4 mouse IgGl anti-human LAG-3 monoclonal antibody. See, e.g., Matsuzaki, J et al., PNAS (2010); 107:7875.
  • an anti-LAG-3 antibody as disclosed herein is formulated for intravenous administration.
  • an anti-LAG-3 antibody as disclosed herein is administered at a flat dose.
  • an anti-LAG-3 antibody as disclosed herein is administered at from at least about 0.25 mg to about 2000 mg, about 0.25 mg to about 1600 mg, about 0.25 mg to about 1200 mg, about 0.25 mg to about 800 mg, about 0.25 mg to about 400 mg, about 0.25 mg to about 100 mg, about 0.25 mg to about 50 mg, about 0.25 mg to about 40 mg, about 0.25 mg to about 30 mg, about 0.25 mg to about 20 mg, about 20 mg to about 2000 mg, about 20 mg to about 1600 mg, about 20 mg to about 1200 mg, about 20 mg to about 800 mg, about 20 mg to about 400 mg, about 20 mg to about 100 mg, about 100 mg to about 2000 mg, about 100 mg to about 1800 mg, about 100 mg to about 1600 mg, about 100 mg to about 1400 mg, about 100 mg to about 1200 mg, about 100 mg to about 1000 mg, about 100 mg to about 800 mg, about 100 mg to about 600 mg, about 100 mg to about 400 mg, about 400 mg to about 2000 mg, about 400 mg to about 1800 mg,
  • an anti-LAG-3 antibody as disclosed herein is administered at about 0.25 mg, about 0.5 mg, about 0.75 mg, about 1 mg, about 1.25 mg, about 1.5 mg, about 1.75 mg, about 2 mg, 2.25 mg, about 2.5 mg, about 2.75 mg, about 3 mg, about 3.25 mg, about 3.5 mg, about 3.75 mg, about 4 mg, about 4.25 mg, about 4.5 mg, about 4.75 mg, about 5 mg, about 5.25 mg, about 5.5 mg, about 5.75 mg, about 6 mg, about 6.25 mg, about 6.5 mg, about 6.75 mg, about 7 mg, about 7.25 mg, about 7.5 mg, about 7.75 mg, about 8 mg, about 8.25 mg, about 8.5 mg, about 8.75 mg, about 9 mg, about 9.25 mg, about 9.5 mg, about 9.75 mg, about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 110 mg, about 120 mg, about 130
  • an anti-LAG-3 antibody as disclosed herein is administered at a weight-based dose.
  • an anti-LAG-3 antibody as disclosed herein is administered at from at least about 0.003 mg/kg to about 25 mg/kg, about 0.003 mg/kg to about 20 mg/kg, about 0.003 mg/kg to about 15 mg/kg, about 0.003 mg/kg to about 10 mg/kg, about 0.003 mg/kg to about 5 mg/kg, about 0.003 mg/kg to about 1 mg/kg, about 0.003 mg/kg to about 0.9 mg/kg, about 0.003 mg/kg to about 0.8 mg/kg, about 0.003 mg/kg to about 0.7 mg/kg, about 0.003 mg/kg to about 0.6 mg/kg, about 0.003 mg/kg to about 0.5 mg/kg, about 0.003 mg/kg to about 0.4 mg/kg, about 0.003 mg/kg to about 0.3 mg/kg, about 0.003 mg/kg to about 0.2 mg/kg, about 0.003 mg/kg to about 0.1 mg/kg, about 0.1 mg/kg to about 25 mg/
  • an anti-LAG-3 antibody as disclosed herein is administered at about 0.003 mg/kg, about 0.004 mg/kg, about 0.005 mg/kg, about 0.006 mg/kg, about 0.007 mg/kg, about 0.008 mg/kg, about 0.009 mg/kg, about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1.0 mg/kg, about 2.0 mg/kg, about 3.0 mg/kg, about 4.0 mg/kg, about 5.0 mg/kg, about 6.0 mg/kg, about 7.0 mg/kg, about 8.0
  • the dose of an anti-LAG-3 antibody as disclosed herein is administered in a constant amount.
  • the dose of an anti-LAG-3 antibody as disclosed herein is administered in a varying amount.
  • the maintenance (or follow-on) dose of an anti-LAG-3 antibody as disclosed herein can be higher or the same as the loading dose which is first administered.
  • the maintenance dose of an anti-LAG-3 antibody as disclosed herein can be lower or the same as the loading dose.
  • an anti-LAG-3 antibody as disclosed herein is administered once about every one week, once about every two weeks, once about every three weeks, once about every four weeks, once about every five weeks, once about every six weeks, once about every seven weeks, once about every eight weeks, once about every nine weeks, once about every ten weeks, once about every eleven weeks, or once about every twelve weeks.
  • Anti-PD-1 antibodies that are known in the art can be used in the methods of the disclosure.
  • Various human monoclonal antibodies that bind specifically to PD-1 with high affinity have been disclosed in U.S. Patent No. 8,008,449.
  • Anti-PD-1 antibodies that can be used in the methods of the disclosure include nivolumab (also known as OPDIVO®, 5C4, BMS-936558, MDX-1106, and ONO-4538), pembrolizumab (Merck; also known as KEYTRUDA®, lambrolizumab, and MK3475; see WO 2008/156712), PDR001 (Novartis; also known as spartalizumab; see WO 2015/112900 and U.S. Patent No.
  • nivolumab also known as OPDIVO®, 5C4, BMS-936558, MDX-1106, and ONO-4538
  • pembrolizumab Merck; also known as KEYTRUDA®, lambrolizumab, and MK3475; see WO 2008/156712
  • PDR001 Novartis; also known as spartalizumab; see WO 2015/112900 and U.S. Patent No.
  • MEDI-0680 (AstraZeneca; also known as AMP-514; see WO 2012/145493), TSR-042 (Tesaro Biopharmaceutical; also known as ANB011 or dostarlimab; see WO 2014/179664), cemiplimab (Regeneron; also known as LIBTAYO® or REGN2810; see WO 2015/112800 and U.S. Patent No. 9,987,500), JS001 (TAIZHOU JUNSHI PHARMA; also known as toripalimab; see Si-Yang Liu et al., J. Hematol. Oncol.
  • PF-06801591 Pfizer; also known as sasanlimab; US 2016/0159905), BGB-A317 (Beigene; also known as tislelizumab; see WO 2015/35606 and US 2015/0079109), BI 754091 (Boehringer Ingelheim; see Zettl M etal., Cancer. Res. (2016);78(13 Suppl): Abstract 4558), INCSHR1210 (Jiangsu Hengrui Medicine; also known as SHR-1210 or camrelizumab; see WO 2015/085847; Si-Yang Liu et al., J. Hematol. Oncol.
  • Anti-PD-1 antibodies that can be used in the methods of the disclosure also include isolated antibodies that bind specifically to human PD-1 and cross-compete for binding to human PD-1 with any anti-PD-1 antibody disclosed herein, e.g., nivolumab (see, e.g., U.S. Patent No. 8,008,449 and 8,779,105; WO 2013/173223).
  • the anti-PD-1 antibody binds the same epitope as any of the anti-PD-1 antibodies described herein, e.g., nivolumab.
  • the antibodies that cross-compete for binding to human PD-1 with, or bind to the same epitope region as, any anti-PD-1 antibody disclosed herein, e.g., nivolumab are monoclonal antibodies.
  • these cross- competing antibodies are chimeric antibodies, engineered antibodies, or humanized or human antibodies.
  • Such chimeric, engineered, humanized or human monoclonal antibodies can be prepared and isolated by methods well known in the art.
  • Anti-PD-1 antibodies that can be used in the methods of the disclosure also include antigen-binding portions of any of the above full-length antibodies.
  • Anti-PD-1 antibodies that can be used in the methods of the disclosure are antibodies that bind to PD-1 with high specificity and affinity, block the binding of PD-L1 and or PD-L2, and inhibit the immunosuppressive effect of the PD-1 signaling pathway.
  • an anti-PD-1 "antibody” includes an antigen-binding portion or fragment that binds to the PD-1 receptor and exhibits the functional properties similar to those of whole antibodies in inhibiting ligand binding and up-regulating the immune system.
  • the anti-PD-1 antibody or antigen- binding portion thereof cross-competes with nivolumab for binding to human PD-1.
  • the anti-PD-1 antibody is a full-length antibody. In some aspects, the anti-PD-1 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody. In some aspects, the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-PD-1 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, PDR001 (spartalizumab), MEDI-0680, TSR-042, cemiplimab, JS001, PF-06801591, BGB-A317, BI 754091, INCSHR1210, GLS-010, AM-001, STI-1110, AGEN2034, MGA012, BCD-100, IBI308, SSI-361, or comprises an antigen binding portion thereof.
  • the anti-PD-1 antibody is nivolumab.
  • Nivolumab is a fully human IgG4 (S228P) PD-1 immune checkpoint inhibitor antibody that selectively prevents interaction with PD-1 ligands (PD-L1 and PD-L2), thereby blocking the down-regulation of antitumor T-cell functions (U.S. Patent No. 8,008,449; Wang et al., 2014 Cancer Immunol Res. 2(9/846-56).
  • nivolumab is administered at about 240 mg, about 360 mg, or about 480 mg once about every 2, 3, or 4 weeks.
  • nivolumab is administered intravenously at about 240 mg for about 30 minutes on Day 1 of a two-week cycle.
  • nivolumab is administered intravenously at about 480 mg for about 30 minutes on Day 1 of a four- week cycle.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:15; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 16; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 17; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO: 18; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 19; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:20.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 13 and 14, respectively.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs: l l and 12, respectively.
  • the methods of the disclosure comprise a combination of relatlimab and nivolumab.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4; and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:5, SEQ ID NO:6, and SEQ ID NO:7, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:8, SEQ ID NO:9, and SEQ ID NO: 10, respectively, and (b) an anti- PD-1 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO: 18, SEQ ID NO: 19, and SEQ ID NO:20, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:3 and 4, respectively, and (b) an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 13 and 14, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs: 1 and 2, respectively, and (b) an anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs: 11 and 12, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:21 and 2, respectively, and (b) an anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs: 11 and 12, respectively.
  • the anti-PD-1 antibody is pembrolizumab.
  • Pembrolizumab is a humanized monoclonal IgG4 (S228P) antibody directed against human cell surface receptor PD-1.
  • S228P humanized monoclonal IgG4
  • Pembrolizumab is described, for example, in U.S. Patent Nos. 8,354,509 and 8,900,587.
  • pembrolizumab is administered at about 200 mg once about every 2 weeks. In some aspects, pembrolizumab is administered at about 200 mg once about every 3 weeks. In some aspects, pembrolizumab is administered at about 400 mg once about every 4 weeks. In some aspects, pembrolizumab is administered at about 400 mg once about every 6 weeks. In some aspects, pembrolizumab is administered at about 300 mg once about every 4-5 weeks.
  • pembrolizumab is administered intravenously at about 200 mg on Day 1, then once about every 3 weeks. In some aspects, pembrolizumab is administered for up to 35 cycles. In some aspects, pembrolizumab is administered intravenously at about 200 mg for about 30 minutes on Day 1 of a three-week cycle for up to 35 cycles.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:79, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:80.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:81; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:82; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 83; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:84; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:85; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:86.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:79 and 80, respectively.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:77 and 78, respectively.
  • the methods of the disclosure comprise a combination of favezelimab and pembrolizumab.
  • 200 mg or 700 mg of favezelimab and 200 mg of pembrolizumab are administered intravenously on Day 1, then once about every 3 weeks.
  • the combination of favezelimab and pembrolizumab is administered for up to 35 cycles.
  • 200 mg or 700 mg of favezelimab and 200 mg of pembrolizumab are administered intravenously for about 30 minutes on Day 1 of a three-week cycle for up to 35 cycles.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 69, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:70; and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:79, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:80.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:71, SEQ ID NO: 72, and SEQ ID NO: 73, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:74, SEQ ID NO:75, and SEQ ID NO:76, respectively, and (b) an anti- PD-1 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:81, SEQ ID NO:82, and SEQ ID NO:83, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:84, SEQ ID NO:85, and SEQ ID NO:86, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:69 and 70, respectively, and (b) an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:79 and 80, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:67 and 68, respectively, and (b) an anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs:77 and 78, respectively.
  • the anti-PD-1 antibody is cemiplimab (REGN2810).
  • Cemiplimab is described, for example, in WO 2015/112800 and U.S. Patent No. 9,987,500.
  • cemiplimab is administered intravenously at about 3 mg/kg or about 350 mg once about every 3 weeks.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:35, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:36.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:37; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:38; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:39; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:40; (e) a light chain variable region CDR2 comprising the sequence AAS; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:42.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:35 and 36, respectively.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:33 and 34, respectively.
  • the methods of the disclosure comprise a combination of fianlimab and cemiplimab.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:25, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:26; and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:35, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:36.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:27, SEQ ID NO:28, and SEQ ID NO:29, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:30, the sequence DAS, and the sequence set forth in SEQ ID NO:32, respectively, and (b) an anti-PD-1 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:37, SEQ ID NO: 38, and SEQ ID NO: 39, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:40, the sequence AAS, and the sequence set forth in SEQ ID NO:42, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:25 and 26, respectively, and (b) an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:35 and 36, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:23 and 24, respectively, and (b) an anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs:33 and 34, respectively.
  • the anti-PD-1 antibody is spartalizumab (PDR001). Spartalizumab is described, for example, in WO 2015/112900 and U.S. Patent No. 9,683,048.
  • spartalizumab is administered intravenously at about 300 mg once about every 3 weeks or about 400 mg once about every 4 weeks.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:59, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:60.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:61; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:62; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:63; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:64; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:65; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:66.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:59 and 60, respectively.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:57 and 58, respectively.
  • the methods of the disclosure comprise a combination of ieramilimab and spartalizumab.
  • ieramilimab is administered intravenously at about 400 mg once about every three weeks and spartalizumab is administered intravenously at about 300 mg once about every 3 weeks.
  • ieramilimab is administered intravenously at about 600 mg once about every four weeks and spartalizumab is administered intravenously at about 400 mg once about every 4 weeks.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:47, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:49; and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:59, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:60.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:48, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:50; and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:59, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:60.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID N0:51, SEQ ID NO:52, and SEQ ID NO:53, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:54, SEQ ID NO:55, and SEQ ID NO:56, respectively, and (b) an anti- PD-1 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:61, SEQ ID NO:62, and SEQ ID NO:63, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:64, SEQ ID NO:65, and SEQ ID NO:66, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:47 and 49, respectively, and (b) an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:59 and 60, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:48 and 50, respectively, and (b) an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:59 and 60, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:43 and 45, respectively, and (b) an anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs:57 and 58, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:44 and 46, respectively, and (b) an anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs:57 and 58, respectively.
  • Anti-PD-L1 antibodies that are known in the art can be used in the methods of the disclosure.
  • Examples of anti-PD-L1 antibodies useful in the compositions and methods of the present disclosure include the antibodies disclosed in US Patent No. 9,580,507.
  • 9,580,507 have been demonstrated to exhibit one or more of the following characteristics: (a) bind to human PD- L1 with a KD of 1 x 10' 7 M or less, as determined by surface plasmon resonance using a Biacore biosensor system; (b) increase T-cell proliferation in a Mixed Lymphocyte Reaction (MLR) assay; (c) increase interferon-y production in an MLR assay; (d) increase IL-2 secretion in an MLR assay; (e) stimulate antibody responses; and (f) reverse the effect of T regulatory cells on T cell effector cells and/or dendritic cells.
  • Anti-PD-L1 antibodies usable in the present disclosure include monoclonal antibodies that bind specifically to human PD-L1 and exhibit at least one, in some aspects, at least five, of the preceding characteristics.
  • Anti-PD-L1 antibodies that can be used in the methods of the disclosure include BMS-936559 (also known as 12A4, MDX-1105; see, e.g, U.S. Patent No. 7,943,743 and WO 2013/173223), atezolizumab (Roche; also known as TECENTRIQ®; MPDL3280A, RG7446; see US 8,217,149; see, also, Herbst et al.
  • Anti-PD-L1 antibodies that can be used in the methods of the disclosure also include isolated antibodies that bind specifically to human PD-L1 and cross-compete for binding to human PD-L1 with any anti-PD-L1 antibody disclosed herein, e.g., atezolizumab, durvalumab, and/or avelumab.
  • the anti-PD-L1 antibody binds the same epitope as any of the anti-PD-L1 antibodies described herein, e.g., atezolizumab, durvalumab, and/or avelumab.
  • the antibodies that cross-compete for binding to human PD-L1 with, or bind to the same epitope region as, any anti-PD-L1 antibody disclosed herein, e.g., atezolizumab, durvalumab, and/or avelumab are monoclonal antibodies.
  • these cross-competing antibodies are chimeric antibodies, engineered antibodies, or humanized or human antibodies.
  • Such chimeric, engineered, humanized or human monoclonal antibodies can be prepared and isolated by methods well known in the art.
  • Anti-PD-L1 antibodies that can be used in the methods of the disclosure also include antigen-binding portions of any of the above full-length antibodies.
  • Anti-PD-L1 antibodies that can be used in the methods of the disclosure are antibodies that bind to PD-L1 with high specificity and affinity, block the binding of PD- 1, and inhibit the immunosuppressive effect of the PD-1 signaling pathway.
  • an anti-PD-L1 "antibody” includes an antigen- binding portion or fragment that binds to PD-L1 and exhibits the functional properties similar to those of whole antibodies in inhibiting receptor binding and up-regulating the immune system.
  • the anti-PD-L1 antibody or antigen-binding portion thereof cross-competes with atezolizumab, durvalumab, and/or avelumab for binding to human PD-L1.
  • an anti-PD-L1 antibody is substituted for the anti-PD-1 antibody in any of the methods disclosed herein.
  • the anti-PD-L1 antibody is a full-length antibody.
  • the anti-PD-L1 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-PD-L1 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-PD-L1 antibody is BMS-936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, CK-301, or comprises an antigen binding portion thereof.
  • the PD-L1 antibody is atezolizumab.
  • Atezolizumab is a fully humanized IgGl monoclonal anti-PD-L1 antibody.
  • atezolizumab is administered at about 800 mg once about every 2 weeks. In some aspects, atezolizumab is administered at about 840 mg once about every 2 weeks.
  • Atezolizumab is administered intravenously at about 1,200 mg on Day 1 of a three-week cycle.
  • Atezolizumab is administered intravenously at about 1,200 mg on Day 1 of a three-week cycle, and bevacizumab is administered at about 15 mg/kg on Day 1 of each cycle.
  • the PD-L1 antibody is durvalumab.
  • Durvalumab is a human IgGl kappa monoclonal anti-PD-L1 antibody.
  • durvalumab is administered at about 10 mg/kg once about every 2 weeks.
  • durvalumab is administered at about 10 mg/kg once about every 2 weeks for up to 12 months.
  • durvalumab is administered at about 800 mg/kg once about every 2 weeks.
  • durvalumab is administered at about 1200 mg/kg once about every 3 weeks.
  • the PD-L1 antibody is avelumab.
  • Avelumab is a human IgGl lambda monoclonal anti-PD-L1 antibody.
  • avelumab is administered at about 800 mg once about every 2 weeks.
  • an anti-PD-1 or anti-PD-L1 antibody as disclosed herein is formulated for intravenous administration.
  • an anti-PD-1 or anti-PD-L1 antibody as disclosed herein is administered at a flat dose.
  • an anti-PD-1 or anti-PD-L1 antibody as disclosed herein is administered at from at least about 0.25 mg to about 2000 mg, about 0.25 mg to about 1600 mg, about 0.25 mg to about 1200 mg, about 0.25 mg to about 800 mg, about 0.25 mg to about 400 mg, about 0.25 mg to about 100 mg, about 0.25 mg to about 50 mg, about 0.25 mg to about 40 mg, about 0.25 mg to about 30 mg, about 0.25 mg to about 20 mg, about 20 mg to about 2000 mg, about 20 mg to about 1600 mg, about 20 mg to about 1200 mg, about 20 mg to about 800 mg, about 20 mg to about 400 mg, about 20 mg to about 100 mg, about 100 mg to about 2000 mg, about 100 mg to about 1800 mg, about 100 mg to about 1600 mg, about 100 mg to about 1400 mg, about 100 mg to about 1200 mg, about 100 mg to about 1000 mg, about 100 mg to about 800 mg, about 100 mg to about 600 mg, about 100 mg to about 400 mg, about 400 mg to about 2000 mg, about 400 mg, about 0.25 mg to
  • an anti-PD-1 or anti-PD-L1 antibody as disclosed herein is administered at about 0.25 mg, about 0.5 mg, about 0.75 mg, about 1 mg, about 1.25 mg, about 1.5 mg, about 1.75 mg, about 2 mg, 2.25 mg, about 2.5 mg, about 2.75 mg, about 3 mg, about 3.25 mg, about 3.5 mg, about 3.75 mg, about 4 mg, about 4.25 mg, about 4.5 mg, about 4.75 mg, about 5 mg, about 5.25 mg, about 5.5 mg, about 5.75 mg, about 6 mg, about 6.25 mg, about 6.5 mg, about 6.75 mg, about 7 mg, about 7.25 mg, about 7.5 mg, about 7.75 mg, about 8 mg, about 8.25 mg, about 8.5 mg, about 8.75 mg, about 9 mg, about 9.25 mg, about 9.5 mg, about 9.75 mg, about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 110 mg,
  • an anti-PD-1 or anti-PD-L1 antibody as disclosed herein is administered at a weight-based dose.
  • an anti-PD-1 or anti-PD-L1 antibody as disclosed herein is administered at from at least about 0.003 mg/kg to about 25 mg/kg, about 0.003 mg/kg to about 20 mg/kg, about 0.003 mg/kg to about 15 mg/kg, about 0.003 mg/kg to about 10 mg/kg, about 0.003 mg/kg to about 5 mg/kg, about 0.003 mg/kg to about 1 mg/kg, about 0.003 mg/kg to about 0.9 mg/kg, about 0.003 mg/kg to about 0.8 mg/kg, about 0.003 mg/kg to about 0.7 mg/kg, about 0.003 mg/kg to about 0.6 mg/kg, about 0.003 mg/kg to about 0.5 mg/kg, about 0.003 mg/kg to about 0.4 mg/kg, about 0.003 mg/kg to about 0.3 mg/kg, about 0.003 mg/kg to about 0.2 mg/kg, about 0.003 mg/kg to about 0.1 mg/kg, about 0.1 mg/kg, about 0.1 mg/
  • an anti-PD-1 or anti-PD-L1 antibody as disclosed herein is administered at about 0.003 mg/kg, about 0.004 mg/kg, about 0.005 mg/kg, about 0.006 mg/kg, about 0.007 mg/kg, about 0.008 mg/kg, about 0.009 mg/kg, about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1.0 mg/kg, about 2.0 mg/kg, about 3.0 mg/kg, about 4.0 mg/kg, about 5.0 mg/kg, about 6.0 mg/kg, about 7.0 mg
  • the dose of an anti-PD-1 or anti-PD-L1 antibody as disclosed herein is administered in a constant amount.
  • the dose of an anti-PD-1 or anti-PD-L1 antibody as disclosed herein is administered in a varying amount.
  • the maintenance (or follow-on) dose of an anti-PD-1 or anti-PD-L1 antibody as disclosed herein can be higher or the same as the loading dose which is first administered.
  • the maintenance dose of an anti-PD-1 or anti-PD-L1 antibody as disclosed herein can be lower or the same as the loading dose.
  • an anti-PD-1 or anti-PD-L1 antibody as disclosed herein is administered once about every one week, once about every two weeks, once about every three weeks, once about every four weeks, once about every five weeks, once about every six weeks, once about every seven weeks, once about every eight weeks, once about every nine weeks, once about every ten weeks, once about every eleven weeks, or once about every twelve weeks.
  • Any amount of an anti-PD-1 or anti-PD-L1 antibody as described herein can be administered in combination with any amount of an anti-LAG-3 antibody as described herein.
  • the amount of the anti-LAG-3 antibody is about 80 mg.
  • the amount of the anti-LAG-3 antibody is about 160 mg.
  • the amount of the anti-LAG-3 antibody is about 360 mg.
  • the amount of the anti-LAG-3 antibody is about 480 mg.
  • the amount of the anti-LAG-3 antibody is about 720 mg.
  • the amount of the anti-LAG-3 antibody is about 800 mg.
  • the amount of the anti-LAG-3 antibody is about 960 mg.
  • the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 200 mg. [0313] In some aspects, the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 240 mg.
  • the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 360 mg.
  • the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 480 mg.
  • the amount of the anti-LAG-3 antibody is about 80 mg and the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 240 mg.
  • the amount of the anti-LAG-3 antibody is about 80 mg and the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 480 mg.
  • the amount of the anti-LAG-3 antibody is about 160 mg and the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 480 mg.
  • the amount of the anti-LAG-3 antibody is about 360 mg and the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 360 mg.
  • the amount of the anti-LAG-3 antibody is about 480 mg and the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 480 mg.
  • the amount of the anti-LAG-3 antibody is about 720 mg and the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 360 mg.
  • the amount of the anti-LAG-3 antibody is about 800 mg and the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 200 mg.
  • the amount of the anti-LAG-3 antibody is about 960 mg and the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 480 mg.
  • the amount of the anti-LAG-3 antibody is about 2 mg/kg and the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 6 mg/kg.
  • the amount of the anti-LAG-3 antibody is about 1 mg/kg and the amount of the anti-PD-1 antibody or anti-PD-L1 antibody is about 6 mg/kg.
  • a method of treating a human subject afflicted with CRC comprising administering to the subject: (a) about 480 mg of an anti-LAG-3 antibody, and (b) about 480 mg of an anti-PD-1 antibody or an anti-PD-L1 antibody.
  • a method of treating a human subject afflicted with CRC comprising administering to the subject: (a) about 480 mg of an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14.
  • the anti-LAG-3 antibody and/or the anti-PD-1 antibody or anti- PD-L1 antibody is formulated for intravenous administration.
  • the anti-LAG-3 antibody and/or the anti-PD-1 antibody or anti- PD-L1 antibody is administered once about every one week, once about every two weeks, once about every three weeks, once about every four weeks, once about every five weeks, once about every six weeks, once about every seven weeks, once about every eight weeks, once about every nine weeks, once about every ten weeks, once about every eleven weeks, or once about every twelve weeks.
  • the anti-PD-1 antibody or anti-PD-L1 antibody is administered before the anti-LAG-3 antibody.
  • the anti-LAG-3 antibody is administered before the anti-PD-1 antibody or anti-PD-L1 antibody.
  • the anti-LAG-3 antibody and the anti-PD-1 antibody or anti-PD- L1 antibody are administered concurrently.
  • the anti-LAG-3 antibody and the anti-PD-1 antibody or anti-PD- L1 antibody are formulated separately.
  • the anti-LAG-3 antibody and the anti-PD-1 antibody or anti-PD- L1 antibody are formulated together.
  • the methods of the disclosure further comprise administering to the subject an additional therapeutic agent and/or anti-cancer therapy.
  • the additional anti-cancer therapy can comprise any therapy known in the art for the treatment of a tumor in a subject and/or any standard-of-care therapy, as disclosed herein.
  • the additional anti-cancer therapy comprises a surgery, a radiation therapy, a chemotherapy, an immunotherapy, or any combination thereof.
  • the additional anti-cancer therapy comprises a chemotherapy, including any chemotherapeutic agent disclosed herein.
  • the chemotherapy comprises platinum-doublet chemotherapy.
  • the additional therapeutic agent comprises an anti-cancer agent.
  • the anti-cancer agent comprises a tyrosine kinase inhibitor, an anti- angiogenesis agent, a checkpoint inhibitor, a checkpoint stimulator, a chemotherapeutic agent, an immunotherapeutic agent, a platinum agent, an alkylating agent, a taxane, a nucleoside analog, an antimetabolite, a topoisomerase inhibitor, an anthracycline, a vinca alkaloid, or any combination thereof.
  • the tyrosine kinase inhibitor comprises sorafenib (e.g., sorafenib tosylate, also known as NEXAVAR®), lenvatinib (e.g., lenvatinib mesylate, also known as LENVIMA®), regorafenib (e.g., STIVARGA®), cabozantinib (e.g., cabozantinib S- malate, also known as CABOMETYX®), sunitinib (e.g., sunitinib malate, also known as SUTENT®), brivanib, linifanib, pemigatinib (also known as PEMAZYRETM), everolimus (also known as AFINITOR® or ZORTRESS®), gefitinib (IRESSA®, a small-molecule TKI of EGFR), imatinib (e.g., imatinib (e.g., im
  • the anti-angiogenesis agent comprises an inhibitor of a vascular endothelial growth factor (VEGF), VEGF receptor (VEGFR), platelet-derived growth factor (PDGF), PDGF receptor (PDGFR), angiopoietin (Ang), tyrosine kinase with Ig-like and EGF-like domains (Tie) receptor, hepatocyte growth factor (HGF), tyrosine-protein kinase Met (c-MET), C-type lectin family 14 member A (CLEC14A), multimerin 2 (MMRN2), shock protein 70-1 A (HSP70-1 A), epidermal growth factor (EGF), EGFR, or any combination thereof.
  • VEGF vascular endothelial growth factor
  • VGF receptor VEGF receptor
  • PDGF platelet-derived growth factor
  • PDGFR PDGF receptor
  • Ang angiopoietin
  • Ang tyrosine kinase with Ig-like and EGF
  • the anti-angiogenesis agent comprises bevacizumab (also known as AVASTIN®), ranibizumab (also known as LUCENTIS®), ramucirumab (also known as CYRAMZA®), aflibercept (also known as EYLEA® or ZALTRAP®), tanibirumab, olaratumab (also known as LARTRUVOTM), nesvacumab, AMG780, MEDI3617, vanucizumab, rilotumumab, ficlatuzumab, TAK-701, onartuzumab, emibetuzumab, or any combination thereof.
  • bevacizumab also known as AVASTIN®
  • ranibizumab also known as LUCENTIS®
  • ramucirumab also known as CYRAMZA®
  • aflibercept also known as EYLEA® or ZALTRAP®
  • tanibirumab also known as LARTRUVOTM
  • the checkpoint stimulator comprises an agonist of B7-1, B7-2, CD28, 4-1BB (CD137), 4-1BBL, GITR, inducible T cell co-stimulator (ICOS), ICOS-L, 0X40, OX40L, CD70, CD27, CD40, death receptor 3 (DR3), CD28H, or any combination thereof.
  • the chemotherapeutic agent comprises an alkylating agent, an antimetabolite, an antineoplastic antibiotic, a mitotic inhibitor, a hormone or hormone modulator, a protein tyrosine kinase inhibitor, an epidermal growth factor inhibitor, a proteasome inhibitor, other neoplastic agent, or any combination thereof.
  • the immunotherapeutic agent comprises an antibody that specifically binds to EGFR (e.g., cetuximab (ERBITUX®)), ALK, ROS-1, NTRK, BRAF, ICOS, CD137 (4-1BB), CD134 (0X40), NKG2A, CD27, CD96, GITR, Herpes Virus Entry Mediator (HVEM), PD-1, PD-L1, CTLA-4, BTLA, TIM-3, A2aR, Killer cell Lectin-like Receptor G1 (KLRG-1), Natural Killer Cell Receptor 2B4 (CD244), CD 160, TIGIT, VISTA, KIR, TGFp, IL- 10, IL-8, B7-H4, Fas ligand, CSF1R, CXCR4, mesothelin, CEACAM-1, CD52, HER2, MICA, MICB, or any combination thereof.
  • EGFR e.g., cetuximab (ERBITUX®)
  • the platinum agent comprises cisplatin, carboplatin, oxaliplatin, satraplatin, picoplatin, nedaplatin, triplatin (e.g., triplatin tetranitrate), lipoplatin, phenanthriplatin, or any combination thereof.
  • the alkylating agent comprises altretamine, bendamustine, busulfan, carboplatin, carmustine, chlorambucil, cisplatin, cyclophosphamide, dacarbazine, ifosfamide, lomustine, mechlorethamine, melphalan, oxaliplatin, procarbazine, streptozocin, temozolomide, thiotepa, or any combination thereof.
  • the taxane comprises paclitaxel, albumin-bound paclitaxel, docetaxel, cabazitaxel, or any combination thereof.
  • the nucleoside analog comprises cytarabine, gemcitabine, lamivudine, entecavir, telbivudine, or any combination thereof.
  • the antimetabolite comprises capecitabine, cladribine, clofarabine, cytarabine, floxuridine, fludarabine, fluorouracil, gemcitabine, mercaptopurine, methotrexate, pemetrexed, pentostatin, pralatrexate, thioguanine, or any combination thereof.
  • the topoisomerase inhibitor comprises etoposide, mitoxantrone, doxorubicin, irinotecan, topotecan, camptothecin, or any combination thereof.
  • the anthracycline is doxorubicin, daunorubicin, epirubicin, idarubicin, or any combination thereof.
  • the vinca alkaloid is vinblastine, vincristine, vinorelbine, vindesine, vincaminol,êtdine, vinburnine, or any combination thereof.
  • the anti-cancer agent that is administered as an additional therapeutic agent in the methods of the disclosure is a checkpoint inhibitor.
  • the checkpoint inhibitor comprises a cytotoxic T-lymphocyte- associated protein 4 (CTLA-4) inhibitor, a T cell immunoglobulin and ITIM domain (TIGIT) inhibitor, a T cell immunoglobulin and mucin-domain containing-3 (TIM-3) inhibitor, a TIM-1 inhibitor, a TIM-4 inhibitor, a B7-H3 inhibitor, a B7-H4 inhibitor, a B and T cell lymphocyte attenuator (BTLA) inhibitor, a V-domain Ig suppressor of T cell activation (VISTA) inhibitor, an indoleamine 2,3-dioxygenase (IDO) inhibitor, a nicotinamide adenine dinucleotide phosphate oxidase isoform 2 (N0X2) inhibitor, a killer- cell immunoglobulin-like receptor (KIR) inhibitor, an adenosine A2a receptor (A2aR) inhibitor, a transforming growth factor beta (TGF- ⁇ )
  • CTL-4 T cell
  • the checkpoint inhibitor is formulated for intravenous administration.
  • the checkpoint inhibitor is administered at a flat dose.
  • the checkpoint inhibitor is administered at from at least about 0.25 mg to about 2000 mg, about 0.25 mg to about 1600 mg, about 0.25 mg to about 1200 mg, about 0.25 mg to about 800 mg, about 0.25 mg to about 400 mg, about 0.25 mg to about 100 mg, about 0.25 mg to about 50 mg, about 0.25 mg to about 40 mg, about 0.25 mg to about 30 mg, about 0.25 mg to about 20 mg, about 20 mg to about 2000 mg, about 20 mg to about 1600 mg, about 20 mg to about 1200 mg, about 20 mg to about 800 mg, about 20 mg to about 400 mg, about 20 mg to about 100 mg, about 100 mg to about 2000 mg, about 100 mg to about 1800 mg, about 100 mg to about 1600 mg, about 100 mg to about 1400 mg, about 100 mg to about 1200 mg, about 100 mg to about 1000 mg, about 100 mg to about 800 mg, about 100 mg to about 600 mg, about 100 mg to about 400 mg, about 400 mg to about 2000 mg, about 400 mg to about 1800 mg, about 400 mg to about 1600 mg, about
  • the checkpoint inhibitor is administered at about 0.25 mg, about 0.5 mg, about 0.75 mg, about 1 mg, about 1.25 mg, about 1.5 mg, about 1.75 mg, about 2 mg, about 2.25 mg, about 2.5 mg, about 2.75 mg, about 3 mg, about 3.25 mg, about 3.5 mg, about 3.75 mg, about 4 mg, about 4.25 mg, about 4.5 mg, about 4.75 mg, about 5 mg, about 5.25 mg, about 5.5 mg, about 5.75 mg, about 6 mg, about 6.25 mg, about 6.5 mg, about 6.75 mg, about 7 mg, about 7.25 mg, about 7.5 mg, about 7.75 mg, about 8 mg, about 8.25 mg, about 8.5 mg, about 8.75 mg, about 9 mg, about 9.25 mg, about 9.5 mg, about 9.75 mg, about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 110 mg, about 120 mg, about
  • the checkpoint inhibitor is administered as a weight-based dose.
  • the checkpoint inhibitor is administered at from at least about 0.003 mg/kg to about 25 mg/kg, about 0.003 mg/kg to about 20 mg/kg, about 0.003 mg/kg to about 15 mg/kg, about 0.003 mg/kg to about 10 mg/kg, about 0.003 mg/kg to about 5 mg/kg, about 0.003 mg/kg to about 1 mg/kg, about 0.003 mg/kg to about 0.9 mg/kg, about 0.003 mg/kg to about 0.8 mg/kg, about 0.003 mg/kg to about 0.7 mg/kg, about 0.003 mg/kg to about 0.6 mg/kg, about 0.003 mg/kg to about 0.5 mg/kg, about 0.003 mg/kg to about 0.4 mg/kg, about 0.003 mg/kg to about 0.3 mg/kg, about 0.003 mg/kg to about 0.2 mg/kg, about 0.003 mg/kg to about 0.1 mg/kg, about 0.1 mg/kg to about 25 mg/kg, about 0.1 mg/kg, about 0.1 mg/
  • the checkpoint inhibitor is administered at about 0.003 mg/kg, about 0.004 mg/kg, about 0.005 mg/kg, about 0.006 mg/kg, about 0.007 mg/kg, about 0.008 mg/kg, about 0.009 mg/kg, about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1.0 mg/kg, about 2.0 mg/kg, about 3.0 mg/kg, about 4.0 mg/kg, about 5.0 mg/kg, about 6.0 mg/kg, about 7.0 mg/kg, about 8.0 mg/kg, about 9.0
  • the dose of the checkpoint inhibitor is administered in a constant amount.
  • the dose of the checkpoint inhibitor is administered in a varying amount.
  • the maintenance (or follow-on) dose of the checkpoint inhibitor can be higher or the same as the loading dose which is first administered. In some aspects, the maintenance dose of the checkpoint inhibitor can be lower or the same as the loading dose.
  • the checkpoint inhibitor is administered every one week, every two weeks, every three weeks, every four weeks, every five weeks, every six weeks, every seven weeks, every eight weeks, every nine weeks, every ten weeks, every eleven weeks, or every twelve weeks.
  • the checkpoint inhibitor as disclosed herein comprises a CTLA-4 inhibitor.
  • the CTLA-4 inhibitor is an anti-CTLA-4 antibody.
  • Anti-CTLA-4 antibodies that can be used in the methods of the disclosure bind to human CTLA-4 and disrupt the interaction of CTLA-4 with a human B7 receptor. Because the interaction of CTLA-4 with B7 transduces a signal leading to inactivation of T-cells bearing the CTLA-4 receptor, disruption of the interaction effectively induces, enhances, or prolongs the activation of such T cells, thereby inducing, enhancing or prolonging an immune response.
  • 6,984,720 have been demonstrated to exhibit one or more of the following characteristics: (a) binds specifically to human CTLA-4 with a binding affinity reflected by an equilibrium association constant (K ⁇ ) of at least about 10 7 M' 1 , or about 10 9 M' 1 , or about 10 10 M' 1 to 10 11 M' 1 or higher, as determined by Biacore analysis; (b) a kinetic association constant (U) of at least about 10 3 , about 10 4 , or about 10 5 m' 1 s' 1 ; (c) a kinetic disassociation constant (k d ) of at least about 10 3 , about 10 4 , or about 10 5 m' 1 s' 1 ; and (d) inhibits the binding of CTLA-4 to B7-1 (CD80) and B7-2 (CD86).
  • Anti-CTLA-4 antibodies useful for the present disclosure include monoclonal antibodies that bind specifically to human CTLA-4 and exhibit at least one, at least two, or at least three of the preceding characteristics.
  • Anti-CTLA-4 antibodies that can be used in the methods of the disclosure include ipilimumab (also known as YERVOY®, MDX-010, 10D1; see U.S. Patent No. 6,984,720), MK-1308 (Merck), AGEN-1884 (Agenus Inc.; see WO 2016/196237), and tremelimumab (AstraZeneca; also known as ticilimumab, CP-675,206; see WO 2000/037504 and Ribas, Update Cancer Ther. 2(3): 133-39 (2007)).
  • the anti-CTLA-4 antibody binds specifically to human CTLA-4 and cross-competes for binding to human CTLA-4 with any anti-CTLA-4 antibody disclosed herein, e.g., ipilimumab and/or tremelimumab.
  • the anti-CTLA- 4 antibody binds the same epitope as any of the anti-CTLA-4 antibodies described herein, e.g., ipilimumab and/or tremelimumab.
  • the antibodies that cross-compete for binding to human CTLA-4 with, or bind to the same epitope region as, any anti-CTLA-4 antibody disclosed herein, e.g., ipilimumab and/or tremelimumab, are monoclonal antibodies.
  • these cross-competing antibodies are chimeric antibodies, engineered antibodies, or humanized or human antibodies.
  • Anti-CTLA-4 antibodies that can be used in the methods of the disclosure also include antigen-binding portions of any of the above full-length antibodies.
  • the anti-CTLA-4 antibody is a full-length antibody. In some aspects, the anti-CTLA-4 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody. In some aspects, the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-CTLA-4 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-CTLA-4 antibody is ipilimumab, tremelimumab, MK- 1308, AGEN-1884, or comprises an antigen binding portion thereof.
  • the anti-CTLA-4 antibody is ipilimumab.
  • Ipilimumab is a fully human, IgGl monoclonal antibody that blocks the binding of CTLA-4 to its B7 ligands, thereby stimulating T cell activation.
  • ipilimumab is administered at about 3 mg/kg once about every 3 weeks.
  • ipilimumab is administered at about 10 mg/kg once about every 3 weeks.
  • ipilimumab is administered at about 10 mg/kg once about every 12 weeks.
  • the ipilimumab is administered for four doses.
  • ipilimumab is administered on Day 1 of each cycle.
  • Therapeutic agents of the present disclosure can be constituted in a composition, e.g., a pharmaceutical composition containing an inhibitor, antibody, and/or agent as disclosed herein and a pharmaceutically acceptable carrier.
  • a pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • the carrier for a composition containing an inhibitor, antibody, and/or agent as disclosed herein is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion).
  • the carrier is suitable for non-parenteral, e.g., oral, administration.
  • a subcutaneous injection is based on Halozyme Therapeutics’ ENHANZE® drug-delivery technology (see U.S. Patent No. 7,767,429, which is incorporated by reference herein in its entirety).
  • ENHANZE® uses a co-formulation of an antibody with recombinant human hyaluronidase enzyme (rHuPH20), which removes traditional limitations on the volume of biologies and drugs that can be delivered subcutaneously due to the extracellular matrix (see U.S. Patent No. 7,767,429).
  • a pharmaceutical composition of the disclosure can include one or more pharmaceutically acceptable salts, anti-oxidant, aqueous and non- aqueous carriers, and/or adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents.
  • the pharmaceutical composition for the present disclosure can further comprise recombinant human hyaluronidase enzyme, e.g., rHuPH20.
  • Treatment is continued as long as clinical benefit is observed or until unacceptable toxicity or disease progression occurs.
  • Dosage and frequency vary depending on the half- life of the inhibitor, antibody, and/or agent in the subject. In general, human antibodies show the longest half-life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies.
  • the dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is typically administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
  • compositions of the present disclosure can be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being unduly toxic to the patient.
  • the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present disclosure employed, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • a composition of the present disclosure can be administered via one or more routes of administration using one or more of a variety of methods well known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results.
  • composition comprising any amount of an anti- LAG-3 antibody and any amount of an anti-PD-1 antibody or anti-PD-L1 antibody as described herein.
  • the pharmaceutical composition is for treating a human subject with CRC as described herein, including unresectable or metastatic CRC.
  • a method for treating a human subject with CRC as described herein comprises administering a pharmaceutical composition as described herein.
  • the pharmaceutical composition comprises relatlimab and an anti- PD-1 antibody or anti-PD-L1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab.
  • the anti-PD-1 antibody is nivolumab.
  • the anti-PD-L1 antibody is BMS- 936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, or CK-301.
  • the pharmaceutical composition comprises favezelimab and an anti-PD-1 antibody or anti-PD-L1 antibody as described herein.
  • the anti- PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab.
  • the anti-PD-1 antibody is pembrolizumab.
  • the anti-PD-L1 antibody is BMS-936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, or CK-301.
  • the pharmaceutical composition comprises fianlimab and an anti- PD-1 antibody or anti-PD-L1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab.
  • the anti-PD-1 antibody is cemiplimab.
  • the anti-PD-L1 antibody is BMS- 936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, or CK-301.
  • the pharmaceutical composition comprises ieramilimab and an anti-PD-1 antibody or anti-PD-L1 antibody as described herein.
  • the anti- PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab.
  • the anti-PD-1 antibody is spartalizumab.
  • the anti-PD-L1 antibody is BMS-936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, or CK-301.
  • the pharmaceutical composition comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody or anti-PD-L1 antibody of about 1:1, about 1:2, about 1:3, about 1:4, about 1:5, about 1:6, about 1:7, about 1:8, about 1:9, about 1:10, about 1:15, about 1:20, about 1:30, about 1:40, about 1:50, about 1:60, about 1:70, about 1:80, about 1:90, about 1:100, about 1:120, about 1:140, about 1:160, about 1:180, about 1:200, about 200:1, about 180:1, about 160:1, about 140:1, about 120:1, about 100:1, about 90:1, about 80:1, about 70:1, about 60:1, about 50:1, about 40:1, about 30:1, about 20:1, about 15:1, about 10:1, about 9:1, about 8:1, about 7:1, about 6:1, about 5:1, about 4:1, about 3:1, or about 2:1.
  • the pharmaceutical composition comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody or anti-PD-L1 antibody of about 1:6.
  • the pharmaceutical composition comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody or anti-PD-L1 antibody of about 1:3.
  • the pharmaceutical composition comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody or anti-PD-L1 antibody of about 1:1
  • the pharmaceutical composition comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody or anti-PD-L1 antibody of about 2:1.
  • the pharmaceutical composition comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody or anti-PD-L1 antibody of about 4:1.
  • the total amount of anti-LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 20 mg/mL, about 25 mg/mL, about 30 mg/mL, about 35 mg/mL, about 40 mg/mL, about 45 mg/mL, about 50 mg/mL, about 55 mg/mL, about 60 mg/mL, about 65 mg/mL, about 70 mg/mL, about 75 mg/mL, about 80 mg/mL, about 85 mg/mL, about 90 mg/mL, about 95 mg/mL, about 100 mg/mL, about 105 mg/mL, about 110 mg/mL, about 115 mg/mL, about 120 mg/mL, about 125 mg/mL, about 130 mg/mL, about 135 mg/mL, about 140 mg/mL, about 145 mg/mL, about 150 mg/mL, about 155 mg/mL, about 160 mg/mL, about 165 mg/mL, about
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 25 mg/mL.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 50 mg/mL.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 150 mg/mL.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 50 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 320 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 480 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 560 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 640 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 720 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 960 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 1000 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 1080 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the pharmaceutical composition is about 1440 mg.
  • the pharmaceutical composition comprises about 10 mg/mL, about
  • 12.5 mg/mL about 15 mg/mL, about 17.5 mg/mL, about 20 mg/mL, about 22.5 mg/mL, about 25 mg/mL, about 27.5 mg/mL, about 30 mg/mL, about 32.5 mg/mL, about 35 mg/mL, about 37.5 mg/mL, about 40 mg/mL, about 42.5 mg/mL, about 45 mg/mL, about
  • the pharmaceutical composition comprises about 10 mg/mL, about
  • the pharmaceutical composition comprises about 12.5 mg/mL of an anti-LAG-3 antibody and about 37.5 mg/mL of an anti-PD-1 antibody or anti-PD-L1 antibody. [0408] In some aspects, the pharmaceutical composition comprises about 20 mg/mL of an anti-LAG-3 antibody and about 5 mg/mL of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the pharmaceutical composition comprises about 75 mg/mL of an anti-LAG-3 antibody and about 75 mg/mL of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the pharmaceutical composition comprises about 100 mg/mL of an anti-LAG-3 antibody and about 50 mg/mL of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the pharmaceutical composition comprises about 80 mg of an anti- LAG-3 antibody and about 240 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the pharmaceutical composition comprises about 80 mg of an anti- LAG-3 antibody and about 480 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the pharmaceutical composition comprises about 120 mg of an anti-LAG-3 antibody and about 360 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the pharmaceutical composition comprises about 160 mg of an anti-LAG-3 antibody and about 480 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the pharmaceutical composition comprises about 360 mg of an anti-LAG-3 antibody and about 360 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the pharmaceutical composition comprises about 480 mg of an anti-LAG-3 antibody and about 480 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the pharmaceutical composition comprises about 720 mg of an anti-LAG-3 antibody and about 360 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the pharmaceutical composition comprises about 800 mg of an anti-LAG-3 antibody and about 200 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the pharmaceutical composition comprises about 960 mg of an anti-LAG-3 antibody and about 480 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the pharmaceutical composition comprises from about 5 mM to about 50 mM of histidine, from about 50 mM to about 300 mM of sucrose, from about 5 pM to about 1 mM of diethylenetriaminepentaacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA), and from about 0.001% to about 1% (w/v) of polysorbate or pol oxamer (e.g., polysorbate 80 (PS80), polysorbate 20 (PS20), pol oxamer 188 (PX188), or any combination thereof).
  • the pharmaceutical composition comprises about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, and 0.05% PS80.
  • the pH of the pharmaceutical composition is from about 5 to about 6.5. In some aspects, the pH is about 5.3 to about 6.3. In some aspects, the pH is 5.8. In some aspects, the pH is 5.7.
  • a vial, syringe, or intravenous bag comprising a pharmaceutical composition as described herein.
  • the disclosure includes an autoinjector comprising a pharmaceutical composition described herein.
  • a vial comprises a pharmaceutical composition as described herein, and the vial further comprises a stopper and a seal.
  • the total volume in the vial is about 5 mL, about 6 mL, about 7 mL, about 8 mL, about 9 mL, about 10 mL, about 11 mL, about 12 mL, about 13 mL, about 14 mL, about 15 mL, about 16 mL, about 17 mL, about 18 mL, about 19 mL, or about 20 mL.
  • kits for treating a human subject with CRC as described herein including unresectable or metastatic CRC, comprising any of the antibodies, therapeutic agents, and/or anti-cancer therapies described herein.
  • Kits typically include a label indicating the intended use of the contents of the kit and instructions for use.
  • label includes any writing, or recorded material supplied on or with the kit, or which otherwise accompanies the kit.
  • kits for treating a human subj ect afflicted with CRC comprising: (a) an anti -LAG-3 antibody; and (b) an anti-PD-1 antibody or anti-PD-L1 antibody; and (c) instructions for using the anti -LAG-3 antibody and the anti-PD-1 antibody or anti-PD-L1 antibody in a method for treating a human subject afflicted with CRC.
  • the anti -LAG-3 antibody and the anti-PD-1 antibody or anti-PD-L1 antibody can be provided at any of the amounts or combinations of amounts described herein.
  • the kit comprises relatlimab and an anti-PD-1 antibody or anti-PD- L1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab.
  • the anti-PD-1 antibody is nivolumab.
  • the anti-PD-L1 antibody is BMS-936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, or CK-301.
  • the kit comprises favezelimab and an anti-PD-1 antibody or anti- PD-L1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab.
  • the anti-PD-1 antibody is pembrolizumab.
  • the anti-PD-L1 antibody is BMS-936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, or CK-301.
  • the kit comprises fianlimab and an anti-PD-1 antibody or anti-PD- L1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab.
  • the anti-PD-1 antibody is cemiplimab.
  • the anti-PD-L1 antibody is BMS-936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, or CK-301.
  • the kit comprises ieramilimab and an anti-PD-1 antibody or anti- PD-L1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab.
  • the anti-PD-1 antibody is spartalizumab.
  • the anti-PD-L1 antibody is BMS-936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, or CK-301.
  • the kit comprises a ratio of the anti-LAG-3 antibody to the anti- PD-1 antibody or anti-PD-L1 antibody of about 1:1, about 1:2, about 1:3, about 1:4, about 1:5, about 1:6, about 1:7, about 1:8, about 1:9, about 1:10, about 1:15, about 1:20, about 1:30, about 1:40, about 1:50, about 1:60, about 1:70, about 1:80, about 1:90, about 1:100, about 1:120, about 1:140, about 1:160, about 1:180, about 1:200, about 200:1, about 180:1, about 160:1, about 140:1, about 120:1, about 100:1, about 90:1, about 80:1, about 70:1, about 60:1, about 50:1, about 40:1, about 30:1, about 20:1, about 15:1, about 10:1, about 9:1, about 8:1, about 7:1, about 6:1, about 5:1, about 4:1, about 3:1, or about 2:1.
  • the kit comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody or anti-PD-L1 antibody of about 1:6.
  • the kit comprises a ratio of the anti-LAG-3 antibody to the anti- PD-1 antibody or anti-PD-L1 antibody of about 1:3.
  • the kit comprises a ratio of the anti-LAG-3 antibody to the anti- PD-1 antibody or anti-PD-L1 antibody of about 1:1 [0437] In some aspects, the kit comprises a ratio of the anti-LAG-3 antibody to the anti- PD-1 antibody or anti-PD-L1 antibody of about 2:1.
  • the kit comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody or anti-PD-L1 antibody of about 4: 1.
  • the total amount of anti-LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 20 mg/mL, about 25 mg/mL, about 30 mg/mL, about
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 25 mg/mL.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 50 mg/mL.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 150 mg/mL.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 50 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 320 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 480 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 560 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 640 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 720 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 960 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 1000 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 1080 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies or anti- PD-L1 antibodies in the kit is about 1440 mg.
  • the kit comprises about 10 mg/mL, about 12.5 mg/mL, about 15 mg/mL, about 17.5 mg/mL, about 20 mg/mL, about 22.5 mg/mL, about 25 mg/mL, about 27.5 mg/mL, about 30 mg/mL, about 32.5 mg/mL, about 35 mg/mL, about 37.5 mg/mL, about 40 mg/mL, about 42.5 mg/mL, about 45 mg/mL, about 47.5 mg/mL, about 50 mg/mL, about 55 mg/mL, about 60 mg/mL, about 65 mg/mL, about 70 mg/mL, about 75 mg/mL, about 80 mg/mL, about 85 mg/mL, about 90 mg/mL, about 95 mg/mL, about 100 mg/mL, about 105 mg/mL, about 110 mg/mL, about 115 mg/mL, about 120 mg/mL, about 125 mg/mL, about 130 mg/mL, about 1
  • the kit comprises about 10 mg/mL, about 12.5 mg/mL, about 15 mg/mL, about 17.5 mg/mL, about 20 mg/mL, about 22.5 mg/mL, about 25 mg/mL, about 27.5 mg/ml, about 30 mg/mL, about 32.5 mg/mL, about 35 mg/mL, about 37.5 mg/mL, about 40 mg/mL, about 42.5 mg/mL, about 45 mg/mL, about 47.5 mg/mL, about 50 mg/mL, about 55 mg/mL, about 60 mg/mL, about 65 mg/mL, about 70 mg/mL, about 75 mg/mL, about 80 mg/mL, about 85 mg/mL, about 90 mg/mL, about 95 mg/mL, about 100 mg/mL, about 105 mg/mL, about 110 mg/mL, about 115 mg/mL, about 120 mg/mL, about 125 mg/mL, 130 mg/mL, about 135
  • the kit comprises about 12.5 mg/mL of an anti-LAG-3 antibody and about 37.5 mg/mL of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the kit comprises about 20 mg/mL of an anti-LAG-3 antibody and about 5 mg/mL of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the kit comprises about 75 mg/mL of an anti-LAG-3 antibody and about 75 mg/mL of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the kit comprises about 100 mg/mL of an anti-LAG-3 antibody and about 50 mg/mL of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the kit comprises about 80 mg of an anti-LAG-3 antibody and about 240 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the kit comprises about 80 mg of an anti-LAG-3 antibody and about 480 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the kit comprises about 120 mg of an anti-LAG-3 antibody and about 360 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the kit comprises about 160 mg of an anti-LAG-3 antibody and about 480 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the kit comprises about 360 mg of an anti-LAG-3 antibody and about 360 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the kit comprises about 480 mg of an anti-LAG-3 antibody and about 480 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the kit comprises about 720 mg of an anti-LAG-3 antibody and about 360 mg of an anti-PD-1 antibody or anti-PD-L1 antibody. [0466] In some aspects, the kit comprises about 800 mg of an anti-LAG-3 antibody and about 200 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • the kit comprises about 960 mg of an anti-LAG-3 antibody and about 480 mg of an anti-PD-1 antibody or anti-PD-L1 antibody.
  • kits for treating a human subj ect afflicted with CRC comprising: (a) about 480 mg of an anti-LAG-3 antibody; (b) about 480 mg of an anti-PD-1 antibody or anti-PD-L1 antibody; and (c) instructions for using the anti-LAG-3 antibody and the anti-PD-1 antibody or anti-PD-L1 antibody in a method for treating a human subject afflicted with CRC.
  • the anti-LAG-3 and anti-PD-1 antibodies or anti-PD-L1 antibodies are co-packaged in a single unit dosage form.
  • the anti-LAG-3 and anti-PD-1 antibodies or anti-PD-L1 antibodies are packaged as separate unit dosage forms.
  • about 80 mg of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 120 mg of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 160 mg of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 360 mg of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 480 mg of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 960 mg of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 50 mg/mL of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 100 mg/mL of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 130 mg/mL of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 150 mg/mL of the anti -LAG-3 antibody is provided in a unit dosage form.
  • about 175 mg/mL of the anti -LAG-3 antibody is provided in a unit dosage form.
  • about 200 mg/mL of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 40 mg of the anti-PD-1 antibody or anti-PD-L1 antibody is provided in a unit dosage form.
  • about 100 mg of the anti-PD-1 antibody or anti-PD-L1 antibody is provided in a unit dosage form.
  • about 240 mg of the anti-PD-1 antibody or anti-PD-L1 antibody is provided in a unit dosage form.
  • the anti-PD-1 antibody or anti-PD-L1 antibody is provided in a unit dosage form.
  • about 480 mg of the anti-PD-1 antibody or anti-PD-L1 antibody is provided in a unit dosage form.
  • the anti-PD-1 antibody or anti-PD-L1 antibody is provided in a unit dosage form.
  • the anti-PD-1 antibody or anti-PD-L1 antibody is provided in a unit dosage form.
  • about 100 mg/mL of the anti-PD-1 antibody or anti-PD-L1 antibody is provided in a unit dosage form.
  • about 150 mg/mL of the anti-PD-1 antibody or anti-PD-L1 antibody is provided in a unit dosage form.
  • about 175 mg/mL of the anti-PD-1 antibody or anti-PD-L1 antibody is provided in a unit dosage form.
  • about 200 mg/mL of the anti-PD-1 antibody or anti-PD-L1 antibody is provided in a unit dosage form.
  • the unit dosage form comprises from about 5 mM to about 50 mM of histidine, from about 50 mM to about 300 mM of sucrose, from about 5 pM to about 1 mM of diethylenetriaminepentaacetic acid (DTP A) or ethylenediaminetetraacetic acid (EDTA), and from about 0.001% to about 1% (w/v) of polysorbate or poloxamer (e.g., polysorbate 80 (PS80), polysorbate 20 (PS20), pol oxamer 188 (PX188), or any combination thereof).
  • DTP A diethylenetriaminepentaacetic acid
  • EDTA ethylenediaminetetraacetic acid
  • polysorbate or poloxamer e.g., polysorbate 80 (PS80), polysorbate 20 (PS20), pol oxamer 188 (PX188), or any combination thereof.
  • the unit dosage form comprises about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, and 0.05% PS80.
  • the unit dosage form comprises a pH of from about 5 to about 6.5. In some aspects, the pH is about 5.3 to about 6.3. In some aspects, the pH is 5.8. In some aspects, the pH is 5.7.
  • the unit dosage form is a vial, syringe, or intravenous bag. In some aspects, the unit dosage form is an autoinjector. In some aspects, the unit dosage form is a vial comprising a stopper and a seal. In some aspects, the total volume in the vial is about 5 mL, about 6 mL, about 7 mL, about 8 mL, about 9 mL, about 10 mL, about 11 mL, about 12 mL, about 13 mL, about 14 mL, about 15 mL, about 16 mL, about 17 mL, about 18 mL, about 19 mL, or about 20 mL.
  • the kit provides instructions for administering the anti-LAG-3 antibody and/or the anti-PD-1 antibody or anti-PD-L1 antibody intravenously for about 30 minutes.
  • An open-label, sponsor blinded, multi-center Phase 3 trial will evaluate the safety and efficacy of a fixed-dose combination of relatlimab and nivolumab as compared to a regorafenib or trifluridine/tipiracil (TAS- 102) standard of care therapy in the treatment of proficient mismatch repair (pMMR)/microsatellite stable (MSS) metastatic colorectal cancer (mCRC).
  • TAS- 102 trifluridine/tipiracil
  • Patients will be > 18 years, or local age of majority, and will be selected based on eligibility criteria that includes the following: (1) histologically-confirmed, previously- treated CRC with adenocarcinoma histology and metastatic or recurrent unresectable disease at study entry; (2) confirmed tumor MSS/pMMR status as per local standard testing, with MSS/pMMR results from initial diagnosis being acceptable; (3) progression during or within approximately three months following the last administration of approved standard therapies (at least one but not more than four prior lines of therapies), which must include a fluoropyrimidine, oxaliplatin, irinotecan, an anti-VEGF therapy, and anti-EGFR therapy (if KRAS wild-type), if approved in the respective country; i) participants treated in adjuvant/neoadjuvant setting should have progressed during or within six months of completion of adjuvant therapy to be considered refractory to that therapy; ii) adjuvant/neoadjuvant therapy or maintenance
  • Patients will not be eligible for the study if they have had prior treatment with immunotherapy (anti -LAG-3, anti-PD-1, anti-PD-L1, or anti-CTLA-4 antibody, or any other antibody or drug specifically targeting T-cell co-stimulation or checkpoint pathways) with regorafenib or with TAS- 102.
  • immunotherapy anti -LAG-3, anti-PD-1, anti-PD-L1, or anti-CTLA-4 antibody, or any other antibody or drug specifically targeting T-cell co-stimulation or checkpoint pathways
  • Stratification factors for randomization will be PD-L1 combined positive score (CPS) expression level (> 1 vs ⁇ 1 [including indeterminate expression]), region (Asia vs US/Canada/Westem Europe/ Australia vs Rest of World), and KRAS status (wild-type vs mutant/amplified).
  • CPS combined positive score
  • PD-L1 expression on tumor and immune cells will be measured using analytically validated immunohistochemical (IHC) assay.
  • IHC immunohistochemical
  • PD-L1 expression will be assessed primarily based on a CPS, defined as the number of PD-L1 staining cells (tumor cells, lymphocytes, macrophages) divided by the total number of viable tumor cells, multiplied by 100.
  • PD-L1 positivity will be defined by CPS >1.
  • PD-L1 may be also assessed by tumor proportion score (TPS), which reflects the percentage of tumor cells that are positive for PD-L1 expression.
  • TPS tumor proportion score
  • IHC analysis will also be used to evaluate an association between tumor LAG- 3 status (defined as the percentage of LAG-3 + cells in a tumor specimen) and treatment efficacy and/or safety.
  • the effect of LAG-3 positivity using 1% threshold and, potentially, other cutoff levels will be interrogated retrospectively.
  • Relatlimab-nivolumab FDC administration will continue until progression, toxicity, withdrawal of consent, or a maximum of 2 years, whichever occurs first. Continuous safety evaluations and tumor assessments will guide the decision to treat a participant with additional cycles of study therapy if the participant has confirmed clinical benefit.
  • DASNRAT SEQ ID NO: 10 Light Chain CDR3 Amino Acid Sequence; Anti-LAG-3 mAh (BMS-986016)
  • GGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQ FNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTI SKAKGQPREPQVYTLPPSQ EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKS RWQEGNVFSCSVMHEALHNHYTQKSLSLSLG

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2023/063254 2022-02-25 2023-02-24 Combination therapy for colorectal carcinoma Ceased WO2023164638A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
JP2024550304A JP2025507694A (ja) 2022-02-25 2023-02-24 結腸直腸癌に対する組み合わせ療法
EP23713540.5A EP4482866A1 (en) 2022-02-25 2023-02-24 Combination therapy for colorectal carcinoma
IL314713A IL314713A (en) 2022-02-25 2023-02-24 Combined therapy for colorectal carcinoma
US18/841,061 US20250179174A1 (en) 2022-02-25 2023-02-24 Combination therapy for colorectal carcinoma
AU2023226078A AU2023226078A1 (en) 2022-02-25 2023-02-24 Combination therapy for colorectal carcinoma.
KR1020247031403A KR20240153583A (ko) 2022-02-25 2023-02-24 결장직장암종에 대한 병용 요법
CA3251366A CA3251366A1 (en) 2022-02-25 2023-02-24 POLYTHERAPY AGAINST COLORECTAL CARCINOMA
MX2024010310A MX2024010310A (es) 2022-02-25 2023-02-24 Terapia de combinacion para carcinoma colorrectal.
CN202380023726.4A CN118765284A (zh) 2022-02-25 2023-02-24 结直肠癌的组合疗法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202263314137P 2022-02-25 2022-02-25
US63/314,137 2022-02-25

Publications (2)

Publication Number Publication Date
WO2023164638A1 true WO2023164638A1 (en) 2023-08-31
WO2023164638A8 WO2023164638A8 (en) 2023-10-05

Family

ID=85772763

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2023/063254 Ceased WO2023164638A1 (en) 2022-02-25 2023-02-24 Combination therapy for colorectal carcinoma

Country Status (10)

Country Link
US (1) US20250179174A1 (cg-RX-API-DMAC7.html)
EP (1) EP4482866A1 (cg-RX-API-DMAC7.html)
JP (1) JP2025507694A (cg-RX-API-DMAC7.html)
KR (1) KR20240153583A (cg-RX-API-DMAC7.html)
CN (1) CN118765284A (cg-RX-API-DMAC7.html)
AU (1) AU2023226078A1 (cg-RX-API-DMAC7.html)
CA (1) CA3251366A1 (cg-RX-API-DMAC7.html)
IL (1) IL314713A (cg-RX-API-DMAC7.html)
MX (1) MX2024010310A (cg-RX-API-DMAC7.html)
WO (1) WO2023164638A1 (cg-RX-API-DMAC7.html)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025245489A1 (en) 2024-05-24 2025-11-27 Bristol-Myers Squibb Company Treatment of tumors in subjects having fgl-1 positive samples

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AR122043A1 (es) * 2020-05-12 2022-08-03 Bristol Myers Squibb Co Dosificación y administración del anticuerpo anti-ctla-4 activable
KR20230093282A (ko) 2020-10-23 2023-06-27 브리스톨-마이어스 스큅 컴퍼니 폐암에 대한 lag-3 길항제 요법

Citations (85)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5977318A (en) 1991-06-27 1999-11-02 Bristol Myers Squibb Company CTLA4 receptor and uses thereof
US6051227A (en) 1995-07-25 2000-04-18 The Regents Of The University Of California, Office Of Technology Transfer Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling
WO2000037504A2 (en) 1998-12-23 2000-06-29 Pfizer Inc. Human monoclonal antibodies to ctla-4
US6682736B1 (en) 1998-12-23 2004-01-27 Abgenix, Inc. Human monoclonal antibodies to CTLA-4
US6808710B1 (en) 1999-08-23 2004-10-26 Genetics Institute, Inc. Downmodulating an immune response with multivalent antibodies to PD-1
US6984720B1 (en) 1999-08-24 2006-01-10 Medarex, Inc. Human CTLA-4 antibodies
US7034121B2 (en) 2000-01-27 2006-04-25 Genetics Institue, Llc Antibodies against CTLA4
WO2007113648A2 (en) 2006-04-05 2007-10-11 Pfizer Products Inc. Ctla4 antibody combination therapy
WO2008156712A1 (en) 2007-06-18 2008-12-24 N. V. Organon Antibodies to human programmed death receptor pd-1
US7488802B2 (en) 2002-12-23 2009-02-10 Wyeth Antibodies against PD-1
WO2009044273A2 (en) 2007-10-05 2009-04-09 Immutep Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response
US7767429B2 (en) 2003-03-05 2010-08-03 Halozyme, Inc. Soluble hyaluronidase glycoprotein (sHASEGP), process for preparing the same, uses and pharmaceutical compositions comprising thereof
US20110007023A1 (en) 2009-07-09 2011-01-13 Sony Ericsson Mobile Communications Ab Display device, touch screen device comprising the display device, mobile device and method for sensing a force on a display device
US7943743B2 (en) 2005-07-01 2011-05-17 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
WO2011066389A1 (en) 2009-11-24 2011-06-03 Medimmmune, Limited Targeted binding agents against b7-h1
US20110150892A1 (en) 2008-08-11 2011-06-23 Medarex, Inc. Human antibodies that bind lymphocyte activation gene-3 (lag-3) and uses thereof
US8008449B2 (en) 2005-05-09 2011-08-30 Medarex, Inc. Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
US8168757B2 (en) 2008-03-12 2012-05-01 Merck Sharp & Dohme Corp. PD-1 binding proteins
US8217149B2 (en) 2008-12-09 2012-07-10 Genentech, Inc. Anti-PD-L1 antibodies, compositions and articles of manufacture
WO2012122444A1 (en) 2011-03-10 2012-09-13 Provectus Pharmaceuticals, Inc. Combination of local and systemic immunomodulative therapies for enhanced treatment of cancer
WO2012145493A1 (en) 2011-04-20 2012-10-26 Amplimmune, Inc. Antibodies and other molecules that bind b7-h1 and pd-1
WO2013079174A1 (en) 2011-11-28 2013-06-06 Merck Patent Gmbh Anti-pd-l1 antibodies and uses thereof
WO2013173223A1 (en) 2012-05-15 2013-11-21 Bristol-Myers Squibb Company Cancer immunotherapy by disrupting pd-1/pd-l1 signaling
WO2013181634A2 (en) 2012-05-31 2013-12-05 Sorrento Therapeutics Inc. Antigen binding proteins that bind pd-l1
US20140093511A1 (en) 2012-07-02 2014-04-03 Bristol-Myers Squibb Company Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof
WO2014140180A1 (en) 2013-03-15 2014-09-18 Glaxosmithkline Intellectual Property Development Limited Anti-lag-3 binding proteins
WO2014179664A2 (en) 2013-05-02 2014-11-06 Anaptysbio, Inc. Antibodies directed against programmed death-1 (pd-1)
WO2014194302A2 (en) 2013-05-31 2014-12-04 Sorrento Therapeutics, Inc. Antigen binding proteins that bind pd-1
WO2014206107A1 (zh) 2013-06-26 2014-12-31 上海君实生物医药科技有限公司 抗pd-1抗体及其应用
WO2015035606A1 (en) 2013-09-13 2015-03-19 Beigene, Ltd. Anti-pd1 antibodies and their use as therapeutics and diagnostics
WO2015042246A1 (en) 2013-09-20 2015-03-26 Bristol-Myers Squibb Company Combination of anti-lag-3 antibodies and anti-pd-1 antibodies to treat tumors
WO2015085847A1 (zh) 2013-12-12 2015-06-18 上海恒瑞医药有限公司 Pd-1抗体、其抗原结合片段及其医药用途
WO2015112800A1 (en) 2014-01-23 2015-07-30 Regeneron Pharmaceuticals, Inc. Human antibodies to pd-1
WO2015112900A1 (en) 2014-01-24 2015-07-30 Dana-Farber Cancer Institue, Inc. Antibody molecules to pd-1 and uses thereof
WO2015200119A1 (en) 2014-06-26 2015-12-30 Macrogenics, Inc. Covalently bonded diabodies having immunoreactivity with pd-1 and lag-3, and methods of use thereof
WO2016028672A1 (en) 2014-08-19 2016-02-25 Merck Sharp & Dohme Corp. Anti-lag3 antibodies and antigen-binding fragments
US20160159905A1 (en) 2014-12-09 2016-06-09 Rinat Neuroscience Corp. Anti-pd-1 antibodies and methods of use thereof
WO2016106159A1 (en) 2014-12-22 2016-06-30 Enumeral Biomedical Holding, Inc. Anti-pd-1 antibodies
WO2016126858A2 (en) 2015-02-03 2016-08-11 Anaptysbio, Inc. Antibodies directed against lymphocyte activation gene 3 (lag-3)
WO2016149201A2 (en) 2015-03-13 2016-09-22 Cytomx Therapeutics, Inc. Anti-pdl1 antibodies, activatable anti-pdl1 antibodies, and methods of use thereof
WO2016196237A1 (en) 2015-05-29 2016-12-08 Agenus Inc. Anti-ctla-4 antibodies and methods of use thereof
WO2016200782A1 (en) 2015-06-08 2016-12-15 Macrogenics, Inc. Lag-3-binding molecules and methods of use thereof
WO2016197367A1 (en) 2015-06-11 2016-12-15 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-l1 antibodies
WO2017015560A2 (en) 2015-07-22 2017-01-26 Sorrento Therapeutics, Inc. Antibody therapeutics that bind lag3
WO2017019846A1 (en) 2015-07-30 2017-02-02 Macrogenics, Inc. Pd-1-binding molecules and methods use thereof
WO2017019894A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to lag-3
WO2017020291A1 (en) 2015-08-06 2017-02-09 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-l1 antibodies
WO2017024515A1 (en) 2015-08-11 2017-02-16 Wuxi Biologics (Cayman) Inc. Novel anti-pd-1 antibodies
WO2017024465A1 (en) 2015-08-10 2017-02-16 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017025051A1 (en) 2015-08-11 2017-02-16 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-1 antibodies
WO2017025498A1 (en) 2015-08-07 2017-02-16 Pieris Pharmaceuticals Gmbh Novel fusion polypeptide specific for lag-3 and pd-1
WO2017034916A1 (en) 2015-08-24 2017-03-02 Eli Lilly And Company Pd-l1 ("programmed death-ligand 1") antibodies
WO2017040790A1 (en) 2015-09-01 2017-03-09 Agenus Inc. Anti-pd-1 antibodies and methods of use thereof
WO2017062888A1 (en) 2015-10-09 2017-04-13 Regeneron Pharmaceuticals, Inc. Anti-lag3 antibodies and uses thereof
WO2017086367A1 (ja) 2015-11-18 2017-05-26 中外製薬株式会社 免疫抑制機能を有する細胞に対するt細胞リダイレクト抗原結合分子を用いた併用療法
WO2017086419A1 (ja) 2015-11-18 2017-05-26 中外製薬株式会社 液性免疫応答の増強方法
WO2017087589A2 (en) 2015-11-18 2017-05-26 Merck Sharp & Dohme Corp. Pd1 and/or lag3 binders
WO2017087901A2 (en) 2015-11-19 2017-05-26 Sutro Biopharma, Inc. Anti-lag3 antibodies, compositions comprising anti-lag3 antibodies and methods of making and using anti-lag3 antibodies
WO2017106061A1 (en) 2015-12-14 2017-06-22 Macrogenics, Inc. Bispecific molecules having immunoreactivity with pd-1 and ctla-4, and methods of use thereof
WO2017106129A1 (en) 2015-12-16 2017-06-22 Merck Sharp & Dohme Corp. Anti-lag3 antibodies and antigen-binding fragments
WO2017123557A1 (en) 2016-01-11 2017-07-20 Armo Biosciences, Inc. Interleukin-10 in production of antigen-specific cd8+ t cells and methods of use of same
WO2017132825A1 (zh) 2016-02-02 2017-08-10 华为技术有限公司 确定发射功率的方法、用户设备和基站
WO2017132827A1 (en) 2016-02-02 2017-08-10 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017149143A1 (en) 2016-03-04 2017-09-08 Agency For Science, Technology And Research Anti-lag-3 antibodies
US20170260271A1 (en) 2014-05-13 2017-09-14 Chugai Seiyaku Kabushiki Kaisha T Cell-Redirected Antigen-Binding Molecule For Cells Having Immunosuppression Function
WO2017198741A1 (en) 2016-05-18 2017-11-23 Boehringer Ingelheim International Gmbh Anti pd-1 and anti-lag3 antibodies for cancer treatment
WO2017220555A1 (en) 2016-06-20 2017-12-28 F-Star Beta Limited Lag -3 binding members
WO2017220569A1 (en) 2016-06-20 2017-12-28 F-Star Delta Limited Binding molecules binding pd-l1 and lag-3
WO2017219995A1 (zh) 2016-06-23 2017-12-28 江苏恒瑞医药股份有限公司 Lag-3抗体、其抗原结合片段及其医药用途
WO2018034227A1 (ja) 2016-08-15 2018-02-22 国立大学法人北海道大学 抗lag-3抗体
WO2018071500A1 (en) 2016-10-11 2018-04-19 Agenus Inc. Anti-lag-3 antibodies and methods of use thereof
WO2018069500A2 (en) 2016-10-13 2018-04-19 Symphogen A/S Anti-lag-3 antibodies and compositions
WO2018083087A2 (en) 2016-11-02 2018-05-11 Glaxosmithkline Intellectual Property (No.2) Limited Binding proteins
WO2018185046A1 (en) 2017-04-05 2018-10-11 F. Hoffmann-La Roche Ag Anti-lag3 antibodies
WO2018185043A1 (en) 2017-04-05 2018-10-11 F. Hoffmann-La Roche Ag Bispecific antibodies specifically binding to pd1 and lag3
WO2018201096A1 (en) 2017-04-27 2018-11-01 Tesaro, Inc. Antibody agents directed against lymphocyte activation gene-3 (lag-3) and uses thereof
WO2018204374A1 (en) 2017-05-02 2018-11-08 Merck Sharp & Dohme Corp. Formulations of anti-lag3 antibodies and co-formulations of anti-lag3 antibodies and anti-pd-1 antibodies
WO2018208868A1 (en) 2017-05-10 2018-11-15 Smet Pharmaceutical Inc Human monoclonal antibodies against lag3 and uses thereof
WO2018217940A2 (en) 2017-05-24 2018-11-29 Sutro Biopharma, Inc. Pd-1/lag3 bi-specific antibodies, compositions thereof, and methods of making and using the same
US20180346569A1 (en) 2015-11-18 2018-12-06 Lyvgen Biopharma Holdings Limited Anti-pd-1 antibodies and therapeutic uses thereof
WO2019011306A1 (en) 2017-07-13 2019-01-17 Nanjing Leads Biolabs Co., Ltd. LAG-3 BINDING ANTIBODIES AND USES THEREOF
WO2019018730A1 (en) 2017-07-20 2019-01-24 Novartis Ag DOSAGE REGIMES FOR ANTI-LAG3 ANTIBODIES AND USES THEREOF
WO2019099838A1 (en) * 2017-11-16 2019-05-23 Novartis Ag Combination therapies
WO2020055702A1 (en) * 2018-09-13 2020-03-19 Merck Sharp & Dohme Corp. Combination of pd-1 antagonist and lag3 antagonist for treating non-microsatellite instablity-high/proficient mismatch repair colorectal cancer
US10711060B2 (en) 2014-03-14 2020-07-14 Novartis Ag Antibody molecules to LAG-3 and uses thereof

Patent Citations (100)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5977318A (en) 1991-06-27 1999-11-02 Bristol Myers Squibb Company CTLA4 receptor and uses thereof
US6051227A (en) 1995-07-25 2000-04-18 The Regents Of The University Of California, Office Of Technology Transfer Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling
WO2000037504A2 (en) 1998-12-23 2000-06-29 Pfizer Inc. Human monoclonal antibodies to ctla-4
US6682736B1 (en) 1998-12-23 2004-01-27 Abgenix, Inc. Human monoclonal antibodies to CTLA-4
US6808710B1 (en) 1999-08-23 2004-10-26 Genetics Institute, Inc. Downmodulating an immune response with multivalent antibodies to PD-1
US6984720B1 (en) 1999-08-24 2006-01-10 Medarex, Inc. Human CTLA-4 antibodies
US7034121B2 (en) 2000-01-27 2006-04-25 Genetics Institue, Llc Antibodies against CTLA4
US7488802B2 (en) 2002-12-23 2009-02-10 Wyeth Antibodies against PD-1
US7767429B2 (en) 2003-03-05 2010-08-03 Halozyme, Inc. Soluble hyaluronidase glycoprotein (sHASEGP), process for preparing the same, uses and pharmaceutical compositions comprising thereof
US8008449B2 (en) 2005-05-09 2011-08-30 Medarex, Inc. Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
US8779105B2 (en) 2005-05-09 2014-07-15 Medarex, L.L.C. Monoclonal antibodies to programmed death 1 (PD-1)
US9580507B2 (en) 2005-07-01 2017-02-28 E.R. Squibb & Sons, L. L. C. Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
US7943743B2 (en) 2005-07-01 2011-05-17 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
WO2007113648A2 (en) 2006-04-05 2007-10-11 Pfizer Products Inc. Ctla4 antibody combination therapy
US8354509B2 (en) 2007-06-18 2013-01-15 Msd Oss B.V. Antibodies to human programmed death receptor PD-1
US8900587B2 (en) 2007-06-18 2014-12-02 Merck Sharp & Dohme Corp. Antibodies to human programmed death receptor PD-1
WO2008156712A1 (en) 2007-06-18 2008-12-24 N. V. Organon Antibodies to human programmed death receptor pd-1
WO2009044273A2 (en) 2007-10-05 2009-04-09 Immutep Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response
US8168757B2 (en) 2008-03-12 2012-05-01 Merck Sharp & Dohme Corp. PD-1 binding proteins
US20110150892A1 (en) 2008-08-11 2011-06-23 Medarex, Inc. Human antibodies that bind lymphocyte activation gene-3 (lag-3) and uses thereof
US8217149B2 (en) 2008-12-09 2012-07-10 Genentech, Inc. Anti-PD-L1 antibodies, compositions and articles of manufacture
US20110007023A1 (en) 2009-07-09 2011-01-13 Sony Ericsson Mobile Communications Ab Display device, touch screen device comprising the display device, mobile device and method for sensing a force on a display device
WO2011066389A1 (en) 2009-11-24 2011-06-03 Medimmmune, Limited Targeted binding agents against b7-h1
WO2012122444A1 (en) 2011-03-10 2012-09-13 Provectus Pharmaceuticals, Inc. Combination of local and systemic immunomodulative therapies for enhanced treatment of cancer
WO2012145493A1 (en) 2011-04-20 2012-10-26 Amplimmune, Inc. Antibodies and other molecules that bind b7-h1 and pd-1
WO2013079174A1 (en) 2011-11-28 2013-06-06 Merck Patent Gmbh Anti-pd-l1 antibodies and uses thereof
WO2013173223A1 (en) 2012-05-15 2013-11-21 Bristol-Myers Squibb Company Cancer immunotherapy by disrupting pd-1/pd-l1 signaling
WO2013181634A2 (en) 2012-05-31 2013-12-05 Sorrento Therapeutics Inc. Antigen binding proteins that bind pd-l1
US20140093511A1 (en) 2012-07-02 2014-04-03 Bristol-Myers Squibb Company Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof
WO2014140180A1 (en) 2013-03-15 2014-09-18 Glaxosmithkline Intellectual Property Development Limited Anti-lag-3 binding proteins
WO2014179664A2 (en) 2013-05-02 2014-11-06 Anaptysbio, Inc. Antibodies directed against programmed death-1 (pd-1)
WO2014194302A2 (en) 2013-05-31 2014-12-04 Sorrento Therapeutics, Inc. Antigen binding proteins that bind pd-1
WO2014206107A1 (zh) 2013-06-26 2014-12-31 上海君实生物医药科技有限公司 抗pd-1抗体及其应用
US20160272708A1 (en) 2013-06-26 2016-09-22 Shanghai Junshi Biosciences Inc. Anti-pd-1 antibody and use thereof
WO2015035606A1 (en) 2013-09-13 2015-03-19 Beigene, Ltd. Anti-pd1 antibodies and their use as therapeutics and diagnostics
US20150079109A1 (en) 2013-09-13 2015-03-19 Beigene, Ltd. Anti-PD1 Antibodies and their Use as Therapeutics and Diagnostics
WO2015042246A1 (en) 2013-09-20 2015-03-26 Bristol-Myers Squibb Company Combination of anti-lag-3 antibodies and anti-pd-1 antibodies to treat tumors
WO2015085847A1 (zh) 2013-12-12 2015-06-18 上海恒瑞医药有限公司 Pd-1抗体、其抗原结合片段及其医药用途
WO2015112800A1 (en) 2014-01-23 2015-07-30 Regeneron Pharmaceuticals, Inc. Human antibodies to pd-1
US9987500B2 (en) 2014-01-23 2018-06-05 Regeneron Pharmaceuticals, Inc. Human antibodies to PD-1
WO2015112900A1 (en) 2014-01-24 2015-07-30 Dana-Farber Cancer Institue, Inc. Antibody molecules to pd-1 and uses thereof
US9683048B2 (en) 2014-01-24 2017-06-20 Novartis Ag Antibody molecules to PD-1 and uses thereof
US10711060B2 (en) 2014-03-14 2020-07-14 Novartis Ag Antibody molecules to LAG-3 and uses thereof
US20170260271A1 (en) 2014-05-13 2017-09-14 Chugai Seiyaku Kabushiki Kaisha T Cell-Redirected Antigen-Binding Molecule For Cells Having Immunosuppression Function
WO2015200119A1 (en) 2014-06-26 2015-12-30 Macrogenics, Inc. Covalently bonded diabodies having immunoreactivity with pd-1 and lag-3, and methods of use thereof
WO2016028672A1 (en) 2014-08-19 2016-02-25 Merck Sharp & Dohme Corp. Anti-lag3 antibodies and antigen-binding fragments
US10188730B2 (en) 2014-08-19 2019-01-29 Merck Sharp & Dohme Corp. Anti-LAG3 antibodies and antigen-binding fragments
US20160159905A1 (en) 2014-12-09 2016-06-09 Rinat Neuroscience Corp. Anti-pd-1 antibodies and methods of use thereof
WO2016106159A1 (en) 2014-12-22 2016-06-30 Enumeral Biomedical Holding, Inc. Anti-pd-1 antibodies
WO2016126858A2 (en) 2015-02-03 2016-08-11 Anaptysbio, Inc. Antibodies directed against lymphocyte activation gene 3 (lag-3)
WO2016149201A2 (en) 2015-03-13 2016-09-22 Cytomx Therapeutics, Inc. Anti-pdl1 antibodies, activatable anti-pdl1 antibodies, and methods of use thereof
WO2016196237A1 (en) 2015-05-29 2016-12-08 Agenus Inc. Anti-ctla-4 antibodies and methods of use thereof
WO2016200782A1 (en) 2015-06-08 2016-12-15 Macrogenics, Inc. Lag-3-binding molecules and methods of use thereof
WO2016197367A1 (en) 2015-06-11 2016-12-15 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-l1 antibodies
WO2017015560A2 (en) 2015-07-22 2017-01-26 Sorrento Therapeutics, Inc. Antibody therapeutics that bind lag3
WO2017019894A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to lag-3
WO2017019846A1 (en) 2015-07-30 2017-02-02 Macrogenics, Inc. Pd-1-binding molecules and methods use thereof
WO2017020291A1 (en) 2015-08-06 2017-02-09 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-l1 antibodies
WO2017020858A1 (en) 2015-08-06 2017-02-09 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-l1 antibodies
WO2017025498A1 (en) 2015-08-07 2017-02-16 Pieris Pharmaceuticals Gmbh Novel fusion polypeptide specific for lag-3 and pd-1
WO2017024465A1 (en) 2015-08-10 2017-02-16 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017025016A1 (en) 2015-08-10 2017-02-16 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017025051A1 (en) 2015-08-11 2017-02-16 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-1 antibodies
WO2017024515A1 (en) 2015-08-11 2017-02-16 Wuxi Biologics (Cayman) Inc. Novel anti-pd-1 antibodies
WO2017034916A1 (en) 2015-08-24 2017-03-02 Eli Lilly And Company Pd-l1 ("programmed death-ligand 1") antibodies
WO2017040790A1 (en) 2015-09-01 2017-03-09 Agenus Inc. Anti-pd-1 antibodies and methods of use thereof
WO2017062888A1 (en) 2015-10-09 2017-04-13 Regeneron Pharmaceuticals, Inc. Anti-lag3 antibodies and uses thereof
US10358495B2 (en) 2015-10-09 2019-07-23 Regeneron Pharmaceuticals, Inc. Anti-LAG3 antibodies and uses thereof
US20180346569A1 (en) 2015-11-18 2018-12-06 Lyvgen Biopharma Holdings Limited Anti-pd-1 antibodies and therapeutic uses thereof
WO2017087589A2 (en) 2015-11-18 2017-05-26 Merck Sharp & Dohme Corp. Pd1 and/or lag3 binders
WO2017086419A1 (ja) 2015-11-18 2017-05-26 中外製薬株式会社 液性免疫応答の増強方法
WO2017086367A1 (ja) 2015-11-18 2017-05-26 中外製薬株式会社 免疫抑制機能を有する細胞に対するt細胞リダイレクト抗原結合分子を用いた併用療法
WO2017087901A2 (en) 2015-11-19 2017-05-26 Sutro Biopharma, Inc. Anti-lag3 antibodies, compositions comprising anti-lag3 antibodies and methods of making and using anti-lag3 antibodies
WO2017106061A1 (en) 2015-12-14 2017-06-22 Macrogenics, Inc. Bispecific molecules having immunoreactivity with pd-1 and ctla-4, and methods of use thereof
WO2017106129A1 (en) 2015-12-16 2017-06-22 Merck Sharp & Dohme Corp. Anti-lag3 antibodies and antigen-binding fragments
WO2017123557A1 (en) 2016-01-11 2017-07-20 Armo Biosciences, Inc. Interleukin-10 in production of antigen-specific cd8+ t cells and methods of use of same
WO2017133540A1 (en) 2016-02-02 2017-08-10 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017132827A1 (en) 2016-02-02 2017-08-10 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017132825A1 (zh) 2016-02-02 2017-08-10 华为技术有限公司 确定发射功率的方法、用户设备和基站
WO2017149143A1 (en) 2016-03-04 2017-09-08 Agency For Science, Technology And Research Anti-lag-3 antibodies
WO2017198741A1 (en) 2016-05-18 2017-11-23 Boehringer Ingelheim International Gmbh Anti pd-1 and anti-lag3 antibodies for cancer treatment
WO2017220569A1 (en) 2016-06-20 2017-12-28 F-Star Delta Limited Binding molecules binding pd-l1 and lag-3
WO2017220555A1 (en) 2016-06-20 2017-12-28 F-Star Beta Limited Lag -3 binding members
WO2017219995A1 (zh) 2016-06-23 2017-12-28 江苏恒瑞医药股份有限公司 Lag-3抗体、其抗原结合片段及其医药用途
WO2018034227A1 (ja) 2016-08-15 2018-02-22 国立大学法人北海道大学 抗lag-3抗体
WO2018071500A1 (en) 2016-10-11 2018-04-19 Agenus Inc. Anti-lag-3 antibodies and methods of use thereof
WO2018069500A2 (en) 2016-10-13 2018-04-19 Symphogen A/S Anti-lag-3 antibodies and compositions
WO2018083087A2 (en) 2016-11-02 2018-05-11 Glaxosmithkline Intellectual Property (No.2) Limited Binding proteins
WO2018185046A1 (en) 2017-04-05 2018-10-11 F. Hoffmann-La Roche Ag Anti-lag3 antibodies
WO2018185043A1 (en) 2017-04-05 2018-10-11 F. Hoffmann-La Roche Ag Bispecific antibodies specifically binding to pd1 and lag3
WO2018201096A1 (en) 2017-04-27 2018-11-01 Tesaro, Inc. Antibody agents directed against lymphocyte activation gene-3 (lag-3) and uses thereof
US20200055938A1 (en) 2017-05-02 2020-02-20 Merck Sharp & Dohme Corp. Formulations of anti-lag3 antibodies and co-formulations of anti-lag3 antibodies and anti-pd-1 antibodies
WO2018204374A1 (en) 2017-05-02 2018-11-08 Merck Sharp & Dohme Corp. Formulations of anti-lag3 antibodies and co-formulations of anti-lag3 antibodies and anti-pd-1 antibodies
WO2018208868A1 (en) 2017-05-10 2018-11-15 Smet Pharmaceutical Inc Human monoclonal antibodies against lag3 and uses thereof
WO2018217940A2 (en) 2017-05-24 2018-11-29 Sutro Biopharma, Inc. Pd-1/lag3 bi-specific antibodies, compositions thereof, and methods of making and using the same
WO2019011306A1 (en) 2017-07-13 2019-01-17 Nanjing Leads Biolabs Co., Ltd. LAG-3 BINDING ANTIBODIES AND USES THEREOF
WO2019018730A1 (en) 2017-07-20 2019-01-24 Novartis Ag DOSAGE REGIMES FOR ANTI-LAG3 ANTIBODIES AND USES THEREOF
US20200172617A1 (en) 2017-07-20 2020-06-04 Novartis Ag Dosage regimens of anti-lag-3 antibodies and uses thereof
WO2019099838A1 (en) * 2017-11-16 2019-05-23 Novartis Ag Combination therapies
WO2020055702A1 (en) * 2018-09-13 2020-03-19 Merck Sharp & Dohme Corp. Combination of pd-1 antagonist and lag3 antagonist for treating non-microsatellite instablity-high/proficient mismatch repair colorectal cancer

Non-Patent Citations (21)

* Cited by examiner, † Cited by third party
Title
"GenBank", Database accession no. NP_032505
"Oxford Dictionary Of Biochemistry And Molecular Biology", 2006, OXFORD UNIVERSITY PRESS
BIOCAD; KAPLON ET AL., MABS, vol. 10, no. 2, 2018, pages 183 - 203
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BUROVA E ET AL., J. IMMUNOTHER. CANCER, vol. 4, 2016, pages 195
DESAI ET AL., JCO, vol. 36, 2018, pages TPS3113
GORELIK ET AL., AACR, April 2016 (2016-04-01)
HERBST ET AL., J CLIN ONCOL, vol. 31, 2013, pages 3000
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
JUO, PEI-SHOW: "Concise Dictionary of Biomedicine and Molecular Biology", 2002, CRC PRESS
LIZARDO DARLENY Y ET AL: "Immunotherapy efficacy on mismatch repair-deficient colorectal cancer: From bench to bedside", BIOCHIMICA ET BIOPHYSICA ACTA (BBA) - REVIEWS ON CANCER, ELSEVIER SCIENCE BV, AMSTERDAM, NL, vol. 1874, no. 2, 6 October 2020 (2020-10-06), XP086363962, ISSN: 0304-419X, [retrieved on 20201006], DOI: 10.1016/J.BBCAN.2020.188447 *
MATSUZAKI, J ET AL., PNAS, vol. 107, 2010, pages 7875
RIBAS, UPDATE CANCER THER, vol. 2, no. 3, 2007, pages 133 - 39
SI-YANG LIU ET AL., HEMATOL. ONCOL, vol. 10, 2017, pages 136
SI-YANG LIU ET AL., J. HEMATOL. ONCOL, vol. 10, 2017, pages 136
SI-YANG LIU ET AL., J. HEMATOL. ONCOL., vol. 10, 2017, pages 136
WANG ET AL., CANCER IMMUNOL RES, vol. 2, no. 9, 2014, pages 846 - 56
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 46
YU XIAOJIE ET AL: "Characterization of a novel anti-human lymphocyte activation gene 3 (LAG-3) antibody for cancer immunotherapy", MABS, vol. 11, no. 6, 18 August 2019 (2019-08-18), US, pages 1139 - 1148, XP055825981, ISSN: 1942-0862, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6748621/pdf/kmab-11-06-1629239.pdf> DOI: 10.1080/19420862.2019.1629239 *
ZETTL M ET AL., CANCER. RES, vol. 78, 2018
ZHANG ET AL., CELL DISCOV., vol. 7, March 2017 (2017-03-01), pages 3

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025245489A1 (en) 2024-05-24 2025-11-27 Bristol-Myers Squibb Company Treatment of tumors in subjects having fgl-1 positive samples

Also Published As

Publication number Publication date
CA3251366A1 (en) 2023-08-31
IL314713A (en) 2024-10-01
KR20240153583A (ko) 2024-10-23
MX2024010310A (es) 2024-08-28
CN118765284A (zh) 2024-10-11
WO2023164638A8 (en) 2023-10-05
EP4482866A1 (en) 2025-01-01
AU2023226078A1 (en) 2024-08-22
JP2025507694A (ja) 2025-03-21
US20250179174A1 (en) 2025-06-05

Similar Documents

Publication Publication Date Title
US12565528B2 (en) LAG-3 antagonist therapy for lung cancer
EP4482866A1 (en) Combination therapy for colorectal carcinoma
US20230265188A1 (en) Lag-3 antagonist therapy for hepatocellular carcinoma
EP4469477A1 (en) Combination therapy for hepatocellular carcinoma
JP2022549273A (ja) Lag-3アンタゴニスト治療のための定量的空間プロファイリング
US20240417473A1 (en) Lag-3 antagonist therapy for hematological cancer
EP4638503A1 (en) Combination therapy for lung cancer
WO2025245489A1 (en) Treatment of tumors in subjects having fgl-1 positive samples

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23713540

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: AU23226078

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2023226078

Country of ref document: AU

Date of ref document: 20230224

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2024/010310

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2024550304

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 202380023726.4

Country of ref document: CN

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024017306

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20247031403

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202492199

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 2023713540

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 11202405710V

Country of ref document: SG

ENP Entry into the national phase

Ref document number: 2023713540

Country of ref document: EP

Effective date: 20240925

ENP Entry into the national phase

Ref document number: 112024017306

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240823

WWP Wipo information: published in national office

Ref document number: 18841061

Country of ref document: US