WO2023147488A1 - Cytokine associated tumor infiltrating lymphocytes compositions and methods - Google Patents
Cytokine associated tumor infiltrating lymphocytes compositions and methods Download PDFInfo
- Publication number
- WO2023147488A1 WO2023147488A1 PCT/US2023/061474 US2023061474W WO2023147488A1 WO 2023147488 A1 WO2023147488 A1 WO 2023147488A1 US 2023061474 W US2023061474 W US 2023061474W WO 2023147488 A1 WO2023147488 A1 WO 2023147488A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- tils
- population
- expansion
- days
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4231—Cytokines
- A61K40/4234—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5443—IL-15
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
- C12N5/0638—Cytotoxic T lymphocytes [CTL] or lymphokine activated killer cells [LAK]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/20—Cytokines; Chemokines
- C12N2501/23—Interleukins [IL]
- C12N2501/2302—Interleukin-2 (IL-2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/50—Cell markers; Cell surface determinants
- C12N2501/515—CD3, T-cell receptor complex
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/60—Transcription factors
- C12N2501/603—Oct-3/4
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2502/00—Coculture with; Conditioned medium produced by
- C12N2502/30—Coculture with; Conditioned medium produced by tumour cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15041—Use of virus, viral particle or viral elements as a vector
- C12N2740/15043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- compositions and methods for the treatment of cancers using modified TILs wherein the modified TILs include one or more immunomodulatory agents (e.g., cytokines) associated with their cell surface.
- immunomodulatory agents e.g., cytokines
- the immunomodulatory agents associated with the TILs provide a localized immunostimulatory effect that can advantageously enhance TIL survival, proliferation and/or anti-tumor activity in a patient recipient.
- the compositions and methods disclosed herein provide effective cancer therapies.
- TILs tumor infiltrating lymphocytes
- a method of treating a cancer in a patient or subject in need thereof comprising administering a population of modified tumor infiltrating lymphocytes (TILs), the method comprising the steps of: (a) obtaining and/or receiving a first population of TILs from a tumor resected from the subject or patient by processing a tumor sample obtained from the subject into multiple tumor fragments; (b) adding the first population of TILs into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with
- a method of treating a cancer in a patient or subject in need thereof comprising administering a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: (a) obtaining a first population of TILs from a tumor resected from a subject by processing a tumor sample obtained from the subject into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-11 days to obtain the second population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3,
- a method of treating a cancer in a patient or subject in need thereof comprising administering a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: (a) obtaining and/or receiving a first population of TILs from surgical resection, needle biopsy, core biopsy, small biopsy, or other means for obtaining a sample that contains a mixture of tumor and TIL cells from the cancer in the patient or subject, (b) adding the first population of TILs into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-11 days to obtain the second population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplement
- a method of treating a cancer in a patient or subject in need thereof comprising administering a population of modified tumor infiltrating lymphocytes (TILs), the method comprising the steps of: (a) resecting a tumor from the subject or patient, the tumor comprising a first population of TILs, optionally from surgical resection, needle biopsy, core biopsy, small biopsy, or other means for obtaining a sample that contains a mixture of tumor and TIL cells from the cancer; (b) processing the tumor into multiple tumor fragments and adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-11 days to obtain the second population of TILs, and wherein the transition from step (b) to step (c)
- TILs modified tumor infiltrating
- a method of treating a cancer in a patient or subject in need thereof comprising administering a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: (a) obtaining and/or receiving a first population of TILs from surgical resection, needle biopsy, core biopsy, small biopsy, or other means for obtaining a sample that contains a mixture of tumor and TIL cells from the subject or patient; (c) contacting the first population of TILs with a first cell culture medium; (d) performing an initial expansion (or priming first expansion) of the first population of TILs in the first cell culture medium to obtain a second population of TILs, wherein the first cell culture medium comprises IL-2, optionally OKT-3 (anti-CD3 antibody), and optionally antigen presenting cells (APCs), where the priming first expansion occurs for a period of 1 to 8 days; (e) performing a rapid second expansion of the second population of TILs in a second cell culture medium to obtain
- TILs tumor infiltrating lymph
- a method of treating a cancer in a patient or subject in need thereof comprising administering a population of tumor infiltrating lymphocytes (TILs), the method comprising the steps of: (a) resecting a tumor from the cancer in the subject or patient, the tumor comprising a first population of TILs, optionally from surgical resection, needle biopsy, core biopsy, small biopsy, or other means for obtaining a sample that contains a mixture of tumor and TIL cells from the cancer; (b) fragmenting the tumor into tumor fragments; (c) contacting the tumor fragments with a first cell culture medium; (d) performing an initial expansion (or priming first expansion) of the first population of TILs in the first cell culture medium to obtain a second population of TILs, wherein the first cell culture medium comprises IL-2, optionally OKT-3 (anti-CD3 antibody), and optionally antigen presenting cells (APCs), where the priming first expansion occurs for a period of 1 to 8 days; (e
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) obtaining and/or receiving a first population of TILs from a tumor resected from a cancer in a subject by processing a tumor sample obtained from the tumor into multiple tumor fragments; (b) selecting PD-l positive TILs from the first population of TILs in step (a) to obtain a PD-l enriched TIL population; (c) performing a priming first expansion by culturing the PD-l enriched TIL population in a first cell culture medium comprising IL-2, OKT-3, and antigen presenting cells (APCs) to produce a second population of TILs, wherein the priming first expansion is performed in a container comprising a first gas-permeable surface area, wherein the priming first expansion is performed for first period of about 1 to 7/8 days to obtain the second population of TILs, wherein the second population of
- TILs tumor infiltrating lymphocytes
- the method comprising the steps of: (a) obtaining and/or receiving a first population of TILs from a tumor resected from a cancer in a subject or patient by processing a tumor sample obtained from the tumor into multiple tumor fragments; (b) adding the first population of TILs into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3,
- TILs tumor infiltrating lymphocytes
- the method comprising the steps of: (a) obtaining a first population of TILs from a tumor resected from a cancer in a subject by processing a tumor sample obtained from the tumor into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-11 days to obtain the second population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APC
- APC antigen presenting cells
- a method of expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising the steps of: (a) obtaining and/or receiving a first population of TILs from surgical resection, needle biopsy, core biopsy, small biopsy, or other means for obtaining a sample that contains a mixture of tumor and TIL cells from a cancer in a patient or subject, (b) adding the first population of TILs into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-11 days to obtain the second population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second
- a method of expanding tumor infiltrating lymphocytes (TILs) to a therapeutic population of TILs comprising the steps of: (a) resecting a tumor from a cancer in a subject or patient, the tumor comprising a first population of TILs, optionally from surgical resection, needle biopsy, core biopsy, small biopsy, or other means for obtaining a sample that contains a mixture of tumor and TIL cells from the cancer; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-11 days to obtain the second population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by
- the first expansion is divided into a first step and a second step, wherein the method further comprises performing the first step of the first expansion by culturing the first population of TILs in a cell culture medium containing IL-2 to produce TILs that egress from the tumor fragments or sample, separating TILs that remain in the tumor fragments or sample from TILs that egressed from the tumor fragments or sample, optionally digesting the tumor fragments or sample to produce a tumor digest, and performing the second step of the first expansion by culturing in the cell culture medium the TILs remaining in the tumor fragments or sample or tumor digest to produce the second population of TILs.
- a method of expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising the steps of: (a) obtaining and/or receiving a first population of TILs from surgical resection, needle biopsy, core biopsy, small biopsy, or other means for obtaining a sample that contains a mixture of tumor and TIL cells from a cancer in the subject or patient; (b) contacting the first population of TILs with a first cell culture medium; (c) performing an initial expansion (or priming first expansion) of the first population of TILs in the first cell culture medium to obtain a second population of TILs, wherein the first cell culture medium comprises IL-2, optionally OKT-3 (anti-CD3 antibody), and optionally antigen presenting cells (APCs), where the priming first expansion occurs for a period of 1 to 8 days; (d) performing a rapid second expansion of the second population of TILs in a second cell culture medium to obtain a third population of TILs
- a method of expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising the steps of: (a) resecting a tumor from a cancer in a subject or patient, the tumor comprising a first population of TILs, optionally from surgical resection, needle biopsy, core biopsy, small biopsy, or other means for obtaining a sample of the tumor that contains a mixture of tumor and TIL cells; (b) fragmenting the tumor into tumor fragments; (c) contacting the tumor fragments with a first cell culture medium; (d) performing an initial expansion (or priming first expansion) of the first population of TILs in the first cell culture medium to obtain a second population of TILs, wherein the first cell culture medium comprises IL-2, optionally OKT-3 (anti-CD3 antibody), and optionally antigen presenting cells (APCs), where the priming first expansion occurs for a period of 1 to 8 days; (e) performing a rapid second expansion of
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) obtaining and/or receiving a first population of TILs from a tumor resected from a cancer in a subject by processing a tumor sample obtained from the tumor into multiple tumor fragments; (b) performing a priming first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2, optionally OKT-3, and optionally comprising antigen presenting cells (APCs), to produce a second population of TILs, wherein the priming first expansion is performed for a first period of about 1 to 7/8 days to obtain the second population of TILs, wherein the second population of TILs is greater in number than the first population of TILs; (c) performing a rapid second expansion by contacting the second population of TILs with a cell culture medium comprising IL-2, OKT-3, and APCs, to produce a third
- the cell culture medium in step (b) further comprises antigen-presenting cells (APCs), and wherein the number of APCs in the culture medium in step (c) is greater than the number of APCs in the culture medium in step (b).
- APCs antigen-presenting cells
- a method of expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) performing a priming first expansion by culturing a first population of TILs, said first population of TILs obtainable by processing a tumor sample from a tumor resected from a cancer in a subject into multiple tumor fragments, in a cell culture medium comprising IL-2, optionally OKT-3, and optionally antigen presenting cells (APCs) to produce a second population of TILs, wherein the priming first expansion is performed in a container comprising a first gas-permeable surface area, wherein the priming first expansion is performed for first period of about 1 to 7/8 days to obtain the second population of TILs, wherein the second population of TILs is greater in number than the first population of TILs; (b) performing a rapid second expansion by contacting the second population of TILs to a cell culture medium of the second population of TILs
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) performing a priming first expansion by culturing a first population of TILs in a cell culture medium comprising IL-2, optionally OKT-3, and optionally comprising antigen presenting cells (APCs), to produce a second population of TILs, wherein the priming first expansion is performed for a first period of about 1 to 7/8 days to obtain the second population of TILs, wherein the second population of TILs is greater in number than the first population of TILs; (b) performing a rapid second expansion by contacting the second population of TILs with a cell culture medium comprising IL-2, OKT-3, and APCs, to produce a third population of TILs, wherein the rapid second expansion is performed for a second period of about 1 to 11 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic
- the cell culture medium in step (a) further comprises antigen-presenting cells (APCs), and wherein the number of APCs in the culture medium in step (c) is greater than the number of APCs in the culture medium in step (b).
- APCs antigen-presenting cells
- the priming first expansion is divided into a first step and a second step, wherein the method further comprises performing the first step of the priming first expansion by culturing the first population of TILs in a cell culture medium containing IL-2 to produce TILs that egress from the tumor fragments or sample, separating TILs that remain in the tumor fragments or sample from TILs that egressed from the tumor fragments or sample, optionally digesting the tumor fragments or sample to produce a tumor digest, and performing the second step of the priming first expansion in the cell culture medium the TILs remaining in the tumor fragments or sample or tumor digest to produce the second population of TILs.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) obtaining and/or receiving a first population of TILs from a tumor sample obtained from one or more small biopsies, core biopsies, or needle biopsies of a tumor from a cancer in a subject by culturing the tumor sample in a first cell culture medium comprising IL-2 for about 3 days; (b) performing a priming first expansion by culturing the first population of TILs in a second cell culture medium comprising IL-2, OKT-3, and antigen presenting cells (APCs) to produce a second population of TILs, wherein the priming first expansion is performed in a container comprising a first gas-permeable surface area, wherein the priming first expansion is performed for first period of about 7 or 8 days to obtain the second population of TILs, wherein the second population of TILs is greater in number than the first
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) obtaining and/or receiving a first population of TILs from a tumor sample obtained from one or more small biopsies, core biopsies, or needle biopsies of a tumor from a cancer in a subject by culturing the tumor sample in a first cell culture medium comprising IL-2 for about 3 days; (b) performing a priming first expansion by culturing the first population of TILs in a second cell culture medium comprising IL-2, OKT-3, and antigen presenting cells (APCs) to produce a second population of TILs, wherein the priming first expansion is performed for first period of about 7 or 8 days to obtain the second population of TILs, wherein the second population of TILs is greater in number than the first population of TILs; (c) performing a rapid second expansion by contacting the second population of TILs with
- the cancer is selected from the group consisting of melanoma, ovarian cancer, cervical cancer, non-small-cell lung cancer (NSCLC), lung cancer, bladder cancer, breast cancer, triple negative breast cancer, cancer caused by human papilloma virus, head and neck cancer (including head and neck squamous cell carcinoma (HNSCC)), renal cancer, and renal cell carcinoma.
- NSCLC non-small-cell lung cancer
- lung cancer bladder cancer
- breast cancer triple negative breast cancer
- cancer caused by human papilloma virus including head and neck squamous cell carcinoma (HNSCC)
- HNSCC head and neck squamous cell carcinoma
- renal cancer and renal cell carcinoma
- a method of expanding T cells comprising: (a) performing a priming first expansion of a first population of T cells obtained from a donor by culturing the first population of T cells to effect growth and to prime an activation of the first population of T cells; (b) after the activation of the first population of T cells primed in step (a) begins to decay, performing a rapid second expansion of the first population of T cells by culturing the first population of T cells to effect growth and to boost the activation of the first population of T cells to obtain a second population of T cells; (c) harvesting the second population of T cells; and (d) modifying a portion of the first or second population of T cells at any time prior to or after the harvesting in step (c) to generate modified T cells each comprising an immunomodulatory composition associated with its surface membrane.
- a method of expanding T cells comprising: (a) performing a priming first expansion of a first population of T cells from a tumor sample obtained from one or more small biopsies, core biopsies, or needle biopsies of a tumor in a donor by culturing the first population of T cells to effect growth and to prime an activation of the first population of T cells; (b) after the activation of the first population of T cells primed in step (a) begins to decay, performing a rapid second expansion of the first population of T cells by culturing the first population of T cells to effect growth and to boost the activation of the first population of T cells to obtain a second population of T cells; (c) harvesting the second population of T cells; and (d) modifying a portion of the first or second population of T cells at any time prior to or after the harvesting in step (e) to generate modified T cells each comprising an immunomodulatory composition associated with its surface membrane [0032] In one aspect, provided herein is a priming first expansion of a first population of
- the patient is pre-treated with ibrutinib or another interleukin-2 inducible T cell kinase (ITK) inhibitor.
- the patient is refractory to treatment with ibrutinib or another ITK inhibitor.
- the immunomodulatory composition comprises one or more membrane anchored immunomodulatory fusion proteins each comprising one or more immunomodulatory agents and a cell membrane anchor moiety.
- the one or more immunomodulatory agents comprise one or more cytokines.
- the one or more cytokines comprise one or more of IL-2, IL-6, IL-7, IL-9, IL-12, IL-15, IL-18, IL-21, IL-23, IL-27, IFN gamma, TNFa, IFN alpha, IFN beta, GM-CSF, GCSF, or a variant thereof.
- the one or more cytokines comprise IL-2 or a variant thereof.
- the IL-2 is human IL-2.
- the human IL-2 has the amino acid sequence of SEQ ID NO:272.
- the one or more cytokines comprise one or more of IL-12 or a variant thereof.
- the IL-12 comprises a human IL-12 p35 subunit attached to a human IL-12 p40 subunit.
- the human IL-12 p35 subunit has the amino acid sequence of SEQ ID NO:267 and the human IL-12 p40 subunit has the amino acid sequence of SEQ ID NO:268.
- the one or more cytokines comprise IL-15 or a variant thereof.
- the IL-15 is human IL-15.
- the human IL- 15 has the amino acid sequence of SEQ ID NO:258.
- the one or more cytokines comprise IL-18 or a variant thereof.
- the IL-18 is human IL-18.
- the human IL-18 has the amino acid sequence of any one of SEQ ID NOs:269, 270, and 331-385.
- the one or more cytokines comprise IL-21 or a variant thereof.
- the IL-21 is human IL-21.
- the human IL-21 has the amino acid sequence of SEQ ID NO:251.
- the one or more cytokines comprise IL-15 or a variant thereof and IL-21 or a variant thereof.
- the IL-15 is human IL-15 and the IL-21 is human IL-21.
- the human IL-15 has the amino acid sequence of SEQ ID NO: 258 and the human IL-21 has the amino acid sequence of SEQ ID NO:271.
- the one or more immunomodulatory agents comprise a CD40 agonist.
- the CD40 agonist is an anti-CD40 binding domain or CD40L.
- the CD40 agonist is a CD40 binding domain comprising a variable heavy domain (VH) and a variable light domain (VL).
- the VH and VL of the CD40 binding domain are selected from the following: a) a VH having the amino acid sequence of SEQ ID NO: 274, and a VL having the amino acid sequence of SEQ ID NO:275; b) a VH having the amino acid sequence of SEQ ID NO: 277, and a VL having the amino acid sequence of SEQ ID NO:278; c) a VH having the amino acid sequence of SEQ ID NO: 280, and a VL having the amino acid sequence of SEQ ID NO:281; and d) a VH having the amino acid sequence of SEQ ID NO: 283, and a VL having the amino acid sequence of SEQ ID NO:284.
- the CD40 binding domain is an scFv.
- the CD40 agonist is a human CD40L having the amino acid sequence of SEQ ID NO: 273.
- the one or more membrane anchored immunomodulatory fusion proteins are independently according to the formula, from N- to C-terminus: S-IA-L- C, wherein S is a signal peptide, IA is an immunomodulatory agent, L is a linker and C is a cell membrane anchor moiety.
- the cell membrane anchor moiety comprises a CD8a transmembrane-intracellular domain, a B7-1 transmembrane domain, a B7-2 transmembrane domain, or a CD8a transmembrane domain.
- the cell membrane anchor moiety comprises a B7-1 transmembrane domain.
- the cell membrane anchor moiety has the amino acid sequence of SEQ ID NO:239.
- the immunomodulatory composition comprises two or more different membrane anchored immunomodulatory fusion proteins, wherein each of the different membrane anchored immunomodulatory fusion proteins each comprise a different immunomodulatory agent.
- the different immunomodulatory agents are selected from: IL-2, IL-6, IL-7, IL-9, IL-12, IL-15, IL-18, IL-21, IL-23, IL-27, IFN gamma, TNFa, IFN alpha, IFN beta, GM-CSF, GCSF, or a variant thereof, and a CD40 agonist.
- the different immunomodulatory agents are selected from: IL-12 and IL- 15, IL-15 and IL-18, IL-15 and IL-21, CD40L and IL-15, IL-15 and IL-21, IL-2 and IL-12, and a variant thereof.
- the modified TILs comprise a first membrane anchored immunomodulatory fusion protein and a second membrane anchored immunomodulatory fusion protein.
- the first membrane anchored immunomodulatory fusion protein comprises IL-15 or a variant thereof and the second membrane anchored immunomodulatory fusion protein comprises IL-21 or a variant thereof.
- the first membrane anchored immunomodulatory fusion protein and the second membrane anchored immunomodulatory fusion protein are expressed under the control of an NFAT promoter in the modified TILs.
- the one or more membrane anchored immunomodulatory fusion proteins are independently according to the formula, from N- to C-terminus: S-IA-L- C, wherein S is a signal peptide, IA is an immunomodulatory agent, L is a linker and C is a cell membrane anchor moiety.
- IA is a cytokine.
- IA is selected from the group consisting of: IL-2, IL-6, IL-7, IL-9, IL-12, IL- 15, IL-18, IL-21, IL-23, IL-27, IFN gamma, TNFa, IFN alpha, IFN beta, GM-CSF, GCSF, or a variant thereof.
- IA is IL-2 or a variant thereof.
- IA is IL-12 or a variant thereof.
- IA is IL-15 or a variant thereof.
- IA is IL-18 or a variant thereof.
- IA is a DR-IL-18.
- IA is IL-21 or a variant thereof.
- the one or more membrane anchored immunomodulatory fusion proteins are independently according to the formula, from N- to C-terminus: S1-IA1-L1-C1- L2-S2-IA2-L3-C2, wherein S1 and S2 are each independently a signal peptide, IA1 and IA2 are each independently an immunomodulatory agent, L1-L3 are each independently a linker, and C1 and C2 are each independently a cell membrane anchor moiety.
- S1 and S2 are the same.
- C1 and C2 are the same.
- L2 is a cleavable linker.
- L2 is a furin cleavable linker.
- IA1 and IA2 are each independently a cytokine.
- IA1 and IA2 are each independently selected from the group consisting of: IL-2, IL-6, IL-7, IL-9, IL-12, IL-15, IL-18, IL-21, IL-23, IL-27, IFN gamma, TNFa, IFN alpha, IFN beta, GM-CSF, GCSF, or a variant thereof.
- IA1 and IA2 are each independently selected from the group consisting of IL-2 and IL-12, with the proviso that one of IA1 and IA2 is IL-2 and the other is IL-12. In some embodiments, IA1 and IA2 are each independently selected from the group consisting of IL- 15 and IL-21, with the proviso that one of IA1 and IA2 is IL-15 and the other is IL-21. [0053] In certain embodiments, the modifying comprises introducing a heterologous nucleic acid encoding the fusion protein into the portion of TILs and expressing the fusion protein on the surface of the modified TILs.
- the modifying comprises introducing a heterologous nucleic acid encoding the fusion protein into the portion of TILs and expressing the fusion protein on the surface of the modified TILs.
- the heterologous nucleic acid comprises a viral vector (e.g., an adenoviral vector, a retroviral vector, a lentiviral vector, or an adeno-associated vector (AAV)).
- the heterologous nucleic acid comprises a piggyBac transposon.
- the heterologous nucleic acid comprises an NFAT promoter, an EF-1a promoter, an MND promoter, or an SSFV promoter.
- the immunomodulatory composition comprises a fusion protein comprising one or more immunomodulatory agents linked to a TIL surface antigen binding domain.
- the one or more immunomodulatory agents comprise one or more cytokines.
- the one or more cytokines comprise one or more of IL-2, IL-6, IL-7, IL-9, IL-12, IL-15, IL-18, IL-21, IL-23, IL-27, IFN gamma, TNFa, IFN alpha, IFN beta, GM-CSF, GCSF, or a variant thereof.
- the one or more cytokines comprise IL-12 or a variant thereof.
- the one or more cytokines comprise IL-15 or a variant thereof. In certain embodiments, the one or more cytokines comprise IL-18 or a variant thereof (e.g., a DR-IL-18). In some embodiments, the one or more cytokines comprise IL-21 or a variant thereof. In certain embodiments, the TIL surface antigen binding domain comprises an antibody variable heavy domain and variable light domain. In some embodiments, the TIL surface antigen binding domain comprises an antibody or fragment thereof.
- the TIL surface antigen binding domain exhibits an affinity for one or more of following TIL surface antigens: CD45, CD4, CD8, CD3, CDlla, CDllb, CDllc, CD18, CD25, CD127, CD19, CD20, CD22, HLA-DR, CD197, CD38, CD27, CD196, CXCR3, CXCR4, CXCR5, CD84, CD229, CCR1, CCR5, CCR4, CCR6, CCR8, CCR10, CD 16, CD56, CD 137, OX40, or GITR.
- the modifying comprises incubating the fusion protein with the portion of TILs under conditions to permit the binding of the fusion protein to the portion of TILs.
- the immunomodulatory composition comprises a nanoparticle comprising a plurality of immunomodulatory agents.
- the plurality of immunomodulatory agents are covalently linked together by degradable linkers.
- the nanoparticle comprises at least one polymer, cationic polymer, or cationic block co-polymer on the nanoparticle surface.
- the one or more cytokines comprise one or more of IL-2, IL-6, IL-7, IL-9, IL-12, IL-15, IL-18, IL-21, IL-23, IL-27, IFN gamma, TNFa, IFN alpha, IFN beta, GM-CSF, GCSF, or a variant thereof.
- the one or more cytokines comprises IL-12.
- the one or more cytokines comprises IL-15.
- the one or more cytokines comprise IL-21.
- the nanoparticle is a liposome, a protein nanogel, a nucleotide nanogel, a polymer nanoparticle, or a solid nanoparticle. In some embodiments, the nanoparticle is a nanogel. In certain embodiments, the nanoparticle further comprises an antigen binding domain that binds to one or more of the following antigens: CD45, CDlla (integrin alpha- L), CD 18 (integrin beta-2), CD1lb, CD1lc, CD25, CD8, or CD4. In some embodiments, the modifying comprises attaching the immunomodulatory composition to the surface of the portion of TILs.
- the modifying is carried out on TILs from the first expansion, or TILs from the second expansion, or both. In certain embodiments, the modifying is carried out on TILs from the priming first expansion, or TILs from the rapid second expansion, or both. [0058] In some embodiments of the methods provided herein, the modifying is carried out after the first expansion and before the second expansion. In some embodiments, the modifying is carried out after the priming first expansion and before the rapid second expansion, or both. In certain embodiments, the modifying is carried out after the second expansion. In some embodiments, the modifying is carried out after the rapid second expansion. In some embodiments, the modifying is carried out after the harvesting.
- the first expansion is performed over a period of about 11 days. In some embodiments, the priming first expansion is performed over a period of about 11 days. [0060] In some embodiments of the methods provided herein, the IL-2 is present at an initial concentration of between 1000 IU/mL and 6000 IU/mL in the cell culture medium in the first expansion. In certain embodiments, the IL-2 is present at an initial concentration of between 1000 IU/mL and 6000 IU/mL in the cell culture medium in the priming first expansion.
- the IL-2 in the second expansion step is present at an initial concentration of between 1000 IU/mL and 6000 IU/mL and the OKT-3 antibody is present at an initial concentration of about 30 ng/mL.
- the IL-2 in the rapid second expansion step is present at an initial concentration of between 1000 IU/mL and 6000 IU/mL and the OKT-3 antibody is present at an initial concentration of about 30 ng/mL.
- the first expansion is performed using a gas permeable container.
- the priming first expansion is performed using a gas permeable container.
- the second expansion is performed using a gas permeable container.
- the rapid second expansion is performed using a gas permeable container.
- the cell culture medium of the first expansion further comprises a cytokine selected from the group consisting of IL-4, IL-7, IL-15, IL-21, and combinations thereof.
- the cell culture medium of the priming first expansion further comprises a cytokine selected from the group consisting of IL-4, IL-7, IL-15, IL-21, and combinations thereof.
- the cell culture medium of the second expansion further comprises a cytokine selected from the group consisting of IL-4, IL-7, IL-15, IL-21, and combinations thereof.
- the cell culture medium of the rapid second expansion further comprises a cytokine selected from the group consisting of IL-4, IL-7, IL-15, IL-21, and combinations thereof.
- the method further includes the step of treating the patient with a non-myeloablative lymphodepletion regimen prior to administering the TILs to the patient.
- the non- myeloablative lymphodepletion regimen comprises the steps of administration of cyclophosphamide at a dose of 60 mg/m 2 /day for two days followed by administration of fludarabine at a dose of 25 mg/m 2 /day for three days.
- the non- myeloablative lymphodepletion regimen comprises the steps of administration of cyclophosphamide at a dose of 60 mg/m 2 /day and fludarabine at a dose of 25 mg/m 2 /day for two days followed by administration of fludarabine at a dose of 25 mg/m 2 /day for three days.
- the non-myeloablative lymphodepletion regimen comprises the steps of administration of cyclophosphamide at a dose of 60 mg/m 2 /day and fludarabine at a dose of 25 mg/m 2 /day for two days followed by administration of fludarabine at a dose of 25 mg/m 2 /day for one day.
- the cyclophosphamide is administered with mesna.
- the method further includes the step of treating the patient with an IL-2 regimen starting on the day after the administration of TILs to the patient.
- the method further includes the step of treating the patient with an IL-2 regimen starting on the same day as administration of TILs to the patient.
- the IL-2 regimen is a high-dose IL-2 regimen comprising 600,000 or 720,000 IU/kg of aldesleukin, or a biosimilar or variant thereof, administered as a 15-minute bolus intravenous infusion every eight hours until tolerance.
- the therapeutically effective population of TILs is administered and comprises from about 2.3 ⁇ 10 10 to about 13.7 ⁇ 10 10 TILs.
- the priming first expansion and rapid second expansion are performed over a period of 21 days or less. In some embodiments, the priming first expansion and rapid second expansion are performed over a period of 16 or 17 days or less. In certain embodiments, the priming first expansion is performed over a period of 7 or 8 days or less. In some embodiments, the rapid second expansion is performed over a period of 11 days or less.
- the first expansion in step (c) and the second expansion in step (d) are each individually performed within a period of 11 days. In some embodiments of the methods provided herein, steps (a) through (f) are performed in about 10 days to about 22 days. [0069] In some embodiments of the methods provided herein, the modified TILs further comprise a genetic modification that causes expression of one or more immune checkpoint genes to be silenced or reduced in at least a portion of the therapeutic population of TILs.
- the one or more immune checkpoint genes is/are selected from the group comprising PD-1, CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, TET2, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY1B2, GUCY1B3,
- the one or more immune checkpoint genes is/are selected from the group comprising PD-1, TGIT, CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , and PKA.
- the immune checkpoint gene is PD-1.
- the genetic modification is produced using an RNA interference method (e.g., shRNA).
- the modified TILs further comprises a genetic modification that causes expression of one or more immune checkpoint genes to be enhanced in at least a portion of the therapeutic population of TILs, the immune checkpoint gene(s) being selected from the group comprising CCR2, CCR4, CCR5, CXCR2, CXCR3, CX3CR1, IL-2, IL-4, IL- 7, IL-10, IL-15, IL-21, the NOTCH 1/2 intracellular domain (ICD), and/or the NOTCH ligand mDLL1.
- the genetic modification is produced using a programmable nuclease that mediates the generation of a double-strand or single-strand break at said one or more immune checkpoint genes.
- the genetic modification is produced using one or more methods selected from an RNA interference method (e.g., shRNA), a CRISPR method, a TALE method, a zinc finger method, a Cas- CLOVER method, and a combination thereof.
- the genetic modification is produced using a CRISPR method.
- the CRISPR method is a CRISPR/Cas9 method.
- the genetic modification is produced using a TALE method.
- the genetic modification is produced using a zinc finger method.
- the genetic modification is produced using a Cas-CLOVER method.
- the modified TILs transiently express the immunomodulatory composition on the cell surface.
- the immunomodulatory composition comprises one or more membrane anchored immunomodulatory fusion proteins, wherein each fusion protein comprises one or more immunomodulatory agents and a cell membrane anchor moiety.
- the one or more immunomodulatory agents comprise one or more cytokines.
- the one or more cytokines comprise one or more of IL-2, IL-6, IL-7, IL-9, IL-12, IL-15, IL-18, IL-21, IL-23, IL-27, IFN gamma, TNFa, IFN alpha, IFN beta, GM-CSF, GCSF, or a variant thereof.
- the one or more cytokines comprise IL-2 or a variant thereof.
- the IL-2 is human IL-2.
- the human IL-2 has the amino acid sequence of SEQ ID NO:272.
- the one or more cytokines comprise IL-12 or a variant thereof.
- the IL-12 comprises a human IL-12 p35 subunit attached to a human IL-12 p40 subunit.
- the human IL-12 p35 subunit has the amino acid sequence of SEQ ID NO:267 and the human IL-12 p40 subunit has the amino acid sequence of SEQ ID NO:268.
- the one or more cytokines comprise IL-15 or a variant thereof.
- the IL-15 is human IL-15.
- the human IL- 15 has the amino acid sequence of SEQ ID NO:258.
- the one or more cytokines comprise IL-18 or a variant thereof (e.g., DR-IL-18).
- the IL-18 is human IL-18.
- the human IL-18 has the amino acid sequence of any one of SEQ ID NOs:269, 270, and 331-385.
- the one or more cytokines comprise IL-21 or a variant thereof.
- the IL-21 is human IL-21. In some embodiments, the human IL-21 has the amino acid sequence of SEQ ID NO:271.
- the one or more cytokines comprise IL-15 and IL-21. In some embodiments, the IL-15 is human IL-15 and the IL-21 is human IL-21. In certain embodiments, the human IL-15 has the amino acid sequence of SEQ ID NO: 258 and the human IL-21 has the amino acid sequence of SEQ ID NO:271.
- the one or more immunomodulatory agents comprise a CD40 agonist. In certain embodiments, the CD40 agonist is an anti-CD40 binding domain or CD40L.
- the CD40 agonist is a CD40 binding domain comprising a variable heavy domain (VH) and a variable light domain (VL).
- VH and VL of the CD40 binding domain are selected from the following: a) a VH having the amino acid sequence of SEQ ID NO: 274, and a VL having the amino acid sequence of SEQ ID NO:275; b) a VH having the amino acid sequence of SEQ ID NO: 277, and a VL having the amino acid sequence of SEQ ID NO:278; c) a VH having the amino acid sequence of SEQ ID NO: 280, and a VL having the amino acid sequence of SEQ ID NO:281; and d) a VH having the amino acid sequence of SEQ ID NO: 283, and a VL having the amino acid sequence of SEQ ID NO:284.
- the CD40 binding domain is an scFv.
- the CD40 agonist is a human CD40L having the amino acid sequence of SEQ ID NO: 273.
- the membrane anchored immunomodulatory fusion protein is according to the formula, from N- to C-terminus: S-IA- L-C, wherein S is a signal peptide, IA is an immunomodulatory agent, L is a linker and C is a cell membrane anchor moiety.
- the cell membrane anchor moiety comprises a CD8a transmembrane-intracellular domain, a B7-1 transmembrane domain, a B7-2 transmembrane domain, or a CD8a transmembrane domain.
- the cell membrane anchor moiety comprises a B7-1 transmembrane domain.
- the cell membrane anchor moiety has the amino acid sequence of SEQ ID NO:239.
- the immunomodulatory composition comprises two or more different membrane anchored immunomodulatory fusion proteins, wherein each of the different membrane anchored immunomodulatory fusion proteins each comprise a different immunomodulatory agent.
- the different immunomodulatory agents are selected from: IL-2, IL-6, IL-7, IL-9, IL-12, IL-15, IL-18, IL-21, IL-23, IL-27, IFN gamma, TNFa, IFN alpha, IFN beta, GM-CSF, GCSF, or a variant thereof, and a CD40 agonist.
- the different immunomodulatory agents are selected from: IL-12 and IL- 15, IL-15 and IL-18, CD40L, IL-15 and IL-21, and IL-15, and IL-2 and IL-12.
- the modified TILs are modified by transfecting the TILs with a nucleic acid encoding a fusion protein comprising one or more immunomodulatory agents and a cell membrane anchor moiety in order to transiently express the fusion protein on the cell surface.
- the nucleic acid is an RNA.
- the RNA is a mRNA.
- the TILs are transfected with the mRNA by electroporation.
- the TILs are transfected with the mRNA by electroporation after the first expansion and before the second expansion.
- the TILs are transfected with the mRNA by electroporation before the first expansion.
- the method further comprises activating the TILs by incubation with an anti-CD3 agonist before transfecting the TILs with the mRNA.
- the anti-CD3 agonist is OKT-3.
- the TILs are activated by incubating the TILs with the anti-CD3 agonist for about 1 to 3 days before transfecting the TILs with the mRNA.
- the modified TILs are transfected with the nucleic acid encoding the fusion protein using a microfluidic device to temporarily disrupt the cell membranes of the TILs, thereby allowing transfection of the nucleic acid.
- artificial antigen-presenting cells are used in place of APCs.
- the aAPCs comprise a cell that expresses HLA-A/B/C, CD64, CD80, ICOS-L, and CD58.
- the aAPCs comprise a MOLM-14 cell.
- the aAPCs comprise a MOLM-13 cell.
- the aAPCs comprise a MOLM-14 cell that endogenously expresses HLA-A/B/C, CD64, CD80, ICOS-L, and CD58.
- the aAPCs comprise a MOLM-14 cell that endogenously expresses HLA-A/B/C, CD64, CD80, ICOS-L, and CD58, wherein the MOLM-14 cell is permanently gene-edited to express CD86.
- the MOLM-14 cell transduced with one or more viral vectors, wherein the one or more viral vectors comprise a nucleic acid sequence encoding CD86 and a nucleic acid sequence encoding 4-1BBL, and wherein the MOLM-14 cell expresses CD86 and 4-1BBL.
- the aAPCs are transiently gene-edited to transiently express on the cell surface an immunomodulatory composition comprising an immunomodulatory fusion protein.
- the aAPCs transiently express on the cell surface an immunomodulatory fusion protein comprising a membrane anchor fused to a cytokine. In some embodiments, the aAPCs transiently express on the cell surface a membrane anchor fused to a cytokine selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, and IL-21. In some embodiments, the aAPCs transiently express on the cell surface a membrane anchor fused to a cytokine selected from the group consisting of IL-2, IL-12, IL-15, and IL-21.
- the aAPCs transiently express on the cell surface a membrane anchor fused to a cytokine selected from the group consisting of IL-12, IL-15, and IL-21.
- the modified TILs are genetically modified to express the immunomodulatory composition on the cell surface.
- the immunomodulatory composition comprises one or more membrane anchored immunomodulatory fusion proteins each comprising one or more immunomodulatory agents and a cell membrane anchor moiety.
- the one or more membrane anchored immunomodulatory fusion proteins comprise IL-2 or a variant thereof.
- the one or more membrane anchored immunomodulatory fusion proteins comprise IL-15 or a variant thereof.
- the one or more membrane anchored immunomodulatory fusion proteins comprise IL-18 or a variant thereof (e.g., a DR- IL-18). In some embodiments, the one or more membrane anchored immunomodulatory fusion proteins comprise IL-21 or a variant thereof.
- the modified TILs comprise a first membrane anchored immunomodulatory fusion protein and a second membrane anchored immunomodulatory fusion protein. In some embodiments, the first membrane anchored immunomodulatory fusion protein comprises IL-15 and the second membrane anchored immunomodulatory fusion protein comprises IL-21.
- the first membrane anchored immunomodulatory fusion protein and the second immunomodulatory fusion protein are expressed under the control of an NFAT promoter, an EF-1a promoter, an MND promoter, or an SSFV promoter in the modified TILs.
- the one or more membrane anchored immunomodulatory fusion proteins are independently according to the formula, from N- to C-terminus: S-IA-L- C, wherein S is a signal peptide, IA is an immunomodulatory agent, L is a linker and C is a cell membrane anchor moiety.
- IA is a cytokine.
- IA is selected from the group consisting of: IL-2, IL-6, IL-7, IL-9, IL-12, IL- 15, IL-18, IL-21, IL-23, IL-27, IFN gamma, TNFa, IFN alpha, IFN beta, GM-CSF, GCSF, or a variant thereof.
- IA is IL-2.
- IA is IL-12.
- IA is IL-15.
- IA is IL-21.
- L is a CD8a transmembrane-intracellular domain, a B7-1 transmembrane domain, a B7-2 transmembrane domain, or a CD8a transmembrane domain. In certain embodiments, L is a B7-1 transmembrane domain. In some embodiments, L has the amino acid sequence of SEQ ID NO:239.
- the one or more membrane anchored immunomodulatory fusion proteins are independently according to the formula, from N- to C-terminus: S1-IA1- L1-C1-L2-S2-IA2-L3-C2, wherein S1 and S2 are each independently a signal peptide, IA1 and IA2 are each independently an immunomodulatory agent, L1-L3 are each independently a linker, and C1 and C2 are each independently a cell membrane anchor moiety.
- S1 and S2 are the same.
- C1 and C2 are the same.
- L2 is a cleavable linker.
- L2 is a furin cleavable linker.
- IA1 and IA2 are each independently a cytokine.
- IA1 and IA2 are each independently selected from the group consisting of: IL- 2, IL-6, IL-7, IL-9, IL-12, IL-15, IL-18, IL-21, IL-23, IL-27, IFN gamma, TNFa, IFN alpha, IFN beta, GM-CSF, GCSF, or a variant thereof.
- IA1 and IA2 are each independently selected from the group consisting of IL-2 and IL-12, with the proviso that one of IA1 and IA2 is IL-2 and the other is IL-12. In some embodiments, IA1 and IA2 are each independently selected from the group consisting of IL-15 and IL-21, with the proviso that one of IA1 and IA2 is IL-15 and the other is IL-21. [0091] In exemplary embodiments, C1 and C2 are each independently a CD8a transmembrane-intracellular domain, a B7-1 transmembrane domain, a B7-2 transmembrane domain, or a CD8a transmembrane domain.
- C1 and C2 are each a B7-1 transmembrane domain. In some embodiments, C1 and C2 each have the amino acid sequence of SEQ ID NO:239.
- the modified TILs express the one or more membrane anchored immunomodulatory fusion proteins under the control of an NFAT promoter, an EF- 1a promoter, an MND promoter, or an SSFV promoter. In some embodiments, the modified TILs are transduced with a retroviral vector to express the one or more membrane anchored immunomodulatory fusion proteins.
- the modified TILs are transduced with a vector (e.g., an adenoviral vector, a retroviral vector, a lentiviral vector, or an adeno- associated vector (AAV)) or a piggyBac transposon, to express the one or more membrane anchored immunomodulatory fusion proteins.
- a vector e.g., an adenoviral vector, a retroviral vector, a lentiviral vector, or an adeno- associated vector (AAV)
- AAV adeno-associated vector
- Figure 3 Shows a diagram of an embodiment of a cryopreserved TIL exemplary manufacturing process ( ⁇ 22 days).
- Figure 4 Shows a diagram of an embodiment of Gen 2 (process 2A), a 22-day process for TIL manufacturing.
- Figure 5 Comparison table of Steps A through F from exemplary embodiments of process 1C and Gen 2 (process 2A) for TIL manufacturing.
- Figure 6 Detailed comparison of an embodiment of process 1C and an embodiment of Gen 2 (process 2A) for TIL manufacturing.
- Figure 7 Exemplary Gen 3 type TIL manufacturing process.
- Figure 8A-8D A) Shows a comparison between the 2A process (approximately 22-day process) and an embodiment of the Gen 3 process for TIL manufacturing (approximately 14-days to 16-days process).
- Figure 9 Provides an experimental flow chart for comparability between Gen 2 (process 2A) versus Gen 3 processes.
- Figure 10 Shows a comparison between various Gen 2 (process 2A) and the Gen 3.1 process embodiment.
- Figure 11 Table describing various features of embodiments of the Gen 2, Gen 2.1 and Gen 3.0 process.
- Figure 12 Overview of the media conditions for an embodiment of the Gen 3 process, referred to as Gen 3.1.
- Figure 13 Table describing various features of embodiments of the Gen 2, Gen 2.1 and Gen 3.0 process.
- Figure 14 Table comparing various features of embodiments of the Gen 2 and Gen 3.0 processes.
- Figure 15 Table providing media uses in the various embodiments of the described expansion processes.
- Figure 16 Schematic of an exemplary embodiment of the Gen 3 process (a 16-day process).
- Figure 17 Schematic of an exemplary embodiment of a method for expanding T cells from hematopoietic malignancies using Gen 3 expansion platform.
- Figure 18 Provides the structures I-A and I-B. The cylinders refer to individual polypeptide binding domains.
- Structures I-A and I-B comprise three linearly- linked TNFRSF binding domains derived from e.g., 4-1BBL or an antibody that binds 4- 1BB, which fold to form a trivalent protein, which is then linked to a second trivalent protein through IgG1-Fc (including CH3 and CH2 domains) is then used to link two of the trivalent proteins together through disulfide bonds (small elongated ovals), stabilizing the structure and providing an agonists capable of bringing together the intracellular signaling domains of the six receptors and signaling proteins to form a signaling complex.
- IgG1-Fc including CH3 and CH2 domains
- the TNFRSF binding domains denoted as cylinders may be scFv domains comprising, e.g., a V H and a V L chain connected by a linker that may comprise hydrophilic residues and Gly and Ser sequences for flexibility, as well as Glu and Lys for solubility.
- Figure 19 Schematic of an exemplary embodiment of the Gen 3 process (a 16-day process).
- Figure 20 Provides a process overview for an exemplary embodiment of the Gen 3.1 process (a 16 day process).
- Figure 21 Schematic of an exemplary embodiment of the Gen 3.1 Test process (a 16-17 day process).
- Figure 22 Schematic of an exemplary embodiment of the Gen 3 process (a 16-day process).
- Figure 23A-23B Comparison table for exemplary Gen 2 and exemplary Gen 3 processes.
- Figure 24 Schematic of an exemplary embodiment of the Gen 3 process (a 16-17 day process) preparation timeline.
- Figure 25 Schematic of an exemplary embodiment of the Gen 3 process (a 14-16 day process).
- Figure 26A-26B Schematic of an exemplary embodiment of the Gen 3 process (a 16 day process).
- Figure 27 Schematic of an exemplary embodiment of the Gen 3 process (a 16 day process).
- Figure 28 Comparison of Gen 2, Gen 2.1 and an embodiment of the Gen 3 process (a 16 day process).
- Figure 29 Comparison of Gen 2, Gen 2.1 and an embodiment of the Gen 3 process (a 16 day process).
- Figure 30 Gen 3 embodiment components.
- Figure 31 Gen 3 embodiment flow chart comparison (Gen 3.0, Gen 3.1 control, Gen 3.1 test).
- Figure 32 Shown are the components of an exemplary embodiment of the Gen 3 process (a 16-17 day process).
- Figure 33 Acceptance criteria table.
- Figure 34 Depiction of some embodiments of a TIL manufacturing process including electroporation step for use with gene-editing processes (including TALEN, zinc finger nuclease, and CRISPR methods as described herein).
- FIG. 35 Depiction of embodiments of TIL manufacturing processes including electroporation step for use with gene-editing processes (including TALEN, zinc finger nuclease, and CRISPR methods as described herein).
- Figure 36A-36J Exemplary membrane anchored immunomodulatory fusion proteins that can be included in the TILs described herein.
- Figure 37A-37D Exemplary membrane anchored immunomodulatory fusion proteins that can be included in the TILs described herein.
- Figure 38A-38C Summary of study to assess expression and signaling of membrane bound IL-15/IL-21 transduced pre-REP TILs.
- Figure 39A-39B Summary of study to assess expression of mIL-15/IL21 and CD8 and CD4 T cell subset in mIL-15/IL-21 transduced REP TILs.
- Figure 40A-40C Summary of study to assess phenotype of mIL-15/IL-21 transduced CD8+ REP TILs.
- Figure 41A-41C Summary of study to assess phenotype of mIL-15/IL-21 transduced CD4+.
- Figure 42 Summary of study to assess fold expansion, cell viability, and transduction efficient of TeIL-18 and TeDR-IL18 expressing TILs after gene transduction and 11-day REP process described herein.
- Figures 43A-43B Summary of studies to assess surface expression of IL-18 and DRIL-18 on TeIL-18 and TeDR-IL18 expressing TILs.
- Figure 44 Summary of study to assess IFN- ⁇ production by TeIL-18 and TeDR-IL18 expressing TILs with and without TCR stimulation using anti-CD3 antibody OKT3
- Figure 45 Summary of study to assess expression and IL-18 activity of TeIL-18 and TeDR-IL18 expressing REP TILs, wherein TeIL-18 and TeDRIL-18 are under the control of an inducible NFAT promoter.
- Figure 46A-46C Summary of TeIL-IL18 and TeDRIL-18 REP TIL functional study using a KILR-THP-I cytotoxicity assay.
- A -(C) freshly thawed TILs.
- B and (C) includes additional experiments with repeated stimulated TILs.
- Figure 47A-47B Summary of assessment o IFN- ⁇ production by TeIL-18 and TeDRIL-18 ub KILR-THP-I cytotoxicity assay.
- Figure 48A-48H Summary of phenotypic and functional analysis of TeIL-18 and TeDRIL-18 REP TILs.
- Figure 49A-49B Summary fo study to assess the effects of TeIL-18 and TeDRIL-18 on THP-I MHC-I and- -II expression.
- Figure 50 depicts an exemplary nucleic acid that allows for expression of a member anchored IL-12 (TeIL-12) and PD-1 shRNA in embodiments of the subject TILs provided herein.
- Figure 51 depicts an exemplary workflow for the preparation of TILs expressing TeIL-12 and/or NFAT-TeIL-12 for administration to a subject.
- Figure 52A-52B Summary of study to assess the expression of TeIL-12 and/or NFAT-TeIL-12 in REP TILs.
- Figure 55A-55B Summary of study to assess (A) the frequency of TeIL-12 and/or NFAT-TeIL-12 in a population of REP TILs from various tissues (including two lung, one head & neck, one breast and one ovarian tumor samples) and (B) viral genome copy number (VCN) per cell.
- Figure 56A-56D Summary of study to assess (A) and (B) cytotoxicity in a THP-1 based allogenic cytotoxicity assay, (C) and (D) IFN- ⁇ production of TeIL-12 REP- TILs and NFAT-driven inducible TeIL-12 REP-TILs.
- Figure 57A-57B Summary of study to assess cytotoxicity of TeIL-12 expressing TILs was also assessed by xCelligence RTCA assay using two target cell populations (A) and (B).
- Figure 58A-58C Summary of a study to assess TIL killing efficacy.
- A Schematic of experimental design.
- B KILR® THP-1 cytotoxicity assay and IFN-g quantification, and
- C Xcellgene RTCA killing assay were performed.
- Figure 59 depicts a summary of study to assess distribution of CD8+, CD4+, and CD4+/FoxP3- T cells within a population of REP TILs transduced to express TeIL-12 or NFAT-TeIL-12.
- Figure 60A-60B Summary of study to assess T cell differentiation of (A) CD8+ and (B) CD4+ T cells, as measured by various cellular markers, within a population of REP TILs transduced to express TeIL-12 or NFAT-TeIL-12.
- Figure 61A-61B Summary of study to assess T cell exhaustion of (A) CD8+ and (B) CD4+ T cells, as measured by various cellular markers, within a population of REP TILs transduced to express TeIL-12 or NFAT-TeIL-12.
- Figure 62A-62B Summary of study to assess T cell activation of (A) CD8+ and (B) CD4+ T cells, as measured by various cellular markers, within a population of REP TILs transduced to express TeIL-12 or NFAT-TeIL-12.
- Figure 63A-63B Summary of study to assess T cell function of (A) CD8+ and (B) CD4+ T cells, as measured by various cellular markers, within a population of REP TILs transduced to express TeIL-12 or NFAT-TeIL-12.
- Figure 64A-64B Shows (A) cell expansion and (B) surface expression of TeIL-15 after the procedure: after gene transduction of TeIL-15 lentivirus, Pre-REP TIL was processed for REP expansion with feeder cell, 3000IU/ml IL-2 and aCD3 Ab OKT3 or HIT3a.
- Figure 65A-65B Shows (A) cell expansion and (B) surface expression of TeIL-15/TeIL-21 after the procedure: after gene transduction of TeIL-15/TeIL-21 lentivirus, Pre-REP TIL was processed for REP expansion with feeder cell, 3000IU/ml IL-2 and aCD3 Ab OKT3 or HIT3a.
- Figure 66A-66B Shows (A) cell expansion and (B) surface expression of TeIL-15 after the procedure: after gene transduction of TeIL-15 lentivirus, Pre-REP TIL was processed for 11 days REP expansion with feeder cell, 3000IU/ml IL-2 and OKT3 with indicated concentration. After 11 days REP expansion, Post-REP-TIL was harvested and analyzed.
- Figure 67A-67B Shows (A) cell expansion and (B)surface expression of TeIL-15/TeIL-21 after the procedure: after gene transduction of TeIL-15/TeIL-21 lentivirus, Pre-REP TIL was processed for REP expansion with feeder cell, 3000IU/ml IL-2 and OKT3 with indicated concentration. After 11 days REP expansion, Post-REP-TIL was harvested and analyzed.
- SEQ ID NO:1 is the amino acid sequence of the heavy chain of muromonab.
- SEQ ID NO:2 is the amino acid sequence of the light chain of muromonab.
- SEQ ID NO:3 is the amino acid sequence of a recombinant human IL-2 protein.
- SEQ ID NO:4 is the amino acid sequence of aldesleukin.
- SEQ ID NO:5 is an IL-2 form.
- SEQ ID NO:6 is the amino acid sequence of nemvaleukin alfa.
- SEQ ID NO:7 is an IL-2 form.
- SEQ ID NO:8 is a mucin domain polypeptide.
- SEQ ID NO:9 is the amino acid sequence of a recombinant human IL-4 protein.
- SEQ ID NO:10 is the amino acid sequence of a recombinant human IL-7 protein.
- SEQ ID NO:11 is the amino acid sequence of a recombinant human IL-15 protein.
- SEQ ID NO:12 is the amino acid sequence of a recombinant human IL-21 protein.
- SEQ ID NO:13 is an IL-2 sequence.
- SEQ ID NO:14 is an IL-2 mutein sequence.
- SEQ ID NO:15 is an IL-2 mutein sequence.
- SEQ ID NO:16 is the HCDR1_IL-2 for IgG.IL2R67A.H1.
- SEQ ID NO:17 is the HCDR2 for IgG.IL2R67A.H1.
- SEQ ID NO:18 is the HCDR3 for IgG.IL2R67A.H1.
- SEQ ID NO:19 is the HCDR1_IL-2 kabat for IgG.IL2R67A.H1.
- SEQ ID NO:20 is the HCDR2 kabat for IgG.IL2R67A.H1.
- SEQ ID NO:21 is the HCDR3 kabat for IgG.IL2R67A.H1.
- SEQ ID NO:22 is the HCDR1_IL-2 clothia for IgG.IL2R67A.H1.
- SEQ ID NO:23 is the HCDR2 clothia for IgG.IL2R67A.H1.
- SEQ ID NO:24 is the HCDR3 clothia for IgG.IL2R67A.H1.
- SEQ ID NO:25 is the HCDR1_IL-2 IMGT for IgG.IL2R67A.H1.
- SEQ ID NO:26 is the HCDR2 IMGT for IgG.IL2R67A.H1.
- SEQ ID NO:27 is the HCDR3 IMGT for IgG.IL2R67A.H1.
- SEQ ID NO:28 is the V H chain for IgG.IL2R67A.H1.
- SEQ ID NO:29 is the heavy chain for IgG.IL2R67A.H1.
- SEQ ID NO:30 is the LCDR1 kabat for IgG.IL2R67A.H1.
- SEQ ID NO:31 is the LCDR2 kabat for IgG.IL2R67A.H1.
- SEQ ID NO:32 is the LCDR3 kabat for IgG.IL2R67A.H1.
- SEQ ID NO:33 is the LCDR1 chothia for IgG.IL2R67A.H1.
- SEQ ID NO:34 is the LCDR2 chothia for IgG.IL2R67A.H1.
- SEQ ID NO:35 is the LCDR3 chothia for IgG.IL2R67A.H1.
- SEQ ID NO:36 is a V L chain.
- SEQ ID NO:37 is a light chain.
- SEQ ID NO:38 is a light chain.
- SEQ ID NO:39 is a light chain.
- SEQ ID NO:40 is the amino acid sequence of human 4-1BB.
- SEQ ID NO:41 is the amino acid sequence of murine 4-1BB.
- SEQ ID NO:42 is the heavy chain for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
- SEQ ID NO:43 is the light chain for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
- SEQ ID NO:44 is the heavy chain variable region (V H ) for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
- SEQ ID NO:45 is the light chain variable region (VL) for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
- SEQ ID NO:46 is the heavy chain CDR1 for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
- SEQ ID NO:47 is the heavy chain CDR2 for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
- SEQ ID NO:48 is the heavy chain CDR3 for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
- SEQ ID NO:49 is the light chain CDR1 for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
- SEQ ID NO:50 is the light chain CDR2 for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
- SEQ ID NO:51 is the light chain CDR3 for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
- SEQ ID NO:52 is the heavy chain for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
- SEQ ID NO:53 is the light chain for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
- SEQ ID NO:54 is the heavy chain variable region (VH) for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
- SEQ ID NO:55 is the light chain variable region (VL) for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
- SEQ ID NO:56 is the heavy chain CDR1 for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
- SEQ ID NO:57 is the heavy chain CDR2 for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
- SEQ ID NO:58 is the heavy chain CDR3 for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
- SEQ ID NO:59 is the light chain CDR1 for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
- SEQ ID NO:60 is the light chain CDR2 for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
- SEQ ID NO:61 is the light chain CDR3 for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
- SEQ ID NO:62 is an Fc domain for a TNFRSF agonist fusion protein.
- SEQ ID NO:63 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:64 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:65 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:66 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:67 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:68 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:69 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:70 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:71 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:72 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:73 is an Fc domain for a TNFRSF agonist fusion protein.
- SEQ ID NO:74 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:75 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:76 is a linker for a TNFRSF agonist fusion protein.
- SEQ ID NO:77 is a 4-1BB ligand (4-1BBL) amino acid sequence.
- SEQ ID NO:78 is a soluble portion of 4-1BBL polypeptide.
- SEQ ID NO:79 is a heavy chain variable region (V H ) for the 4-1BB agonist antibody 4B4-1-1 version 1.
- SEQ ID NO:80 is a light chain variable region (VL) for the 4-1BB agonist antibody 4B4-1-1 version 1.
- SEQ ID NO:81 is a heavy chain variable region (V H ) for the 4-1BB agonist antibody 4B4-1-1 version 2.
- SEQ ID NO:82 is a light chain variable region (VL) for the 4-1BB agonist antibody 4B4-1-1 version 2.
- SEQ ID NO:83 is a heavy chain variable region (VH) for the 4-1BB agonist antibody H39E3-2.
- SEQ ID NO:84 is a light chain variable region (V L ) for the 4-1BB agonist antibody H39E3-2.
- SEQ ID NO:85 is the amino acid sequence of human OX40.
- SEQ ID NO:86 is the amino acid sequence of murine OX40.
- SEQ ID NO:87 is the heavy chain for the OX40 agonist monoclonal antibody tavolixizumab (MEDI-0562).
- SEQ ID NO:88 is the light chain for the OX40 agonist monoclonal antibody tavolixizumab (MEDI-0562).
- SEQ ID NO:89 is the heavy chain variable region (V H ) for the OX40 agonist monoclonal antibody tavolixizumab (MEDI-0562).
- SEQ ID NO:90 is the light chain variable region (VL) for the OX40 agonist monoclonal antibody tavolixizumab (MEDI-0562).
- SEQ ID NO:91 is the heavy chain CDR1 for the OX40 agonist monoclonal antibody tavolixizumab (MEDI-0562).
- SEQ ID NO:92 is the heavy chain CDR2 for the OX40 agonist monoclonal antibody tavolixizumab (MEDI-0562).
- SEQ ID NO:93 is the heavy chain CDR3 for the OX40 agonist monoclonal antibody tavolixizumab (MEDI-0562).
- SEQ ID NO:94 is the light chain CDR1 for the OX40 agonist monoclonal antibody tavolixizumab (MEDI-0562).
- SEQ ID NO:95 is the light chain CDR2 for the OX40 agonist monoclonal antibody tavolixizumab (MEDI-0562).
- SEQ ID NO:96 is the light chain CDR3 for the OX40 agonist monoclonal antibody tavolixizumab (MEDI-0562).
- SEQ ID NO:97 is the heavy chain for the OX40 agonist monoclonal antibody 11D4.
- SEQ ID NO:98 is the light chain for the OX40 agonist monoclonal antibody 11D4.
- SEQ ID NO:99 is the heavy chain variable region (VH) for the OX40 agonist monoclonal antibody 11D4.
- SEQ ID NO:100 is the light chain variable region (VL) for the OX40 agonist monoclonal antibody 11D4.
- SEQ ID NO:101 is the heavy chain CDR1 for the OX40 agonist monoclonal antibody 11D4.
- SEQ ID NO:102 is the heavy chain CDR2 for the OX40 agonist monoclonal antibody 11D4.
- SEQ ID NO:103 is the heavy chain CDR3 for the OX40 agonist monoclonal antibody 11D4.
- SEQ ID NO:104 is the light chain CDR1 for the OX40 agonist monoclonal antibody 11D4.
- SEQ ID NO:105 is the light chain CDR2 for the OX40 agonist monoclonal antibody 11D4.
- SEQ ID NO:106 is the light chain CDR3 for the OX40 agonist monoclonal antibody 11D4.
- SEQ ID NO:107 is the heavy chain for the OX40 agonist monoclonal antibody 18D8.
- SEQ ID NO:108 is the light chain for the OX40 agonist monoclonal antibody 18D8.
- SEQ ID NO:109 is the heavy chain variable region (V H ) for the OX40 agonist monoclonal antibody 18D8.
- SEQ ID NO:110 is the light chain variable region (VL) for the OX40 agonist monoclonal antibody 18D8.
- SEQ ID NO:111 is the heavy chain CDR1 for the OX40 agonist monoclonal antibody 18D8.
- SEQ ID NO:112 is the heavy chain CDR2 for the OX40 agonist monoclonal antibody 18D8.
- SEQ ID NO:113 is the heavy chain CDR3 for the OX40 agonist monoclonal antibody 18D8.
- SEQ ID NO:114 is the light chain CDR1 for the OX40 agonist monoclonal antibody 18D8.
- SEQ ID NO:115 is the light chain CDR2 for the OX40 agonist monoclonal antibody 18D8.
- SEQ ID NO:116 is the light chain CDR3 for the OX40 agonist monoclonal antibody 18D8.
- SEQ ID NO:117 is the heavy chain variable region (V H ) for the OX40 agonist monoclonal antibody Hu119-122.
- SEQ ID NO:118 is the light chain variable region (VL) for the OX40 agonist monoclonal antibody Hu119-122.
- SEQ ID NO:119 is the heavy chain CDR1 for the OX40 agonist monoclonal antibody Hu119-122.
- SEQ ID NO:120 is the heavy chain CDR2 for the OX40 agonist monoclonal antibody Hu119-122.
- SEQ ID NO:121 is the heavy chain CDR3 for the OX40 agonist monoclonal antibody Hu119-122.
- SEQ ID NO:122 is the light chain CDR1 for the OX40 agonist monoclonal antibody Hu119-122.
- SEQ ID NO:123 is the light chain CDR2 for the OX40 agonist monoclonal antibody Hu119-122.
- SEQ ID NO:124 is the light chain CDR3 for the OX40 agonist monoclonal antibody Hu119-122.
- SEQ ID NO:125 is the heavy chain variable region (VH) for the OX40 agonist monoclonal antibody Hu106-222.
- SEQ ID NO:126 is the light chain variable region (VL) for the OX40 agonist monoclonal antibody Hu106-222.
- SEQ ID NO:127 is the heavy chain CDR1 for the OX40 agonist monoclonal antibody Hu106-222.
- SEQ ID NO:128 is the heavy chain CDR2 for the OX40 agonist monoclonal antibody Hu106-222.
- SEQ ID NO:129 is the heavy chain CDR3 for the OX40 agonist monoclonal antibody Hu106-222.
- SEQ ID NO:130 is the light chain CDR1 for the OX40 agonist monoclonal antibody Hu106-222.
- SEQ ID NO:131 is the light chain CDR2 for the OX40 agonist monoclonal antibody Hu106-222.
- SEQ ID NO:132 is the light chain CDR3 for the OX40 agonist monoclonal antibody Hu106-222.
- SEQ ID NO:133 is an OX40 ligand (OX40L) amino acid sequence.
- SEQ ID NO:134 is a soluble portion of OX40L polypeptide.
- SEQ ID NO:135 is an alternative soluble portion of OX40L polypeptide.
- SEQ ID NO:136 is the heavy chain variable region (VH) for the OX40 agonist monoclonal antibody 008.
- SEQ ID NO:137 is the light chain variable region (V L ) for the OX40 agonist monoclonal antibody 008.
- SEQ ID NO:138 is the heavy chain variable region (VH) for the OX40 agonist monoclonal antibody 011.
- SEQ ID NO:139 is the light chain variable region (VL) for the OX40 agonist monoclonal antibody 011.
- SEQ ID NO:140 is the heavy chain variable region (V H ) for the OX40 agonist monoclonal antibody 021.
- SEQ ID NO:141 is the light chain variable region (VL) for the OX40 agonist monoclonal antibody 021.
- SEQ ID NO:142 is the heavy chain variable region (V H ) for the OX40 agonist monoclonal antibody 023.
- SEQ ID NO:143 is the light chain variable region (VL) for the OX40 agonist monoclonal antibody 023.
- SEQ ID NO:144 is the heavy chain variable region (VH) for an OX40 agonist monoclonal antibody.
- SEQ ID NO:145 is the light chain variable region (V L ) for an OX40 agonist monoclonal antibody.
- SEQ ID NO:146 is the heavy chain variable region (VH) for an OX40 agonist monoclonal antibody.
- SEQ ID NO:147 is the light chain variable region (V L ) for an OX40 agonist monoclonal antibody.
- SEQ ID NO:148 is the heavy chain variable region (VH) for a humanized OX40 agonist monoclonal antibody.
- SEQ ID NO:149 is the heavy chain variable region (VH) for a humanized OX40 agonist monoclonal antibody.
- SEQ ID NO:150 is the light chain variable region (V L ) for a humanized OX40 agonist monoclonal antibody.
- SEQ ID NO:151 is the light chain variable region (VL) for a humanized OX40 agonist monoclonal antibody.
- SEQ ID NO:152 is the heavy chain variable region (V H ) for a humanized OX40 agonist monoclonal antibody.
- SEQ ID NO:153 is the heavy chain variable region (VH) for a humanized OX40 agonist monoclonal antibody.
- SEQ ID NO:154 is the light chain variable region (V L ) for a humanized OX40 agonist monoclonal antibody.
- SEQ ID NO:155 is the light chain variable region (VL) for a humanized OX40 agonist monoclonal antibody.
- SEQ ID NO:156 is the heavy chain variable region (VH) for an OX40 agonist monoclonal antibody.
- SEQ ID NO:157 is the light chain variable region (VL) for an OX40 agonist monoclonal antibody.
- SEQ ID NO:158 is the heavy chain amino acid sequence of the PD-1 inhibitor nivolumab.
- SEQ ID NO:159 is the light chain amino acid sequence of the PD-1 inhibitor nivolumab.
- SEQ ID NO:160 is the heavy chain variable region (VH) amino acid sequence of the PD-1 inhibitor nivolumab.
- SEQ ID NO:161 is the light chain variable region (V L ) amino acid sequence of the PD-1 inhibitor nivolumab.
- SEQ ID NO:162 is the heavy chain CDR1 amino acid sequence of the PD-1 inhibitor nivolumab.
- SEQ ID NO:163 is the heavy chain CDR2 amino acid sequence of the PD-1 inhibitor nivolumab.
- SEQ ID NO:164 is the heavy chain CDR3 amino acid sequence of the PD-1 inhibitor nivolumab.
- SEQ ID NO:165 is the light chain CDR1 amino acid sequence of the PD-1 inhibitor nivolumab.
- SEQ ID NO:166 is the light chain CDR2 amino acid sequence of the PD-1 inhibitor nivolumab.
- SEQ ID NO:167 is the light chain CDR3 amino acid sequence of the PD-1 inhibitor nivolumab.
- SEQ ID NO:168 is the heavy chain amino acid sequence of the PD-1 inhibitor pembrolizumab.
- SEQ ID NO:169 is the light chain amino acid sequence of the PD-1 inhibitor pembrolizumab.
- SEQ ID NO:170 is the heavy chain variable region (VH) amino acid sequence of the PD-1 inhibitor pembrolizumab.
- SEQ ID NO:171 is the light chain variable region (VL) amino acid sequence of the PD-1 inhibitor pembrolizumab.
- SEQ ID NO:172 is the heavy chain CDR1 amino acid sequence of the PD-1 inhibitor pembrolizumab.
- SEQ ID NO:173 is the heavy chain CDR2 amino acid sequence of the PD-1 inhibitor pembrolizumab.
- SEQ ID NO:174 is the heavy chain CDR3 amino acid sequence of the PD-1 inhibitor pembrolizumab.
- SEQ ID NO:175 is the light chain CDR1 amino acid sequence of the PD-1 inhibitor pembrolizumab.
- SEQ ID NO:176 is the light chain CDR2 amino acid sequence of the PD-1 inhibitor pembrolizumab.
- SEQ ID NO:177 is the light chain CDR3 amino acid sequence of the PD-1 inhibitor pembrolizumab.
- SEQ ID NO:178 is the heavy chain amino acid sequence of the PD-L1 inhibitor durvalumab.
- SEQ ID NO:179 is the light chain amino acid sequence of the PD-L1 inhibitor durvalumab.
- SEQ ID NO:180 is the heavy chain variable region (V H ) amino acid sequence of the PD-L1 inhibitor durvalumab.
- SEQ ID NO:181 is the light chain variable region (VL) amino acid sequence of the PD-L1 inhibitor durvalumab.
- SEQ ID NO:182 is the heavy chain CDR1 amino acid sequence of the PD-L1 inhibitor durvalumab.
- SEQ ID NO:183 is the heavy chain CDR2 amino acid sequence of the PD-L1 inhibitor durvalumab.
- SEQ ID NO:184 is the heavy chain CDR3 amino acid sequence of the PD-L1 inhibitor durvalumab.
- SEQ ID NO:185 is the light chain CDR1 amino acid sequence of the PD-L1 inhibitor durvalumab.
- SEQ ID NO:186 is the light chain CDR2 amino acid sequence of the PD-L1 inhibitor durvalumab.
- SEQ ID NO:187 is the light chain CDR3 amino acid sequence of the PD-L1 inhibitor durvalumab.
- SEQ ID NO:188 is the heavy chain amino acid sequence of the PD-L1 inhibitor avelumab.
- SEQ ID NO:189 is the light chain amino acid sequence of the PD-L1 inhibitor avelumab.
- SEQ ID NO:190 is the heavy chain variable region (VH) amino acid sequence of the PD-L1 inhibitor avelumab.
- SEQ ID NO:191 is the light chain variable region (VL) amino acid sequence of the PD-L1 inhibitor avelumab.
- SEQ ID NO:192 is the heavy chain CDR1 amino acid sequence of the PD-L1 inhibitor avelumab.
- SEQ ID NO:193 is the heavy chain CDR2 amino acid sequence of the PD-L1 inhibitor avelumab.
- SEQ ID NO:194 is the heavy chain CDR3 amino acid sequence of the PD-L1 inhibitor avelumab.
- SEQ ID NO:195 is the light chain CDR1 amino acid sequence of the PD-L1 inhibitor avelumab.
- SEQ ID NO:196 is the light chain CDR2 amino acid sequence of the PD-L1 inhibitor avelumab.
- SEQ ID NO:197 is the light chain CDR3 amino acid sequence of the PD-L1 inhibitor avelumab.
- SEQ ID NO:198 is the heavy chain amino acid sequence of the PD-L1 inhibitor atezolizumab.
- SEQ ID NO:199 is the light chain amino acid sequence of the PD-L1 inhibitor atezolizumab.
- SEQ ID NO:200 is the heavy chain variable region (VH) amino acid sequence of the PD-L1 inhibitor atezolizumab.
- SEQ ID NO:201 is the light chain variable region (V L ) amino acid sequence of the PD-L1 inhibitor atezolizumab.
- SEQ ID NO:202 is the heavy chain CDR1 amino acid sequence of the PD-L1 inhibitor atezolizumab.
- SEQ ID NO:203 is the heavy chain CDR2 amino acid sequence of the PD-L1 inhibitor atezolizumab.
- SEQ ID NO:204 is the heavy chain CDR3 amino acid sequence of the PD-L1 inhibitor atezolizumab.
- SEQ ID NO:205 is the light chain CDR1 amino acid sequence of the PD-L1 inhibitor atezolizumab.
- SEQ ID NO:206 is the light chain CDR2 amino acid sequence of the PD-L1 inhibitor atezolizumab.
- SEQ ID NO:207 is the light chain CDR3 amino acid sequence of the PD-L1 inhibitor atezolizumab.
- SEQ ID NO:208 is the heavy chain amino acid sequence of the CTLA-4 inhibitor ipilimumab.
- SEQ ID NO:209 is the light chain amino acid sequence of the CTLA-4 inhibitor ipilimumab.
- SEQ ID NO:210 is the heavy chain variable region (V H ) amino acid sequence of the CTLA-4 inhibitor ipilimumab.
- SEQ ID NO:211 is the light chain variable region (VL) amino acid sequence of the CTLA-4 inhibitor ipilimumab.
- SEQ ID NO:212 is the heavy chain CDR1 amino acid sequence of the CTLA-4 inhibitor ipilimumab.
- SEQ ID NO:213 is the heavy chain CDR2 amino acid sequence of the CTLA-4 inhibitor ipilimumab.
- SEQ ID NO:214 is the heavy chain CDR3 amino acid sequence of the CTLA-4 inhibitor ipilimumab.
- SEQ ID NO:215 is the light chain CDR1 amino acid sequence of the CTLA-4 inhibitor ipilimumab.
- SEQ ID NO:216 is the light chain CDR2 amino acid sequence of the CTLA-4 inhibitor ipilimumab.
- SEQ ID NO:217 is the light chain CDR3 amino acid sequence of the CTLA-4 inhibitor ipilimumab.
- SEQ ID NO:218 is the heavy chain amino acid sequence of the CTLA-4 inhibitor tremelimumab.
- SEQ ID NO:219 is the light chain amino acid sequence of the CTLA-4 inhibitor tremelimumab.
- SEQ ID NO:220 is the heavy chain variable region (V H ) amino acid sequence of the CTLA-4 inhibitor tremelimumab.
- SEQ ID NO:221 is the light chain variable region (VL) amino acid sequence of the CTLA-4 inhibitor tremelimumab.
- SEQ ID NO:222 is the heavy chain CDR1 amino acid sequence of the CTLA-4 inhibitor tremelimumab.
- SEQ ID NO:223 is the heavy chain CDR2 amino acid sequence of the CTLA-4 inhibitor tremelimumab.
- SEQ ID NO:224 is the heavy chain CDR3 amino acid sequence of the CTLA-4 inhibitor tremelimumab.
- SEQ ID NO:225 is the light chain CDR1 amino acid sequence of the CTLA-4 inhibitor tremelimumab.
- SEQ ID NO:226 is the light chain CDR2 amino acid sequence of the CTLA-4 inhibitor tremelimumab.
- SEQ ID NO:227 is the light chain CDR3 amino acid sequence of the CTLA-4 inhibitor tremelimumab.
- SEQ ID NO:228 is the heavy chain amino acid sequence of the CTLA-4 inhibitor zalifrelimab.
- SEQ ID NO:229 is the light chain amino acid sequence of the CTLA-4 inhibitor zalifrelimab.
- SEQ ID NO:230 is the heavy chain variable region (VH) amino acid sequence of the CTLA-4 inhibitor zalifrelimab.
- SEQ ID NO:231 is the light chain variable region (V L ) amino acid sequence of the CTLA-4 inhibitor zalifrelimab.
- SEQ ID NO:232 is the heavy chain CDR1 amino acid sequence of the CTLA-4 inhibitor zalifrelimab.
- SEQ ID NO:233 is the heavy chain CDR2 amino acid sequence of the CTLA-4 inhibitor zalifrelimab.
- SEQ ID NO:234 is the heavy chain CDR3 amino acid sequence of the CTLA-4 inhibitor zalifrelimab.
- SEQ ID NO:235 is the light chain CDR1 amino acid sequence of the CTLA-4 inhibitor zalifrelimab.
- SEQ ID NO:236 is the light chain CDR2 amino acid sequence of the CTLA-4 inhibitor zalifrelimab.
- SEQ ID NO:237 is the light chain CDR3 amino acid sequence of the CTLA-4 inhibitor zalifrelimab.
- SEQ ID NO:238 is a CD8a transmembrane domain.
- SEQ ID NO:239 is a B7-1 transmembrane-intracellular domain
- SEQ ID NOs:240-245 are exemplary glycine-serine linkers that are useful in the immunomodulatory fusion proteins described herein.
- SEQ ID NO:246 is an exemplary linker that is useful in the immunomodulatory fusion proteins described herein.
- SEQ ID NO:247 is a 2A peptide C-terminus sequence.
- SEQ ID NO:248 is a porcine teschovirus-12A peptide.
- SEQ ID NO:249 is an equine rhinitis A virus 2A peptide.
- SEQ ID NO:250 is a foot-and-mouth disease virus 2A peptide.
- SEQ ID NO:251 is an exemplary furin-cleavable 2A peptide.
- SEQ ID NOs:252 and 253 are human IgE signal peptide sequences.
- SEQ ID NO:254 is a human IL-2 signal peptide sequence.
- SEQ ID NO:255 is a 6X NFAT IL-2 minimal promoter.
- SEQ ID NO:256 is an NFAT responsive element.
- SEQ ID NO:257 is a human IL-2 promoter sequence.
- SEQ ID NO:258 is human IL-15 (N72D mutant).
- SEQ ID NO:259 is human IL-15R-alpha-Su/Fc domain.
- SEQ ID NO:260 is human IL-15R-alpha-Su (65aa truncated extracellular domain).
- SEQ ID NO:261 is human IL-15 isoform 2.
- SEQ ID NO:262 is human IL-15 isoform 1.
- SEQ ID NO:263 is human IL-15 (without signal peptide).
- SEQ ID NO:264 is human IL-15R-alpha (85 aa truncated extracellular domain).
- SEQ ID NO:265 is human IL-15R-alpha (182aa truncated extracellular domain).
- SEQ ID NO:266 is human IL-15R-alpha.
- SEQ ID NO:267 is human IL-12 p35 subunit.
- SEQ ID NO:268 is human IL-12 p40 subunit.
- SEQ ID NO:269 is human IL-18
- SEQ ID NO:270 is a human IL-18 variant
- SEQ ID NO:271 is human IL-21.
- SEQ ID NO: 272 is human IL-2 [00426]
- SEQ ID NO:273 is human CD40L [00427]
- SEQ ID NO:274 is agonistic anti-human CD40 VH (Sotigalimab) [00428]
- SEQ ID NO:275 is agonistic anti-human CD40 VL (Sotigalimab) [00429]
- SEQ ID NO:276 is agonistic anti-human CD40 scFv (Sotigalimab) [00430]
- SEQ ID NO:277 is agonistic anti-human CD40 VH (Dacetuzumab) [00431]
- SEQ ID NO:278 is agonistic anti-human CD40 VL (Dacetuzumab) [00432]
- SEQ ID NO:279 is agonistic anti-human CD40 scFv (Dacetuzumab) [00433]
- SEQ ID NO:280 is agonistic anti
- SEQ ID NO:287 is a target PD-1 sequence.
- SEQ ID NO:288 is a repeat PD-1 left repeat sequence.
- SEQ ID NO:289 is a repeat PD-1 right repeat sequence.
- SEQ ID NO:290 is a repeat PD-1 left repeat sequence.
- SEQ ID NO:291 is a repeat PD-1 right repeat sequence.
- SEQ ID NO:292 is a PD-1 left TALEN nuclease sequence.
- SEQ ID NO:293 is a PD-1 right TALEN nuclease sequence.
- SEQ ID NO:294 is a PD-1 left TALEN nuclease sequence.
- SEQ ID NO:295 is a PD-1 right TALEN nuclease sequence.
- SEQ ID NO:296 is a nucleic acid sequence that encodes for the tethered IL-15 of SEQ ID NO:328
- SEQ ID NO:297 is a nucleic acid sequence that encodes for the tethered IL-21 fusion protein of SEQ ID NO:.
- SEQ ID NO:298 is a nucleic acid sequence that encodes for the tethered IL-15 fusion protein of SEQ ID NO:328 and tether IL-21 fusion protein of SEQ ID NO:331.
- SEQ ID NO:299 is a nucleic acid sequence that encodes for the tethered IL-12 fusion protein of SEQ ID NO:303. The nucleic acid sequence includes an NFAT promoter.
- SEQ ID NO:300 is a nucleic acid sequence that encodes for the tethered IL-15 fusion protein of SEQ ID NO:328. The nucleic acid sequence includes an NFAT promoter.
- SEQ ID NO:301 is a nucleic acid sequence that encodes for the tethered IL-21 fusion protein of SEQ ID NO:XX.
- the nucleic acid sequence includes an NFAT promoter.
- SEQ ID NO:302 is a nucleic acid sequence that encodes for the tethered IL-15 fusion protein of SEQ ID NO:328 and tether IL-21 fusion protein of SEQ ID NO:331.
- the nucleic acid sequence includes an NFAT promoter.
- SEQ ID NO:303 is the amino acid sequence of an exemplary tethered IL-12 (tethered IL-12-Lr1-Ar2).
- SEQ ID NO:304 is a nucleic acid sequence that encodes for the tethered IL-12 of SEQ ID NO:303.
- SEQ ID NO:305 is the amino acid sequence of an exemplary tethered IL-18 (tethered IL-18-Lr1-Ar2).
- SEQ ID NO:306 is a nucleic acid sequence that encodes for the tethered IL-18 of SEQ ID NO:305.
- SEQ ID NO:307 is the amino acid sequence of an exemplary tethered variant IL-18 (tethered DR-IL-18 (6-27 variant)-Lr1-Ar2).
- SEQ ID NO:308 is a nucleic acid sequence that encodes for the tethered variant IL- 18 of SEQ ID NO:307.
- SEQ ID NO:309 is the amino acid sequence of an exemplary tethered IL-12/IL-15.
- SEQ ID NO:310 is a nucleic acid sequence that encodes for the tethered IL-12/IL- 15 of SEQ ID NO:309.
- SEQ ID NO:311 is the amino acid sequence of an exemplary tethered IL-18/IL-15.
- SEQ ID NO:312 is a nucleic acid sequence that encodes for the tethered IL-18/IL- 15 of SEQ ID NO:311.
- SEQ ID NO:313 is the amino acid sequence of an exemplary tethered anti- CD40scFV (APX005M).
- SEQ ID NO:314 is a nucleic acid sequence that encodes for the tethered anti- CD40scFV (APX005M) of SEQ ID NO:313.
- SEQ ID NO:315 is the amino acid sequence of an exemplary tethered anti- CD40scFV (Dacetuzumab).
- SEQ ID NO:316 is a nucleic acid sequence that encodes for the tethered anti- CD40scFV (Dacetuzumab) of SEQ ID NO:315.
- SEQ ID NO:317 is the amino acid sequence of an exemplary tethered anti- CD40scFV (Lucatutuzumab).
- SEQ ID NO:318 is a nucleic acid sequence that encodes for the tethered anti- CD40scFV (Lucatutuzumab) of SEQ ID NO:317.
- SEQ ID NO:319 is the amino acid sequence of an exemplary tethered anti- CD40scFV (Selicrelumab).
- SEQ ID NO:320 is a nucleic acid sequence that encodes for the tethered anti- CD40scFV (Selicrelumab) of SEQ ID NO:319.
- SEQ ID NO:321 is a nucleic acid sequence that encodes for the CD40L of SEQ ID NO:273.
- SEQ ID NO:322 is the amino acid sequence an exemplary tethered CD40L/IL-15.
- SEQ ID NO:323 is a nucleic acid sequence that encodes for the tethered CD40L/IL- 15 of SEQ ID NO:311.
- SEQ ID NO:324 is the amino acid sequence of an exemplary tethered IL-2.
- SEQ ID NO:325 is a nucleic acid sequence that encodes for the tethered IL-2 of SEQ ID NO:313.
- SEQ ID NO:326 is the amino acid sequence of an exemplary tethered IL-12.
- SEQ ID NO:327 is a nucleic acid sequence that encodes for the tethered IL-12 of SEQ ID NO:315.
- SEQ ID NO:328 is the amino acid sequence of an exemplary tethered IL-15.
- SEQ ID NO:329 is a nucleic acid sequence that encodes for the tethered IL-15 of SEQ ID NO:317.
- SEQ ID NO:330 is a nucleic acid sequence that encodes for GFP.
- SEQ ID NOS:331-385 are nucleic acids of additiona variant IL-18s (e.g., decoy- resistant IL-18s or “DR-IL18”).
- SEQ ID NO:386 is an exemplary Clo05 l nuclease domain amino acid sequence.
- SEQ ID NO:387 is an exemplary piggyBac (PB) transposase enzyme amino acid sequence.
- SEQ ID NO:388 is an exemplary Sleeping Beauty transposase enzyme amino acid sequence.
- SEQ ID NO:389 is an exemplary hyperactive Sleeping Beauty (SB100X) transposase amino acid sequence.
- SEQ ID NO:390 is an exemplary nucleic acid sequence of a 6XNFAT binding motif.
- SEQ ID NO:391 is an exemplarynucleic acid sequence of an IL-2min promoter.
- SEQ ID NO:392 is an Tethered IL-12 (TeIL-12).
- SEQ ID NO:393 is an exemplary nucleic acid sequence of an IRES.
- SEQ ID NO:394 is an exemplary nucleic acid sequence of a U6 promoter.
- SEQ ID NO:395- SEQ ID NO:401 are exemplary nucleic acid sequence of PD-1 shRNAs. DETAILED DESCRIPTION I. Introduction [00495]
- Adoptive cell therapy utilizing TILs is an effective approach for inducing tumor regression in various cancers, including leukemias and melanoma. The use of adjuvants that include immunostimulatory agents has been explored to enhance adoptive cell therapies and to extend such therapies to other solid tumors.
- compositions and methods for the treatment of cancers using modified TILs wherein the modified TILs include one or more immunomodulatory agents (e.g., cytokines) associated with their cell surface.
- the immunomodulatory agents associated with the TILs provide a localized immunostimulatory effect that can advantageously enhance TIL survival and/or anti-tumor activity in a patient recipient.
- the compositions and methods disclosed herein provide effective cancer therapies. II.
- Co-administration includes simultaneous administration in separate compositions, administration at different times in separate compositions, or administration in a composition in which two or more active pharmaceutical ingredients are present. Simultaneous administration in separate compositions and administration in a composition in which both agents are present are preferred.
- the term “in vivo” refers to an event that takes place in a subject's body.
- the term “in vitro” refers to an event that takes places outside of a subject's body. In vitro assays encompass cell-based assays in which cells alive or dead are employed and may also encompass a cell-free assay in which no intact cells are employed.
- ex vivo refers to an event which involves treating or performing a procedure on a cell, tissue and/or organ which has been removed from a subject’s body. Aptly, the cell, tissue and/or organ may be returned to the subject’s body in a method of surgery or treatment.
- TILs tumor infiltrating lymphocytes
- TILs tumor infiltrating lymphocytes
- TILs include, but are not limited to, CD8 + cytotoxic T cells (lymphocytes), Th1 and Th17 CD4 + T cells, natural killer cells, dendritic cells and M1 macrophages.
- TILs include both primary and secondary TILs. “Primary TILs” are those that are obtained from patient tissue samples as outlined herein (sometimes referred to as “freshly harvested”), and “secondary TILs” are any TIL cell populations that have been expanded or proliferated as discussed herein, including, but not limited to bulk TILs and expanded TILs (“REP TILs” or “post-REP TILs”). TIL cell populations can include genetically modified TILs.
- population of cells herein is meant a number of cells that share common traits. In general, populations generally range from 1 X 10 6 to 1 X 10 10 in number, with different TIL populations comprising different numbers. For example, initial growth of primary TILs in the presence of IL-2 results in a population of bulk TILs of roughly 1 ⁇ 10 8 cells. REP expansion is generally done to provide populations of 1.5 ⁇ 10 9 to 1.5 ⁇ 10 10 cells for infusion. [00505] By cryopreserved TILs herein is meant that TILs, either primary, bulk, or expanded (REP TILs), are treated and stored in the range of about -150°C to -60°C.
- cryopreserved TILs are distinguishable from frozen tissue samples which may be used as a source of primary TILs.
- thawed cryopreserved TILs herein is meant a population of TILs that was previously cryopreserved and then treated to return to room temperature or higher, including but not limited to cell culture temperatures or temperatures wherein TILs may be administered to a patient.
- TILs can generally be defined either biochemically, using cell surface markers, or functionally, by their ability to infiltrate tumors and effect treatment.
- TILs can be generally categorized by expressing one or more of the following biomarkers: CD4, CD8, TCR ⁇ , CD27, CD28, CD56, CCR7, CD45Ra, CD95, PD-1, and CD25. Additionally and alternatively, TILs can be functionally defined by their ability to infiltrate solid tumors upon reintroduction into a patient.
- the term “cryopreservation media” or “cryopreservation medium” refers to any medium that can be used for cryopreservation of cells. Such media can include media comprising 7% to 10% DMSO. Exemplary media include CryoStor CS10, Hyperthermasol, as well as combinations thereof.
- CS10 refers to a cryopreservation medium which is obtained from Stemcell Technologies or from Biolife Solutions.
- the CS10 medium may be referred to by the trade name “CryoStor® CS10”.
- the CS10 medium is a serum-free, animal component-free medium which comprises DMSO.
- central memory T cell refers to a subset of T cells that in the human are CD45R0+ and constitutively express CCR7 (CCR7 hi ) and CD62L (CD62 hi ).
- the surface phenotype of central memory T cells also includes TCR, CD3, CD127 (IL-7R), and IL-15R.
- central memory T cells Transcription factors for central memory T cells include BCL-6, BCL-6B, MBD2, and BMI1.
- Central memory T cells primarily secret IL-2 and CD40L as effector molecules after TCR triggering.
- Central memory T cells are predominant in the CD4 compartment in blood, and in the human are proportionally enriched in lymph nodes and tonsils.
- effector memory T cell refers to a subset of human or mammalian T cells that, like central memory T cells, are CD45R0+, but have lost the constitutive expression of CCR7 (CCR7 lo ) and are heterogeneous or low for CD62L expression (CD62L lo ).
- the surface phenotype of central memory T cells also includes TCR, CD3, CD127 (IL-7R), and IL-15R.
- Transcription factors for central memory T cells include BLIMP1. Effector memory T cells rapidly secret high levels of inflammatory cytokines following antigenic stimulation, including interferon- ⁇ , IL-4, and IL-5. Effector memory T cells are predominant in the CD8 compartment in blood, and in the human are proportionally enriched in the lung, liver, and gut. CD8+ effector memory T cells carry large amounts of perforin.
- the term “closed system” refers to a system that is closed to the outside environment. Any closed system appropriate for cell culture methods can be employed with the methods of the present invention.
- Closed systems include, for example, but are not limited to, closed G-containers. Once a tumor segment is added to the closed system, the system is no opened to the outside environment until the TILs are ready to be administered to the patient.
- fragmenting includes mechanical fragmentation methods such as crushing, slicing, dividing, and morcellating tumor tissue as well as any other method for disrupting the physical structure of tumor tissue.
- PBMCs peripheral blood mononuclear cells
- PBMCs refers to a peripheral blood cell having a round nucleus, including lymphocytes (T cells, B cells, NK cells) and monocytes.
- peripheral blood mononuclear cells When used as an antigen presenting cell (PBMCs are a type of antigen-presenting cell), the peripheral blood mononuclear cells are preferably irradiated allogeneic peripheral blood mononuclear cells.
- peripheral blood lymphocytes and “PBLs” refer to T cells expanded from peripheral blood.
- PBLs are separated from whole blood or apheresis product from a donor.
- PBLs are separated from whole blood or apheresis product from a donor by positive or negative selection of a T cell phenotype, such as the T cell phenotype of CD3+ CD45+.
- anti-CD3 antibody refers to an antibody or variant thereof, e.g., a monoclonal antibody and including human, humanized, chimeric or murine antibodies which are directed against the CD3 receptor in the T cell antigen receptor of mature T cells.
- Anti- CD3 antibodies include OKT-3, also known as muromonab.
- Anti-CD3 antibodies also include the UHCT1 clone, also known as T3 and CD3 ⁇ .
- Other anti-CD3 antibodies include, for example, otelixizumab, teplizumab, and visilizumab.
- OKT-3 refers to a monoclonal antibody or biosimilar or variant thereof, including human, humanized, chimeric, or murine antibodies, directed against the CD3 receptor in the T cell antigen receptor of mature T cells, and includes commercially-available forms such as OKT-3 (30 ng/mL, MACS GMP CD3 pure, Miltenyi Biotech, Inc., San Diego, CA, USA) and muromonab or variants, conservative amino acid substitutions, glycoforms, or biosimilars thereof.
- the amino acid sequences of the heavy and light chains of muromonab are given in Table 1 (SEQ ID NO:1 and SEQ ID NO:2).
- a hybridoma capable of producing OKT-3 is deposited with the American Type Culture Collection and assigned the ATCC accession number CRL 8001.
- a hybridoma capable of producing OKT-3 is also deposited with European Collection of Authenticated Cell Cultures (ECACC) and assigned Catalogue No.86022706.
- ECACC European Collection of Authenticated Cell Cultures
- TABLE 1 Amino acid sequences of muromonab (exemplary OKT-3 antibody).
- Identifier Sequence One-Letter Amino Acid Symbols
- interleukin-2 includes all forms of IL-2 including human and mammalian forms, conservative amino acid substitutions, glycoforms, biosimilars, and variants thereof.
- IL-2 is described, e.g., in Nelson, J.
- IL-2 encompasses human, recombinant forms of IL-2 such as aldesleukin (PROLEUKIN, available commercially from multiple suppliers in 22 million IU per single use vials), as well as the form of recombinant IL-2 commercially supplied by CellGenix, Inc., Portsmouth, NH, USA (CELLGRO GMP) or ProSpec-Tany TechnoGene Ltd., East Brunswick, NJ, USA (Cat. No. CYT-209-b) and other commercial equivalents from other vendors.
- Aldesleukin (des-alanyl-1, serine-125 human IL- 2) is a nonglycosylated human recombinant form of IL-2 with a molecular weight of approximately 15 kDa.
- IL-2 also encompasses pegylated forms of IL-2, as described herein, including the pegylated IL2 prodrug bempegaldesleukin (NKTR-214, pegylated human recombinant IL-2 as in SEQ ID NO:4 in which an average of 6 lysine residues are N 6 substituted with [(2,7-bis ⁇ [methylpoly(oxyethylene)]carbamoyl ⁇ -9H- fluoren-9-yl)methoxy]carbonyl), which is available from Nektar Therapeutics, South San Francisco, CA, USA, or which may be prepared by methods known in the art, such as the methods described in Example 19 of International Patent Application Publication No.
- NKTR-214 pegylated human recombinant IL-2 as in SEQ ID NO:4 in which an average of 6 lysine residues are N 6 substituted with [(2,7-bis ⁇ [methylpoly(oxyethylene)]carbamoyl ⁇ -9H- fluoren
- WO 2018/132496 A1 or the method described in Example 1 of U.S. Patent Application Publication No. US 2019/0275133 A1, the disclosures of which are incorporated by reference herein.
- Bempegaldesleukin (NKTR-214) and other pegylated IL-2 molecules suitable for use in the invention are described in U.S. Patent Application Publication No. US 2014/0328791 A1 and International Patent Application Publication No. WO 2012/065086 A1, the disclosures of which are incorporated by reference herein.
- Alternative forms of conjugated IL-2 suitable for use in the invention are described in U.S. Patent Nos.4,766,106, 5,206,344, 5,089,261 and 4,902,502, the disclosures of which are incorporated by reference herein.
- an IL-2 form suitable for use in the present invention is THOR-707, available from Synthorx, Inc.
- the preparation and properties of THOR-707 and additional alternative forms of IL-2 suitable for use in the invention are described in U.S. Patent Application Publication Nos. US 2020/0181220 A1 and US 2020/0330601 A1, the disclosures of which are incorporated by reference herein.
- IL-2 form suitable for use in the invention is an interleukin 2 (IL-2) conjugate comprising: an isolated and purified IL-2 polypeptide; and a conjugating moiety that binds to the isolated and purified IL-2 polypeptide at an amino acid position selected from K35, T37, R38, T41, F42, K43, F44, Y45, E61, E62, E68, K64, P65, V69, L72, and Y107, wherein the numbering of the amino acid residues corresponds to SEQ ID NO:5.
- IL-2 interleukin 2
- the amino acid position is selected from T37, R38, T41, F42, F44, Y45, E61, E62, E68, K64, P65, V69, L72, and Y107. In some embodiments, the amino acid position is selected from T37, R38, T41, F42, F44, Y45, E61, E62, E68, P65, V69, L72, and Y107. In some embodiments, the amino acid position is selected from T37, T41, F42, F44, Y45, P65, V69, L72, and Y107. In some embodiments, the amino acid position is selected from R38 and K64.
- the amino acid position is selected from E61, E62, and E68. In some embodiments, the amino acid position is at E62. In some embodiments, the amino acid residue selected from K35, T37, R38, T41, F42, K43, F44, Y45, E61, E62, E68, K64, P65, V69, L72, and Y107 is further mutated to lysine, cysteine, or histidine. In some embodiments, the amino acid residue is mutated to cysteine. In some embodiments, the amino acid residue is mutated to lysine.
- the amino acid residue selected from K35, T37, R38, T41, F42, K43, F44, Y45, E61, E62, E68, K64, P65, V69, L72, and Y107 is further mutated to an unnatural amino acid.
- the unnatural amino acid comprises N6-azidoethoxy-L- lysine (AzK), N6-propargylethoxy-L-lysine (PraK), BCN-L-lysine, norbornene lysine, TCO- lysine, methyltetrazine lysine, allyloxycarbonyllysine, 2-amino-8-oxononanoic acid, 2- amino-8-oxooctanoic acid, p-acetyl-L-phenylalanine, p-azidomethyl-L-phenylalanine (pAMF), p-iodo-L-phenylalanine, m-acetylphenylalanine, 2-amino-8-oxononanoic acid, p- propargyloxyphenylalanine, p-propargyl-phenylalanine, 3-methyl-phenylalanine, L-Dopa
- the IL-2 conjugate has a decreased affinity to IL-2 receptor ⁇ (IL-2R ⁇ ) subunit relative to a wild-type IL-2 polypeptide.
- the decreased affinity is about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, or greater than 99% decrease in binding affinity to IL-2R ⁇ relative to a wild-type IL-2 polypeptide.
- the decreased affinity is about 1-fold, 2-fold, 3-fold, 4- fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 30-fold, 50-fold, 100-fold, 200-fold, 300- fold, 500-fold, 1000-fold, or more relative to a wild-type IL-2 polypeptide.
- the conjugating moiety impairs or blocks the binding of IL-2 with IL-2R ⁇ .
- the conjugating moiety comprises a water-soluble polymer.
- the additional conjugating moiety comprises a water-soluble polymer.
- each of the water-soluble polymers independently comprises polyethylene glycol (PEG), poly(propylene glycol) (PPG), copolymers of ethylene glycol and propylene glycol, poly(oxyethylated polyol), poly(olefinic alcohol), poly(vinylpyrrolidone), poly(hydroxyalkylmethacrylamide), poly(hydroxyalkylmethacrylate), poly(saccharides), poly( ⁇ -hydroxy acid), poly(vinyl alcohol), polyphosphazene, polyoxazolines (POZ), poly(N- acryloylmorpholine), or a combination thereof.
- each of the water- soluble polymers independently comprises PEG.
- the PEG is a linear PEG or a branched PEG.
- each of the water-soluble polymers independently comprises a polysaccharide.
- the polysaccharide comprises dextran, polysialic acid (PSA), hyaluronic acid (HA), amylose, heparin, heparan sulfate (HS), dextrin, or hydroxyethyl-starch (HES).
- each of the water-soluble polymers independently comprises a glycan.
- each of the water-soluble polymers independently comprises polyamine.
- the conjugating moiety comprises a protein.
- the additional conjugating moiety comprises a protein. In some embodiments, each of the proteins independently comprises an albumin, a transferrin, or a transthyretin. In some embodiments, each of the proteins independently comprises an Fc portion. In some embodiments, each of the proteins independently comprises an Fc portion of IgG. In some embodiments, the conjugating moiety comprises a polypeptide. In some embodiments, the additional conjugating moiety comprises a polypeptide.
- each of the polypeptides independently comprises a XTEN peptide, a glycine-rich homoamino acid polymer (HAP), a PAS polypeptide, an elastin-like polypeptide (ELP), a CTP peptide, or a gelatin-like protein (GLK) polymer.
- the isolated and purified IL-2 polypeptide is modified by glutamylation.
- the conjugating moiety is directly bound to the isolated and purified IL-2 polypeptide.
- the conjugating moiety is indirectly bound to the isolated and purified IL-2 polypeptide through a linker.
- the linker comprises a homobifunctional linker.
- the homobifunctional linker comprises Lomant's reagent dithiobis (succinimidylpropionate) DSP, 3′3′- dithiobis(sulfosuccinimidyl proprionate) (DTSSP), disuccinimidyl suberate (DSS), bis(sulfosuccinimidyl)suberate (BS), disuccinimidyl tartrate (DST), disulfosuccinimidyl tartrate (sulfo DST), ethylene glycobis(succinimidylsuccinate) (EGS), disuccinimidyl glutarate (DSG), N,N′-disuccinimidyl carbonate (DSC), dimethyl adipimidate (DMA), dimethyl pimelimidate (DMP), dimethyl suberimidate (DMS), dimethyl-3,3′- dithiobispropionimidate (DTBP), 1,4-di-(3′-(2′-)
- the linker comprises a heterobifunctional linker.
- the heterobifunctional linker comprises N-succinimidyl 3-(2- pyridyldithio)propionate (sPDP), long-chain N-succinimidyl 3-(2-pyridyldithio)propionate (LC-sPDP), water-soluble-long-chain N-succinimidyl 3-(2-pyridyldithio) propionate (sulfo- LC-sPDP), succinimidyloxycarbonyl- ⁇ -methyl- ⁇ -(2-pyridyldithio)toluene (sMPT), sulfosuccinimidyl-6-[ ⁇ -methyl- ⁇ -(2-pyridyldithio)toluamido]hexanoate (sulfo-LC-sMPT), succinimidyl-4-(N-maleimidomethyl)cyclo
- the linker comprises a cleavable linker, optionally comprising a dipeptide linker.
- the dipeptide linker comprises Val-Cit, Phe-Lys, Val-Ala, or Val-Lys.
- the linker comprises a non-cleavable linker.
- the linker comprises a maleimide group, optionally comprising maleimidocaproyl (mc), succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (sMCC), or sulfosuccinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (sulfo- sMCC).
- the linker further comprises a spacer.
- the spacer comprises p-aminobenzyl alcohol (PAB), p-aminobenzyoxycarbonyl (PABC), a derivative, or an analog thereof.
- the conjugating moiety is capable of extending the serum half-life of the IL-2 conjugate.
- the additional conjugating moiety is capable of extending the serum half-life of the IL-2 conjugate.
- the IL-2 form suitable for use in the invention is a fragment of any of the IL-2 forms described herein.
- the IL-2 form suitable for use in the invention is pegylated as disclosed in U.S. Patent Application Publication No. US 2020/0181220 A1 and U.S. Patent Application Publication No. US 2020/0330601 A1.
- the IL-2 form suitable for use in the invention is an IL-2 conjugate comprising: an IL-2 polypeptide comprising an N6-azidoethoxy-L-lysine (AzK) covalently attached to a conjugating moiety comprising a polyethylene glycol (PEG), wherein: the IL-2 polypeptide comprises an amino acid sequence having at least 80% sequence identity to SEQ ID NO:5; and the AzK substitutes for an amino acid at position K35, F42, F44, K43, E62, P65, R38, T41, E68, Y45, V69, or L72 in reference to the amino acid positions within SEQ ID NO:5.
- AzK N6-azidoethoxy-L-lysine
- the IL-2 polypeptide comprises an N-terminal deletion of one residue relative to SEQ ID NO:5.
- the IL-2 form suitable for use in the invention lacks IL-2R alpha chain engagement but retains normal binding to the intermediate affinity IL-2R beta-gamma signaling complex.
- the IL-2 form suitable for use in the invention is an IL-2 conjugate comprising: an IL-2 polypeptide comprising an N6-azidoethoxy-L-lysine (AzK) covalently attached to a conjugating moiety comprising a polyethylene glycol (PEG), wherein: the IL-2 polypeptide comprises an amino acid sequence having at least 90% sequence identity to SEQ ID NO:5; and the AzK substitutes for an amino acid at position K35, F42, F44, K43, E62, P65, R38, T41, E68, Y45, V69, or L72 in reference to the amino acid positions within SEQ ID NO:5.
- AzK N6-azidoethoxy-L-lysine
- the IL-2 form suitable for use in the invention is an IL-2 conjugate comprising: an IL-2 polypeptide comprising an N6-azidoethoxy-L-lysine (AzK) covalently attached to a conjugating moiety comprising a polyethylene glycol (PEG), wherein: the IL-2 polypeptide comprises an amino acid sequence having at least 95% sequence identity to SEQ ID NO:5; and the AzK substitutes for an amino acid at position K35, F42, F44, K43, E62, P65, R38, T41, E68, Y45, V69, or L72 in reference to the amino acid positions within SEQ ID NO:5.
- AzK N6-azidoethoxy-L-lysine
- the IL-2 form suitable for use in the invention is an IL-2 conjugate comprising: an IL-2 polypeptide comprising an N6-azidoethoxy-L-lysine (AzK) covalently attached to a conjugating moiety comprising a polyethylene glycol (PEG), wherein: the IL-2 polypeptide comprises an amino acid sequence having at least 98% sequence identity to SEQ ID NO:5; and the AzK substitutes for an amino acid at position K35, F42, F44, K43, E62, P65, R38, T41, E68, Y45, V69, or L72 in reference to the amino acid positions within SEQ ID NO:5.
- AzK N6-azidoethoxy-L-lysine
- an IL-2 form suitable for use in the invention is nemvaleukin alfa, also known as ALKS-4230 (SEQ ID NO:6), which is available from Alkermes, Inc.
- Nemvaleukin alfa is also known as human interleukin 2 fragment (1-59), variant (Cys 125 >Ser 51 ), fused via peptidyl linker ( 60 GG 61 ) to human interleukin 2 fragment (62-132), fused via peptidyl linker ( 133 GSGGGS 138 ) to human interleukin 2 receptor ⁇ -chain fragment (139-303), produced in Chinese hamster ovary (CHO) cells, glycosylated; human interleukin 2 (IL-2) (75-133)-peptide [Cys 125 (51)>Ser]-mutant (1-59), fused via a G2 peptide linker (60- 61) to human interleukin 2 (IL-2) (4-74)-peptide (62-13
- nemvaleukin alfa exhibits the following post-translational modifications: disulfide bridges at positions: 31-116, 141-285, 184-242, 269-301, 166-197 or 166-199, 168- 199 or 168-197 (using the numbering in SEQ ID NO:6), and glycosylation sites at positions: N187, N206, T212 using the numbering in SEQ ID NO:6.
- disulfide bridges at positions: 31-116, 141-285, 184-242, 269-301, 166-197 or 166-199, 168- 199 or 168-197 (using the numbering in SEQ ID NO:6)
- glycosylation sites at positions: N187, N206, T212 using the numbering in SEQ ID NO:6.
- an IL-2 form suitable for use in the invention is a protein having at least 80%, at least 90%, at least 95%, or at least 90% sequence identity to SEQ ID NO:6.
- an IL-2 form suitable for use in the invention has the amino acid sequence given in SEQ ID NO:6 or conservative amino acid substitutions thereof.
- an IL-2 form suitable for use in the invention is a fusion protein comprising amino acids 24-452 of SEQ ID NO:7, or variants, fragments, or derivatives thereof.
- an IL-2 form suitable for use in the invention is a fusion protein comprising an amino acid sequence having at least 80%, at least 90%, at least 95%, or at least 90% sequence identity to amino acids 24-452 of SEQ ID NO:7, or variants, fragments, or derivatives thereof.
- Other IL-2 forms suitable for use in the present invention are described in U.S. Patent No.10,183,979, the disclosures of which are incorporated by reference herein.
- an IL-2 form suitable for use in the invention is a fusion protein comprising a first fusion partner that is linked to a second fusion partner by a mucin domain polypeptide linker, wherein the first fusion partner is IL-1R ⁇ or a protein having at least 98% amino acid sequence identity to IL-1R ⁇ and having the receptor antagonist activity of IL-R ⁇ , and wherein the second fusion partner comprises all or a portion of an immunoglobulin comprising an Fc region, wherein the mucin domain polypeptide linker comprises SEQ ID NO:8 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:8 and wherein the half-life of the fusion protein is improved as compared to a fusion of the first fusion partner to the second fusion partner in the absence of the mucin domain polypeptide linker.
- SEQ ID NO:8 SESSASSDGP HPVITP 16 mucin domain polypeptide antibody cytokine engrafted protein comprises a heavy chain variable region (VH), comprising complementarity determining regions HCDR1, HCDR2, HCDR3; a light chain variable region (VL), comprising LCDR1, LCDR2, LCDR3; and an IL-2 molecule or a fragment thereof engrafted into a CDR of the V H or the V L , wherein the antibody cytokine engrafted protein preferentially expands T effector cells over regulatory T cells.
- VH heavy chain variable region
- VL light chain variable region
- the antibody cytokine engrafted protein comprises a heavy chain variable region (VH), comprising complementarity determining regions HCDR1, HCDR2, HCDR3; a light chain variable region (V L ), comprising LCDR1, LCDR2, LCDR3; and an IL-2 molecule or a fragment thereof engrafted into a CDR of the VH or the VL, wherein the IL-2 molecule is a mutein, and wherein the antibody cytokine engrafted protein preferentially expands T effector cells over regulatory T cells.
- the IL-2 regimen comprises administration of an antibody described in U.S. Patent Application Publication No.
- the antibody cytokine engrafted protein comprises a heavy chain variable region (VH), comprising complementarity determining regions HCDR1, HCDR2, HCDR3; a light chain variable region (VL), comprising LCDR1, LCDR2, LCDR3; and an IL-2 molecule or a fragment thereof engrafted into a CDR of the VH or the VL, wherein the IL-2 molecule is a mutein, wherein the antibody cytokine engrafted protein preferentially expands T effector cells over regulatory T cells, and wherein the antibody further comprises an IgG class heavy chain and an IgG class light chain selected from the group consisting of: a IgG class light chain comprising SEQ ID NO:39 and a IgG class heavy chain comprising SEQ ID NO:38; a IgG class light chain comprising SEQ ID NO:37 and a IgG class heavy chain comprising
- an IL-2 molecule or a fragment thereof is engrafted into HCDR1 of the V H , wherein the IL-2 molecule is a mutein. In some embodiments, an IL-2 molecule or a fragment thereof is engrafted into HCDR2 of the VH, wherein the IL-2 molecule is a mutein. In some embodiments, an IL-2 molecule or a fragment thereof is engrafted into HCDR3 of the VH, wherein the IL-2 molecule is a mutein. In some embodiments, an IL-2 molecule or a fragment thereof is engrafted into LCDR1 of the V L , wherein the IL-2 molecule is a mutein.
- an IL-2 molecule or a fragment thereof is engrafted into LCDR2 of the V L , wherein the IL-2 molecule is a mutein. In some embodiments, an IL-2 molecule or a fragment thereof is engrafted into LCDR3 of the V L , wherein the IL-2 molecule is a mutein. [00522] The insertion of the IL-2 molecule can be at or near the N-terminal region of the CDR, in the middle region of the CDR or at or near the C-terminal region of the CDR.
- the antibody cytokine engrafted protein comprises an IL-2 molecule incorporated into a CDR, wherein the IL2 sequence does not frameshift the CDR sequence.
- the antibody cytokine engrafted protein comprises an IL-2 molecule incorporated into a CDR, wherein the IL-2 sequence replaces all or part of a CDR sequence.
- the replacement by the IL-2 molecule can be the N-terminal region of the CDR, in the middle region of the CDR or at or near the C-terminal region the CDR.
- a replacement by the IL-2 molecule can be as few as one or two amino acids of a CDR sequence, or the entire CDR sequences.
- an IL-2 molecule is engrafted directly into a CDR without a peptide linker, with no additional amino acids between the CDR sequence and the IL-2 sequence.
- an IL-2 molecule is engrafted indirectly into a CDR with a peptide linker, with one or more additional amino acids between the CDR sequence and the IL-2 sequence.
- the IL-2 molecule described herein is an IL-2 mutein.
- the IL-2 mutein comprising an R67A substitution.
- the IL-2 mutein comprises the amino acid sequence SEQ ID NO:14 or SEQ ID NO:15.
- the IL-2 mutein comprises an amino acid sequence in Table 1 in U.S. Patent Application Publication No. US 2020/0270334 A1, the disclosure of which is incorporated by reference herein.
- the antibody cytokine engrafted protein comprises an HCDR1 selected from the group consisting of SEQ ID NO:16, SEQ ID NO:19, SEQ ID NO:22 and SEQ ID NO:25.
- the antibody cytokine engrafted protein comprises an HCDR1 selected from the group consisting of SEQ ID NO:7, SEQ ID NO:10, SEQ ID NO:13 and SEQ ID NO:16.
- the antibody cytokine engrafted protein comprises an HCDR1 selected from the group consisting of HCDR2 selected from the group consisting of SEQ ID NO:17, SEQ ID NO:20, SEQ ID NO:23, and SEQ ID NO:26.
- the antibody cytokine engrafted protein comprises an HCDR3 selected from the group consisting of SEQ ID NO:18, SEQ ID NO:21, SEQ ID NO:24, and SEQ ID NO:27.
- the antibody cytokine engrafted protein comprises a VH region comprising the amino acid sequence of SEQ ID NO:28.
- the antibody cytokine engrafted protein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO:29. In some embodiments, the antibody cytokine engrafted protein comprises a VL region comprising the amino acid sequence of SEQ ID NO:36. In some embodiments, the antibody cytokine engrafted protein comprises a light chain comprising the amino acid sequence of SEQ ID NO:37. In some embodiments, the antibody cytokine engrafted protein comprises a V H region comprising the amino acid sequence of SEQ ID NO:28 and a VL region comprising the amino acid sequence of SEQ ID NO:36.
- the antibody cytokine engrafted protein comprises a heavy chain region comprising the amino acid sequence of SEQ ID NO:29 and a light chain region comprising the amino acid sequence of SEQ ID NO:37. In some embodiments, the antibody cytokine engrafted protein comprises a heavy chain region comprising the amino acid sequence of SEQ ID NO:29 and a light chain region comprising the amino acid sequence of SEQ ID NO:39. In some embodiments, the antibody cytokine engrafted protein comprises a heavy chain region comprising the amino acid sequence of SEQ ID NO:38 and a light chain region comprising the amino acid sequence of SEQ ID NO:37.
- the antibody cytokine engrafted protein comprises a heavy chain region comprising the amino acid sequence of SEQ ID NO:38 and a light chain region comprising the amino acid sequence of SEQ ID NO:39.
- the antibody cytokine engrafted protein comprises IgG.IL2F71A.H1 or IgG.IL2R67A.H1 of U.S. Patent Application Publication No. 2020/0270334 A1, or variants, derivatives, or fragments thereof, or conservative amino acid substitutions thereof, or proteins with at least 80%, at least 90%, at least 95%, or at least 98% sequence identity thereto.
- the antibody components of the antibody cytokine engrafted protein described herein comprise immunoglobulin sequences, framework sequences, or CDR sequences of palivizumab.
- the antibody cytokine engrafted protein described herein has a longer serum half-life than a wild-type IL-2 molecule such as, but not limited to, aldesleukin or a comparable molecule.
- the antibody cytokine engrafted protein described herein has a sequence as set forth in Table 3.
- IL-4 regulates the differentiation of na ⁇ ve helper T cells (Th0 cells) to Th2 T cells. Steinke and Borish, Respir. Res.2001, 2, 66-70. Upon activation by IL-4, Th2 T cells subsequently produce additional IL-4 in a positive feedback loop. IL-4 also stimulates B cell proliferation and class II MHC expression, and induces class switching to IgE and IgG1 expression from B cells.
- Recombinant human IL-4 suitable for use in the invention is commercially available from multiple suppliers, including ProSpec-Tany TechnoGene Ltd., East Brunswick, NJ, USA (Cat. No. CYT-211) and ThermoFisher Scientific, Inc., Waltham, MA, USA (human IL-15 recombinant protein, Cat.
- IL-7 refers to a glycosylated tissue- derived cytokine known as interleukin 7, which may be obtained from stromal and epithelial cells, as well as from dendritic cells. Fry and Mackall, Blood 2002, 99, 3892-904. IL-7 can stimulate the development of T cells.
- IL-7 binds to the IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor, which in a series of signals important for T cell development within the thymus and survival within the periphery.
- Recombinant human IL-7 suitable for use in the invention is commercially available from multiple suppliers, including ProSpec-Tany TechnoGene Ltd., East Brunswick, NJ, USA (Cat. No. CYT-254) and ThermoFisher Scientific, Inc., Waltham, MA, USA (human IL-15 recombinant protein, Cat. No. Gibco PHC0071).
- the amino acid sequence of recombinant human IL-7 suitable for use in the invention is given in Table 2 (SEQ ID NO:10).
- IL-15 refers to the T cell growth factor known as interleukin-15, and includes all forms of IL-2 including human and mammalian forms, conservative amino acid substitutions, glycoforms, biosimilars, and variants thereof.
- IL-15 is described, e.g., in Fehniger and Caligiuri, Blood 2001, 97, 14-32, the disclosure of which is incorporated by reference herein.
- IL-15 shares ⁇ and ⁇ signaling receptor subunits with IL-2.
- Recombinant human IL-15 is a single, non-glycosylated polypeptide chain containing 114 amino acids (and an N-terminal methionine) with a molecular mass of 12.8 kDa.
- Recombinant human IL-15 is commercially available from multiple suppliers, including ProSpec-Tany TechnoGene Ltd., East Brunswick, NJ, USA (Cat. No. CYT-230-b) and ThermoFisher Scientific, Inc., Waltham, MA, USA (human IL-15 recombinant protein, Cat. No.34-8159-82).
- the amino acid sequence of recombinant human IL-15 suitable for use in the invention is given in Table 2 (SEQ ID NO:11).
- IL-21 refers to the pleiotropic cytokine protein known as interleukin-21, and includes all forms of IL-21 including human and mammalian forms, conservative amino acid substitutions, glycoforms, biosimilars, and variants thereof. IL-21 is described, e.g., in Spolski and Leonard, Nat. Rev. Drug. Disc.2014, 13, 379-95, the disclosure of which is incorporated by reference herein. IL-21 is primarily produced by natural killer T cells and activated human CD4 + T cells.
- Recombinant human IL- 21 is a single, non-glycosylated polypeptide chain containing 132 amino acids with a molecular mass of 15.4 kDa.
- Recombinant human IL-21 is commercially available from multiple suppliers, including ProSpec-Tany TechnoGene Ltd., East Brunswick, NJ, USA (Cat. No. CYT-408-b) and ThermoFisher Scientific, Inc., Waltham, MA, USA (human IL-21 recombinant protein, Cat. No.14-8219-80).
- the amino acid sequence of recombinant human IL-21 suitable for use in the invention is given in Table 2 (SEQ ID NO:12).
- an anti-tumor effective amount “a tumor-inhibiting effective amount”, or “therapeutic amount”
- the precise amount of the compositions of the present invention to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the tumor infiltrating lymphocytes (e.g.
- secondary TILs or genetically modified cytotoxic lymphocytes described herein may be administered at a dosage of 10 4 to 10 11 cells/kg body weight (e.g., 10 5 to 10 6 , 10 5 to 10 10 , 10 5 to 10 11 , 10 6 to 10 10 , 10 6 to 10 11 ,10 7 to 10 11 , 10 7 to 10 10 , 10 8 to 10 11 , 10 8 to 10 10 , 10 9 to 10 11 , or 10 9 to 10 10 cells/kg body weight), including all integer values within those ranges.
- TILs (including in some cases, genetically modified cytotoxic lymphocytes) compositions may also be administered multiple times at these dosages.
- the TILs can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg, et al., New Eng. J. of Med.1988, 319, 1676).
- the optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
- the term “hematological malignancy”, “hematologic malignancy” or terms of correlative meaning refer to mammalian cancers and tumors of the hematopoietic and lymphoid tissues, including but not limited to tissues of the blood, bone marrow, lymph nodes, and lymphatic system.
- Hematological malignancies are also referred to as “liquid tumors.” Hematological malignancies include, but are not limited to, acute lymphoblastic leukemia (ALL), chronic lymphocytic lymphoma (CLL), small lymphocytic lymphoma (SLL), acute myelogenous leukemia (AML), chronic myelogenous leukemia (CML), multiple myeloma, acute monocytic leukemia (AMoL), Hodgkin’s lymphoma, and non-Hodgkin’s lymphomas.
- ALL acute lymphoblastic leukemia
- CLL chronic lymphocytic lymphoma
- SLL small lymphocytic lymphoma
- AML acute myelogenous leukemia
- CML chronic myelogenous leukemia
- AoL acute monocytic leukemia
- Hodgkin’s lymphoma and non-Hodgkin’s lymphomas.
- liquid tumor refers to an abnormal mass of cells that is fluid in nature.
- Liquid tumor cancers include, but are not limited to, leukemias, myelomas, and lymphomas, as well as other hematological malignancies.
- TILs obtained from liquid tumors may also be referred to herein as marrow infiltrating lymphocytes (MILs).
- MILs obtained from liquid tumors, including liquid tumors circulating in peripheral blood may also be referred to herein as PBLs.
- MIL, TIL, and PBL are used interchangeably herein and differ only based on the tissue type from which the cells are derived.
- microenvironment may refer to the solid or hematological tumor microenvironment as a whole or to an individual subset of cells within the microenvironment.
- the tumor microenvironment refers to a complex mixture of “cells, soluble factors, signaling molecules, extracellular matrices, and mechanical cues that promote neoplastic transformation, support tumor growth and invasion, protect the tumor from host immunity, foster therapeutic resistance, and provide niches for dominant metastases to thrive,” as described in Swartz, et al., Cancer Res., 2012, 72, 2473.
- tumors express antigens that should be recognized by T cells, tumor clearance by the immune system is rare because of immune suppression by the microenvironment.
- the invention includes a method of treating a cancer with a population of TILs, wherein a patient is pre-treated with non-myeloablative chemotherapy prior to an infusion of TILs according to the invention.
- the population of TILs may be provided wherein a patient is pre-treated with nonmyeloablative chemotherapy prior to an infusion of TILs according to the present invention.
- the non-myeloablative chemotherapy is cyclophosphamide 60 mg/kg/d for 2 days (days 27 and 26 prior to TIL infusion) and fludarabine 25 mg/m2/d for 5 days (days 27 to 23 prior to TIL infusion).
- the patient receives an intravenous infusion of IL-2 intravenously at 720,000 IU/kg every 8 hours to physiologic tolerance.
- lymphodepletion prior to adoptive transfer of tumor-specific T lymphocytes plays a key role in enhancing treatment efficacy by eliminating regulatory T cells and competing elements of the immune system (“cytokine sinks”).
- cytokine sinks regulatory T cells and competing elements of the immune system
- some embodiments of the invention utilize a lymphodepletion step (sometimes also referred to as “immunosuppressive conditioning”) on the patient prior to the introduction of the TILs of the invention.
- an effective amount refers to that amount of a compound or combination of compounds as described herein that is sufficient to effect the intended application including, but not limited to, disease treatment.
- a therapeutically effective amount may vary depending upon the intended application (in vitro or in vivo), or the subject and disease condition being treated (e.g., the weight, age and gender of the subject), the severity of the disease condition, or the manner of administration.
- the term also applies to a dose that will induce a particular response in target cells (e.g., the reduction of platelet adhesion and/or cell migration).
- treatment refers to obtaining a desired pharmacologic and/or physiologic effect.
- the effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease.
- Treatment covers any treatment of a disease in a mammal, particularly in a human, and includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development or progression; and (c) relieving the disease, i.e., causing regression of the disease and/or relieving one or more disease symptoms. “Treatment” is also meant to encompass delivery of an agent in order to provide for a pharmacologic effect, even in the absence of a disease or condition.
- treatment encompasses delivery of a composition that can elicit an immune response or confer immunity in the absence of a disease condition, e.g., in the case of a vaccine.
- heterologous when used with reference to portions of a nucleic acid or protein indicates that the nucleic acid or protein comprises two or more subsequences that are not found in the same relationship to each other in nature.
- the nucleic acid is typically recombinantly produced, having two or more sequences from unrelated genes arranged to make a new functional nucleic acid, e.g., a promoter from one source and a coding region from another source, or coding regions from different sources.
- a heterologous protein indicates that the protein comprises two or more subsequences that are not found in the same relationship to each other in nature (e.g., a fusion protein).
- sequence identity refers to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity.
- the percent identity can be measured using sequence comparison software or algorithms or by visual inspection.
- Various algorithms and software are known in the art that can be used to obtain alignments of amino acid or nucleotide sequences. Suitable programs to determine percent sequence identity include for example the BLAST suite of programs available from the U.S. Government’s National Center for Biotechnology Information BLAST web site. Comparisons between two sequences can be carried using either the BLASTN or BLASTP algorithm. BLASTN is used to compare nucleic acid sequences, while BLASTP is used to compare amino acid sequences. ALIGN, ALIGN-2 (Genentech, South San Francisco, California) or MegAlign, available from DNASTAR, are additional publicly available software programs that can be used to align sequences.
- the term “variant” encompasses but is not limited to antibodies or fusion proteins which comprise an amino acid sequence which differs from the amino acid sequence of a reference antibody by way of one or more substitutions, deletions and/or additions at certain positions within or adjacent to the amino acid sequence of the reference antibody.
- the variant may comprise one or more conservative substitutions in its amino acid sequence as compared to the amino acid sequence of a reference antibody. Conservative substitutions may involve, e.g., the substitution of similarly charged or uncharged amino acids.
- the variant retains the ability to specifically bind to the antigen of the reference antibody.
- TILs tumor infiltrating lymphocytes
- lymphocytes cytotoxic T cells
- Th1 and Th17 CD4 + T cells natural killer cells
- dendritic cells dendritic cells
- M1 macrophages include both primary and secondary TILs.
- Primary TILs are those that are obtained from patient tissue samples as outlined herein (sometimes referred to as “freshly harvested”), and “secondary TILs” are any TIL cell populations that have been expanded or proliferated as discussed herein, including, but not limited to bulk TILs, expanded TILs (“REP TILs”) as well as “reREP TILs” as discussed herein.
- reREP TILs can include for example second expansion TILs or second additional expansion TILs (such as, for example, those described in Step D of Figure 8, including TILs referred to as reREP TILs).
- TILs can generally be defined either biochemically, using cell surface markers, or functionally, by their ability to infiltrate tumors and effect treatment.
- TILs can be generally categorized by expressing one or more of the following biomarkers: CD4, CD8, TCR ⁇ , CD27, CD28, CD56, CCR7, CD45Ra, CD95, PD-1, and CD25. Additionally, and alternatively, TILs can be functionally defined by their ability to infiltrate solid tumors upon reintroduction into a patient.
- TILs may further be characterized by potency – for example, TILs may be considered potent if, for example, interferon (IFN) release is greater than about 50 pg/mL, greater than about 100 pg/mL, greater than about 150 pg/mL, or greater than about 200 pg/mL.
- IFN interferon
- TILs may be considered potent if, for example, interferon (IFN ⁇ ) release is greater than about 50 pg/mL, greater than about 100 pg/mL, greater than about 150 pg/mL, or greater than about 200 pg/mL, greater than about 300 pg/mL, greater than about 400 pg/mL, greater than about 500 pg/mL, greater than about 600 pg/mL, greater than about 700 pg/mL, greater than about 800 pg/mL, greater than about 900 pg/mL, greater than about 1000 pg/mL.
- IFN ⁇ interferon
- deoxyribonucleotide encompasses natural and synthetic, unmodified and modified deoxyribonucleotides. Modifications include changes to the sugar moiety, to the base moiety and/or to the linkages between deoxyribonucleotide in the oligonucleotide.
- RNA defines a molecule comprising at least one ribonucleotide residue.
- ribonucleotide defines a nucleotide with a hydroxyl group at the 2' position of a b-D-ribofuranose moiety.
- RNA includes double-stranded RNA, single-stranded RNA, isolated RNA such as partially purified RNA, essentially pure RNA, synthetic RNA, recombinantly produced RNA, as well as altered RNA that differs from naturally occurring RNA by the addition, deletion, substitution and/or alteration of one or more nucleotides. Nucleotides of the RNA molecules described herein may also comprise non-standard nucleotides, such as non-naturally occurring nucleotides or chemically synthesized nucleotides or deoxynucleotides. These altered RNAs can be referred to as analogs or analogs of naturally-occurring RNA.
- pharmaceutically acceptable carrier or “pharmaceutically acceptable excipient” are intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and inert ingredients.
- pharmaceutically acceptable carriers or pharmaceutically acceptable excipients for active pharmaceutical ingredients is well known in the art. Except insofar as any conventional pharmaceutically acceptable carrier or pharmaceutically acceptable excipient is incompatible with the active pharmaceutical ingredient, its use in therapeutic compositions of the invention is contemplated. Additional active pharmaceutical ingredients, such as other drugs, can also be incorporated into the described compositions and methods.
- the terms “about” and “approximately” mean within a statistically meaningful range of a value.
- Such a range can be within an order of magnitude, preferably within 50%, more preferably within 20%, more preferably still within 10%, and even more preferably within 5% of a given value or range.
- the allowable variation encompassed by the terms “about” or “approximately” depends on the particular system under study, and can be readily appreciated by one of ordinary skill in the art. Moreover, as used herein, the terms “about” and “approximately” mean that dimensions, sizes, formulations, parameters, shapes and other quantities and characteristics are not and need not be exact, but may be approximate and/or larger or smaller, as desired, reflecting tolerances, conversion factors, rounding off, measurement error and the like, and other factors known to those of skill in the art.
- compositions, methods, and kits described herein that embody the present invention can, in alternate embodiments, be more specifically defined by any of the transitional terms “comprising,” “consisting essentially of,” and “consisting of.”
- the terms “antibody” and its plural form “antibodies” refer to whole immunoglobulins and any antigen-binding fragment (“antigen-binding portion”) or single chains thereof.
- An “antibody” further refers to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen-binding portion thereof. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as V H ) and a heavy chain constant region.
- V H heavy chain variable region
- V H heavy chain constant region
- the heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as V L ) and a light chain constant region.
- V L light chain variable region
- CL light chain constant region
- the light chain constant region is comprised of one domain, CL.
- the VH and VL regions of an antibody may be further subdivided into regions of hypervariability, which are referred to as complementarity determining regions (CDR) or hypervariable regions (HVR), and which can be interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- HVR hypervariable regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen epitope or epitopes.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- the term “antigen” refers to a substance that induces an immune response.
- an antigen is a molecule capable of being bound by an antibody or a TCR if presented by major histocompatibility complex (MHC) molecules.
- MHC major histocompatibility complex
- the term “antigen”, as used herein, also encompasses T cell epitopes.
- An antigen is additionally capable of being recognized by the immune system.
- an antigen is capable of inducing a humoral immune response or a cellular immune response leading to the activation of B lymphocytes and/or T lymphocytes. In some cases, this may require that the antigen contains or is linked to a Th cell epitope.
- An antigen can also have one or more epitopes (e.g., B- and T-epitopes).
- an antigen will preferably react, typically in a highly specific and selective manner, with its corresponding antibody or TCR and not with the multitude of other antibodies or TCRs which may be induced by other antigens.
- the terms “monoclonal antibody,” “mAb,” “monoclonal antibody composition,” or their plural forms refer to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope. Monoclonal antibodies specific to certain receptors can be made using knowledge and skill in the art of injecting test subjects with suitable antigen and then isolating hybridomas expressing antibodies having the desired sequence or functional characteristics.
- DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies).
- the hybridoma cells serve as a preferred source of such DNA.
- the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. Recombinant production of antibodies will be described in more detail below.
- antigen-binding portion or “antigen-binding fragment” of an antibody (or simply “antibody portion” or “fragment”), as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen. It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- binding fragments encompassed within the term “antigen-binding portion” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L and CH1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and CH1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a domain antibody (dAb) fragment (Ward, et al., Nature, 1989, 341, 544-546), which may consist of a V H or a V L domain; and (vi) an isolated complementarity determining region (CDR).
- a Fab fragment a monovalent fragment consisting of the V L , V H , C L and CH1 domains
- a F(ab′)2 fragment
- the two domains of the Fv fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules known as single chain Fv (scFv); see, e.g., Bird, et al., Science 1988, 242, 423-426; and Huston, et al., Proc. Natl. Acad. Sci. USA 1988, 85, 5879-5883).
- scFv antibodies are also intended to be encompassed within the terms “antigen-binding portion” or “antigen-binding fragment” of an antibody.
- a scFv protein domain comprises a VH portion and a V L portion.
- a scFv molecule is denoted as either V L -L-V H if the V L domain is the N-terminal part of the scFv molecule, or as VH-L-VL if the VH domain is the N-terminal part of the scFv molecule.
- Methods for making scFv molecules and designing suitable peptide linkers are described in U.S. Pat. No.4,704,692, U.S. Pat. No.4,946,778, R.
- human antibody is intended to include antibodies having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.
- human antibodies of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- human antibody as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- human monoclonal antibody refers to antibodies displaying a single binding specificity which have variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences.
- the human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (such as a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom (described further below), (b) antibodies isolated from a host cell transformed to express the human antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
- Such recombinant human antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences.
- such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the V H and V L regions of the recombinant antibodies are sequences that, while derived from and related to human germline V H and V L sequences, may not naturally exist within the human antibody germline repertoire in vivo.
- isotype refers to the antibody class (e.g., IgM or IgG1) that is encoded by the heavy chain constant region genes.
- immunoglobulin refers to the immunoglobulin immunoglobulins.
- immunoglobulin refers to the immunoglobulins.
- human antibody derivatives refers to any modified form of the human antibody, including a conjugate of the antibody and another active pharmaceutical ingredient or antibody.
- conjugates refers to an antibody, or a fragment thereof, conjugated to another therapeutic moiety, which can be conjugated to antibodies described herein using methods available in the art.
- humanized antibody “humanized antibodies,” and “humanized” are intended to refer to antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences. Additional framework region modifications may be made within the human framework sequences.
- Humanized forms of non-human (for example, murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a 15 hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
- donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
- Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
- humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non- human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence.
- the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- the antibodies described herein may also be modified to employ any Fc variant which is known to impart an improvement (e.g., reduction) in effector function and/or FcR binding.
- the Fc variants may include, for example, any one of the amino acid substitutions disclosed in International Patent Application Publication Nos.
- chimeric antibody is intended to refer to antibodies in which the variable region sequences are derived from one species and the constant region sequences are derived from another species, such as an antibody in which the variable region sequences are derived from a mouse antibody and the constant region sequences are derived from a human antibody.
- a “diabody” is a small antibody fragment with two antigen-binding sites.
- the fragments comprises a heavy chain variable domain (V H ) connected to a light chain variable domain (VL) in the same polypeptide chain (VH-VL or VL-VH).
- V H heavy chain variable domain
- VL light chain variable domain
- VH-VL or VL-VH the same polypeptide chain
- linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
- Diabodies are described more fully in, e.g., European Patent No. EP 404,097, International Patent Publication No. WO 93/11161; and Bolliger, et al., Proc. Natl. Acad. Sci.
- glycosylation refers to a modified derivative of an antibody.
- An aglycoslated antibody lacks glycosylation.
- Glycosylation can be altered to, for example, increase the affinity of the antibody for antigen.
- Such carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence. For example, one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
- Aglycosylation may increase the affinity of the antibody for antigen, as described in U.S. Patent Nos.5,714,350 and 6,350,861.
- an antibody can be made that has an altered type of glycosylation, such as a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures.
- altered glycosylation patterns have been demonstrated to increase the ability of antibodies.
- carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant antibodies of the invention to thereby produce an antibody with altered glycosylation.
- the cell lines Ms704, Ms705, and Ms709 lack the fucosyltransferase gene, FUT8 (alpha (1,6) fucosyltransferase), such that antibodies expressed in the Ms704, Ms705, and Ms709 cell lines lack fucose on their carbohydrates.
- the Ms704, Ms705, and Ms709 FUT8 ⁇ / ⁇ cell lines were created by the targeted disruption of the FUT8 gene in CHO/DG44 cells using two replacement vectors (see e.g. U.S. Patent Publication No.2004/0110704 or Yamane-Ohnuki, et al., Biotechnol. Bioeng., 2004, 87, 614-622).
- EP 1,176,195 describes a cell line with a functionally disrupted FUT8 gene, which encodes a fucosyl transferase, such that antibodies expressed in such a cell line exhibit hypofucosylation by reducing or eliminating the alpha 1,6 bond-related enzyme, and also describes cell lines which have a low enzyme activity for adding fucose to the N- acetylglucosamine that binds to the Fc region of the antibody or does not have the enzyme activity, for example the rat myeloma cell line YB2/0 (ATCC CRL 1662).
- WO 99/54342 describes cell lines engineered to express glycoprotein-modifying glycosyl transferases (e.g., beta(1,4)-N- acetylglucosaminyltransferase III (GnTIII)) such that antibodies expressed in the engineered cell lines exhibit increased bisecting GlcNac structures which results in increased ADCC activity of the antibodies (see also Umana, et al., Nat. Biotech.1999, 17, 176-180).
- GnTIII glycoprotein-modifying glycosyl transferases
- the fucose residues of the antibody may be cleaved off using a fucosidase enzyme.
- the fucosidase alpha-L-fucosidase removes fucosyl residues from antibodies as described in Tarentino, et al., Biochem.1975, 14, 5516-5523.
- “Pegylation” refers to a modified antibody, or a fragment thereof, that typically is reacted with polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment. Pegylation may, for example, increase the biological (e.g., serum) half life of the antibody.
- PEG polyethylene glycol
- the pegylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer).
- a reactive PEG molecule or an analogous reactive water-soluble polymer.
- polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10)alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide.
- the antibody to be pegylated may be an aglycosylated antibody. Methods for pegylation are known in the art and can be applied to the antibodies of the invention, as described for example in European Patent Nos. EP 0154316 and EP 0401384 and U.S.
- biosimilar means a biological product, including a monoclonal antibody or protein, that is highly similar to a U.S. licensed reference biological product notwithstanding minor differences in clinically inactive components, and for which there are no clinically meaningful differences between the biological product and the reference product in terms of the safety, purity, and potency of the product.
- a similar biological or “biosimilar” medicine is a biological medicine that is similar to another biological medicine that has already been authorized for use by the European Medicines Agency.
- biosimilar is also used synonymously by other national and regional regulatory agencies.
- Biological products or biological medicines are medicines that are made by or derived from a biological source, such as a bacterium or yeast. They can consist of relatively small molecules such as human insulin or erythropoietin, or complex molecules such as monoclonal antibodies.
- a biological source such as a bacterium or yeast.
- They can consist of relatively small molecules such as human insulin or erythropoietin, or complex molecules such as monoclonal antibodies.
- the reference IL-2 protein is aldesleukin (PROLEUKIN)
- a protein approved by drug regulatory authorities with reference to aldesleukin is a “biosimilar to” aldesleukin or is a “biosimilar thereof” of aldesleukin.
- EMA European Medicines Agency
- a biosimilar as described herein may be similar to the reference medicinal product by way of quality characteristics, biological activity, mechanism of action, safety profiles and/or efficacy.
- the biosimilar may be used or be intended for use to treat the same conditions as the reference medicinal product.
- a biosimilar as described herein may be deemed to have similar or highly similar quality characteristics to a reference medicinal product.
- a biosimilar as described herein may be deemed to have similar or highly similar biological activity to a reference medicinal product.
- a biosimilar as described herein may be deemed to have a similar or highly similar safety profile to a reference medicinal product.
- a biosimilar as described herein may be deemed to have similar or highly similar efficacy to a reference medicinal product.
- a biosimilar in Europe is compared to a reference medicinal product which has been authorized by the EMA.
- the biosimilar may be compared to a biological medicinal product which has been authorized outside the European Economic Area (a non-EEA authorized “comparator”) in certain studies. Such studies include for example certain clinical and in vivo non-clinical studies.
- the term “biosimilar” also relates to a biological medicinal product which has been or may be compared to a non-EEA authorized comparator.
- Certain biosimilars are proteins such as antibodies, antibody fragments (for example, antigen binding portions) and fusion proteins.
- a protein biosimilar may have an amino acid sequence that has minor modifications in the amino acid structure (including for example deletions, additions, and/or substitutions of amino acids) which do not significantly affect the function of the polypeptide.
- the biosimilar may comprise an amino acid sequence having a sequence identity of 97% or greater to the amino acid sequence of its reference medicinal product, e.g., 97%, 98%, 99% or 100%.
- the biosimilar may comprise one or more post-translational modifications, for example, although not limited to, glycosylation, oxidation, deamidation, and/or truncation which is/are different to the post-translational modifications of the reference medicinal product, provided that the differences do not result in a change in safety and/or efficacy of the medicinal product.
- the biosimilar may have an identical or different glycosylation pattern to the reference medicinal product. Particularly, although not exclusively, the biosimilar may have a different glycosylation pattern if the differences address or are intended to address safety concerns associated with the reference medicinal product. Additionally, the biosimilar may deviate from the reference medicinal product in for example its strength, pharmaceutical form, formulation, excipients and/or presentation, providing safety and efficacy of the medicinal product is not compromised.
- the biosimilar may comprise differences in for example pharmacokinetic (PK) and/or pharmacodynamic (PD) profiles as compared to the reference medicinal product but is still deemed sufficiently similar to the reference medicinal product as to be authorized or considered suitable for authorization.
- PK pharmacokinetic
- PD pharmacodynamic
- the biosimilar exhibits different binding characteristics as compared to the reference medicinal product, wherein the different binding characteristics are considered by a Regulatory Authority such as the EMA not to be a barrier for authorization as a similar biological product.
- the term “biosimilar” is also used synonymously by other national and regional regulatory agencies.
- TIL tumor infiltrating lymphocytes
- the subject modified TILs exhibit enhanced in vivo survival, proliferation and/or anti-tumor effects in a patient recipient.
- the immunomodulatory agent can be attached to the TIL disclosed herein (e.g. therapeutics TILs provided herein) using any suitable method.
- the one or more immunomodulatory agents are part of an immunomodulatory fusion protein that is attached to the TIL cell surface.
- the one or more immunomodulatory agents are included as part of nanoparticles that are associated with the TIL cell surfaces.
- the immunomodulatory agents can be any immunomodulatory agent that promotes TIL survival proliferation, and/or anti-tumor effects in a patient recipient.
- the immunomodulatory agent is a cytokine (e.g., an interleukin).
- the TILs include IL-12, IL-15, and/or IL-21.
- Any suitable TIL population can be modified to produce the subject compositions, including TILs produced using the manufacturing processes described herein.
- the modified TILs are derived from TILs produced during any of the steps of the Process 2A method disclosure herein (see, e.g., FIGs 2-6).
- the modified TILs are derived from TILs produced during any of the steps of the GEN 3 method disclosure herein (see, e.g., FIG.7).
- the TILs are PD-1 positive TILs that are derived from the methods disclosed herein.
- the TILs are futher modified by a gene-editing process as disclosed herein, for example, CRISPR methods, TALE methods, ZFN methods, tCas- CLOVER methods, shRNA methods, or a combination thereof, to alter the expression of one or more immune checkpoint genes in the TIL population.
- Non-limiting examples of immune checkpoint genes that may be silenced or inhibited by gene-editing methods of the present invention include PD-1, CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, TET2, BAFF (BR3), CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1
- the modified TILs provided herein includes an immunomodulatory fusion protein that includes an immunomodulatory agent (e.g., a cytokine) linked to a moiety that facilitates the tethering of the immunomodulatory agent to surface of the TILs.
- an immunomodulatory agent e.g., a cytokine
- the fusion protein includes a cell membrane anchor moiety (a transmembrane domain).
- the fusion protein includes a TIL surface antigen binding moiety that binds to a TIL surface antigen. Aspects of these fusion proteins are further discussed in detail below.
- any suitable genetic modification method can be used to genetically modify the subject TILs to include such immunomodulatory fusion proteins, including, for example, any of the gene editing methods described herein.
- the genetic modification method is a CRISPR, TALE, zinc finger, or Cas-CLOVER method described herein.
- such modified TILs are produced using any one of the retroviral methods (e.g., lentiviral methods) provided herein.
- such modified TILs are produced using any of the transposon/transposase systems described herein, e.g., a piggyBac method (e.g., piggyBac transposons and transposases or piggyBac- like transposons and transposases), a Sleeping Beauty method (e.g., Sleeping Beauty or Sleeping Beauty-like transposons and transposases), a Helraiser method (e.g., Helraiser ahd Helraiser-like transposons and transposases), and a Tol2 method (e.g., Tol2 and Tol2-like transposons and transposases).
- a piggyBac method e.g., piggyBac transposons and transposases or piggyBac- like transposons and transposases
- a Sleeping Beauty method e.g., Sleeping Beauty or Sleeping Beauty-like transposons and transposases
- a Helraiser method e.g.,
- the modified TILs provided herein include a membrane anchored immunomodulatory fusion protein.
- the membrane anchored immunomodulatory fusion protein includes one or more of the immunomodulatory agents (e.g., a cytokine) linked to a cell membrane anchor moiety.
- the membrane anchored immunomodulatory agent is tethered to the TIL surface membrane via the cell membrane anchor moiety, thus allowing the immunomodulatory agent to exert its effects in a targeted manner.
- the immunomodulatory agent can be any suitable immunomodulatory agent including, for example, any of the immunomodulatory agents provided herein.
- the immunomodulatory agent is an interleukin that promotes an anti-tumor response.
- the immunomodulatory agent is a cytokine.
- the immunomodulatory agent is IL-2, IL-12, IL-15, IL-18, IL-21, or a CD40 agonist (e.g., CD40L or agonistic anti-CD40 binding domain (e.g., an anti-CD40 scFv)) or a bioactive variant thereof.
- a TIL includes 2, 3, 4, 5, 6, 7, 8, 9 or 10 different membrane anchored immunomodulatory fusion proteins.
- the immunomodulatory agent is linked to a cell membrane anchor moiety that allows the tethering of the immunomodulatory agent to the TIL cell surface.
- Suitable cell membrane anchor moieties include, for example, transmembrane domains of endogenous TIL cell surface proteins and fragments thereof.
- Exemplary transmembrane domains that can be used in the subject fusion proteins include for example, B7-1, B7-2, and CD8a transmembrane domains and fragments thereof.
- the cell membrane anchor moiety further includes a transmembrane and intracellular domain of an endogenous TIL cell surface protein or fragment thereof.
- the cell membrane anchor moiety is a B7-1, B7-2 or CD8a transmembrane-intracellular domain or fragment thereof.
- the cell membrane anchor moiety is a CD8a transmembrane domain having the amino acid sequence of IYIWAPLAGTCGVLLLSLVIT (SEQ ID NO:238).
- the cell membrane anchor moiety is a B7-1 transmembrane-intracellular domain having the amino acid sequence of LLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV (SEQ ID NO:239).
- the cell membrane anchor moiety is a non-peptide cell membrane anchor moiety.
- the non-peptide cell membrane anchor moiety is a glycophosphatidylinositol (GPI) anchor.
- GPI anchors have a structure that includes a phosphoethanolamine linker, glycan core, and phospholipid tail.
- the glycan core is modified with one or more side chains.
- the glycan core is modified with one or more of the following side chains: a phosphoethanolamine group, mannose, galactose, sialic acid, or other sugars.
- the membrane anchored immunomodulatory fusion protein include linkers that allow for the linkage of components of the membrane anchored immunomodulatory fusion protein (e.g.
- Suitable linkers include linkers that are at least about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid residues in length. In some embodiments, the linker is 5-10, 10-15, 15-20, 20-25, 25-30, 30-35, 35-40, 45-50, 50-60 amino acids in length.
- Suitable linkers include, but are not limited: a cleavable linker, a non- cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, or a non- helical linker.
- the linker is a peptide linker that optionally comprises Gly and Ser.
- the peptide linker utilize a glycine-serine polymer, including for example (GS)n (SEQ ID NO:240), (GSGGS)n (SEQ ID NO:241), (GGGS)n (SEQ ID NO:242), (GGGGS)n (SEQ ID NO:243), (GGGGGS)n (SEQ ID NO:244), and (GGGGGGS)n (SEQ ID NO:245), where n is an integer of at least one (and generally from 3 to 10). Additional linkers that can be used with the present compositions and methods are described in U.S. Patent Publication Nos.
- the peptide linker is SGGGGSGGGGSGGGGSGGGGSGGGSLQ (SEQ ID NO:246).
- the linker is a cleavable linker.
- the cleavable linker allows for the release of the immunomodulatory agent into the tumor microenvironment.
- Cleavable linkers are also useful in embodiments, wherein two membrane anchored immunomodulatory fusion proteins are co-expressed in the same TIL (see, e.g., Figure 36 and Tables 58 and 59).
- the linker is a self- cleaving 2A peptide. See, e.g., Liu et al., Sci. Rep.7(1):2193 (2017), which is incorporated by reference in relevant parts relating to 2A peptides.
- 2A peptides are viral oligopeptides that mediate cleavage of polypeptides during translation in eukaryotic cells.
- the 2A peptide includes a C-terminus having the amino acid sequence GDVEXiNPGP (SEQ ID NO:247), wherein Xi is any naturally occurring amino acid residue.
- the 2A peptide is a porcine teschovirus-12A peptide (GSGATNFSLLKQAGDVEENPGP, SEQ ID NO:248).
- the 2A peptide is an equine rhinitis A virus 2A peptide (GSGQCTNYALLKLAGDVESNPGP, SEQ ID NO:249).
- the 2A peptide is a foot-and-mouth disease virus 2A peptide: (GSGEGRGSLLTCGDVEENPGP, SEQ ID NO:250).
- the cleavable linker includes a furin-cleavable sequence. Exemplary furin-cleavable sequences are described for example, Duckert et al., Protein Engineering, Design & Selection 17(1):107-112 (2004), and US Patent No.8,871,906, each of which is incorporated herein by reference, particularly in relevant parts relating to furin-cleavable sequences.
- the linker includes a 2A peptide and a furin-cleavable sequence.
- the furin-cleavable 2A peptide includes the amino acid sequence RAKRSGSGATNFSLLKQAGDVEENPGP (SEQ ID NO:251).
- the immunomodulatory agents are attached in the membrane anchored immunomodulatory fusion protein by a degradable linker (e.g., a disulfide linker) such that under physiological conditions, the linker degrades, thereby releasing the immunomodulatory agent.
- the immunomodulatory agents are reversibly linked to functional groups through a degradable linker such that under physiological conditions, the linker degrades and releases the immunomodulatory agent.
- Suitable degradable linkers include, but are not limited to: a protease sensitive linker that is sensitive to one or more enzymes present in biological media such as proteases in a tumor microenvironment such a matrix metalloproteases present in a tumor microenvironment or in inflamed tissue (e.g. matrix metalloproteinase 2 (MMP2) or matrix metalloproteinase 9 (MMP9)).
- a protease sensitive linker that is sensitive to one or more enzymes present in biological media such as proteases in a tumor microenvironment such a matrix metalloproteases present in a tumor microenvironment or in inflamed tissue (e.g. matrix metalloproteinase 2 (MMP2) or matrix metalloproteinase 9 (MMP9)).
- MMP2 matrix metalloproteinase 2
- MMP9 matrix metalloproteinase 9
- Exemplary cleavable linker include those that are recognized by one of the following enzymes: metalloprotease MMP-1, MMP-2, MMP-3, MMP-8, MMP-9, MMP-14, plasmin, PSA, PSMA, CATHEPSIN D, CATHEPSIN K, CATHEPSIN S, ADAM10, ADAM12, ADAMTS, Caspase-1, Caspase-2, Caspase-3, Caspase-4, Caspase-5, Caspase-6, Caspase-7, Caspase-8, Caspase-9, Caspase-10, Caspase-11, Caspase-12, Caspase-13, Caspase-14, and TACE.
- metalloprotease MMP-1, MMP-2, MMP-3, MMP-8, MMP-9, MMP-14 plasmin, PSA, PSMA, CATHEPSIN D, CATHEPSIN K, CATHEPSIN S, ADAM10, ADAM12, ADAMTS, Caspase-1
- the membrane anchored immunomodulatory fusion protein includes a signal peptide that facilitates the translocation of the fusion protein to the TIL cell membrane. Any suitable signal peptide that facilities the localization of the fusion protein to the TIL cell membrane can be used. In some embodiments, the signal peptide does not interfere with the bioactivity of the immunomodulatory agent.
- Exemplary signal peptide sequences include, but are not limited to: human granulocyte-macrophage colony- stimulating factor (GM-CSF) receptor signal sequence, human prolactin signal sequence, and human IgE signal sequence.
- the fusion protein includes a human IgE signal sequence.
- the human IgE signal sequence has the amino acid sequence MDWTWILFLVAAATRVHS (SEQ ID NO:252).
- the human IgE signal sequence includes the amino acid sequence NIKGSPWKGSLLLLLVSNLLLCQSVAP (SEQ ID NO:253).
- the signal peptide sequence is an IL-2 signal sequence having the amino acid sequence MYRMQLLSCIALSLALVTNS (SEQ ID NO:254).
- the membrane anchored immunomodulatory fusion protein is according to the formula, from N- to C-terminus: [00579] S-IA-L-C, [00580] wherein S is a signal peptide, IA is an immunomodulatory agent, L is a linker and C is a cell membrane anchor moiety.
- the signal peptide S is any one of SEQ ID NOs:252- 254. In some emboidments, the cell membrane anchor moiety is SEQ ID NO:277.
- the immunomodulatory agent is IL-2, IL-12, IL-15, IL-18, IL-21, or a CD40 agonist (e.g., CD40L or an anti-CD40 scFv as described herein).
- C is a B7-1 trnasmembrane-intracellular domain (e.g., SEQ ID NO:239).
- Exemplary membrane anchored immunomodulatory fusion proteins according to the above formula are depicted in Figures 36 and 37.
- the TIL includes two or more different membrane anchored immunomodulatory fusion proteins according to the formula, from N- to C- terminus: S-IA-L-C, wherein each of the different membrane anchored immunomodulatory fusion proteins includes a different immunomodulatory agent.
- the two or more different immunomodulatory agents are selected from the group consisting of: IL-12 and IL-15, IL-15 and IL-18, CD40L and IL-15, IL-15 and IL-21, and IL-2 and IL-12.
- the membrane anchored immunomodulatory fusion proteins are arranged according to the formula, from N- to C-terminus: [00584] S1-IA1-L1-C1-L2-S2-IA2-L3-C2, [00585] wherein S1 and S2 are each a signal peptide, IA1 and IA2 are each an immunomodulatory agent, L1-L3 are each a linker, and C1 and C2 are each a cell membrane anchor moiety.
- IA1 and IA2 are the same immunomodulatory agent.
- IA1 and IA2 are different immunomodulatory agents.
- IA1 and IA2 are independently selected from IL-2, IL-12, IL-15, IL-18, IL-21, a CD40 agonist (e.g., CD40L or an agonistic anti-CD40 binding domain (e.g., an anti-CD40 scFv)) or a bioactive variant thereof.
- IA1 and IA2 are selected from the group consisting of: IL-12 and IL-15, IL-15 and IL-18, CD40L and IL-15, IL-15 and IL-21, and IL- 2 and IL-12.
- one or more of L1-L3 is a cleavable linker.
- L1-L3 are different linkers.
- L2 is a cleavable linker.
- L2 is furin cleavable P2A linker (e.g., SEQ ID NO:251).
- C1 and C2 are independently transmembrane domains and/or transmembrane-intracellular domains.
- C1 and C2 are the same.
- C1 and C2 are each a B7-1 transmembrane-intracellular domain (e.g., SEQ ID NO:239).
- C1 and C2 are different.
- Modified TILs that include cell membrane anchored immunomodulatory fusion proteins associated with their surfaces can be made by genetically modifying a populations of TILs to include a nucleic acid encoding the fusion protein. Any suitable genetic modification method can be used to produce such modified TILs including, for example, CRISPR, TALE, zinc finger, and Cas-CLOVER method described herein. [00587] Any suitable population of TILs can be genetically modified to make the subject modified TIL compositions.
- a population TILs produced during any of the steps of the Process 2A method disclosure herein is genetically modified to produce the subject modified TILs.
- a population TILs produced during any of the steps of the GEN 3 method disclosure herein is genetically modified to produce the subject modified TILs.
- TILs produced from the second step in the Process 2A method and/or the rapid expansion step in the GEN 3 method provided herein are genetically modified to produce the subject modified TILs.
- PD-1 positive TILs that have been preselected using the methods described herein are genetically modified to produce the subject modified TILs.
- any suitable population of TILs can be transiently modified to make the subject transiently modified TIL compositions.
- a population of TILs produced during any of the steps of the Process 2A method disclosure herein is transfected with nucleic acid encoding a cell membrane anchored immunomodulatory fusion protein to transiently express the cell membrane anchored immunomodulatory fusion protein in the subject transiently modified TILs.
- a population of TILs produced during any of the steps of the GEN 3 method disclosure herein see, e.g., FIG.
- TILs produced from the first expansion step in the Process 2A method and/or the priming expansion step in the GEN 3 method provided herein are transfected with nucleic acid encoding a cell membrane anchored immunomodulatory fusion protein to transiently express the cell membrane anchored immunomodulatory fusion protein in the subject transiently modified TILs.
- TILs produced from the second expansion step in the Process 2A method and/or the rapid expansion step in the GEN 3 method provided herein are transfected with nucleic acid encoding a cell membrane anchored immunomodulatory fusion protein to transiently express the cell membrane anchored immunomodulatory fusion protein in the subject transiently modified TILs.
- PD-1 positive TILs that have been preselected using the methods described herein are transfected with nucleic acid encoding a cell membrane anchored immunomodulatory fusion protein to transiently express the cell membrane anchored immunomodulatory fusion protein in the subject transiently modified TILs.
- nucleic acids encoding the membrane anchored immunomodulatory fusion proteins
- expression vectors that include such nucleic acids
- host cells that include the nucleic acids or expression vectors.
- Any suitable promoter can be used for the expression of the membrane anchored immunomodulatory fusion protein.
- the promoter is an inducible promoter.
- Vectors for expression of the subject membrane anchored immunomodulatory fusion proteins include, but are not limited to adenoviral vectors, retroviral vectors, lentiviral vectors, and adeno-associated vectors (AAV).
- a piggyBac transposon is used for expression of the subject membrane anchored immunomodulatory fusion proteins.
- nucleic acids that encode for exemplary membrane anchored immunomodulatory fusion proteins and components of such fusion proteins are depicted in Figures 36 and 37, and Tables 58 and 59.
- the nucleic acids encoding the membrane anchored immunomodulatory fusion protein is mRNA.
- the mRNA includes one or more modifications that improves intracellular stability and/or translation efficiency of the mRNA.
- the mRNA includes a 5’ cap or cap analog that improves mRNA half-life.
- Exemplary cap structures include, but are not limited to ARCA, mCAP, m 7 GpppN (cap 0), m 7 GpppNm (cap 1), and m 7 GpppNmpNm (cap 2) caps.
- the 5’ cap is according ot the formula: m7 Gppp[N2'Ome]n[N]m wherein m7 G is N7-methylated guanosine or any guanosine analog, N is any natural, modified or unnatural nucleoside, "n” can be any integer from 0 to 4 and "m” can be an integer from 1 to 9.
- the nucleic acids encoding the membrane anchored immunomodulatory fusion protein is mRNA further includes a 3’ untranslated region (UTR) or modified UTR.
- UTR untranslated region
- 3′ UTRs are known to have stretches of adenosines and uridines. These AU rich signatures are particularly prevalent in genes with high rates of turnover.
- AU rich elements can be separated into three classes (Chen et al, 1995): Class I AREs contain several dispersed copies of an AUUUA motif within U-rich regions. C-Myc and MyoD contain class I AREs. Class II AREs possess two or more overlapping UUAUUUA(U/A)(U/A) nonamers. Molecules containing this type of AREs include GM-CSF and TNF-a. Class III ARES are less well defined. These U rich regions do not contain an AUUUA motif. c-Jun and Myogenin are two well-studied examples of this class.
- AREs 3′ UTR AU rich elements
- AREs can be identified and removed or mutated to increase the intracellular stability and thus increase translation and production of the resultant protein.
- Transfection experiments can be conducted in relevant cell lines, using nucleic acids, and protein production can be assayed at various time points post-transfection.
- cells can be transfected with different ARE-engineering molecules and by using an ELISA kit to the relevant protein and assaying protein produced at 6 hour, 12 hour, 24 hour, 48 hour, and 7 days post-transfection.
- the nucleic acid encoding the membrane anchored immunomodulatory fusion proteins is operably linked to a nuclear factor of activated T-cells (NFAT) promoter or a functional portion or functional variant thereof.
- NFAT nuclear factor of activated T-cells
- NFAT promoter means one or more NFAT responsive elements linked to a minimal promoter of any gene expressed by T-cells.
- the minimal promoter of a gene expressed by T- cells is a minimal human IL-2 promoter.
- the NFAT responsive elements may comprise, e.g., NFATl, NFAT2, NFAT3, and/or NFAT4 responsive elements.
- the NFAT promoter (or functional portion or functional variant thereof) may comprise any number of binding motifs, e.g., at least two, at least three, at least four, at least five, or at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, or up to twelve binding motifs.
- the NFAT promoter comprises six NFAT binding motifs. See, e.g., US Patent No.8,556,882, which is incorporated by reference in its entirety and particularly for pertinent parts relating to NFAT promoters.
- the NFAT promoter system controls expression of an immunomodulatory fusion protein that includes any of the immunomodulatory agents described herein.
- the immunomodulatory agent is selected from: IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., CD40L or agonistic anti-CD40 binding domain (e.g., an anti-CD40 scFv)) or a bioactive variant thereof.
- a CD40 agonist e.g., CD40L or agonistic anti-CD40 binding domain (e.g., an anti-CD40 scFv)
- Exemplary nucleic acids encoding exemplary subject membrane anchored immunomodulatory fusion proteins operably linked to a NFAT promoter are depicted in Table 59.
- the NFAT promoter system controls expression of an immunomodulatory fusion protein that includes IL-15.
- the NFAT promoter system controls expression of an immunomodulatory fusion protein that includes IL-21.
- the NFAT promoter system controls expression of an immunomodulatory fusion protein that includes IL-15 and IL-21.
- the invention provides TILs genetically modified to comprise DNA encoding an immunomodulatory fusion protein operably linked to the NFAT promoter.
- the NFAT promoter controls expression of DNA encoding an immunomodulatory fusion protein that includes any of the immunomodulatory agents described herein.
- the immunomodulatory agent is selected from: IL- 2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., CD40L or agonistic anti-CD40 binding domain (e.g., an anti-CD40 scFv)) or a bioactive variant thereof.
- the NFAT promoter controls expression of DNA encoding an immunomodulatory fusion protein that includes IL-15. In some embodiments, the NFAT promoter controls expression of DNA encoding an immunomodulatory fusion protein that includes IL-21. In some embodiments, the NFAT promoter controls expression of DNA encoding an immunomodulatory fusion protein that includes IL-15 and IL-21.
- the invention provides TILs genetically modified to comprise DNA encoding an immunomodulatory fusion protein operably linked to the NFAT promoter, wherein the immunomodulatory fusion protein is arranged according to the formula, from N- to C-terminus: [00597] S1-IA1-L1-C1-L2-S2-IA2-L3-C2, [00598] wherein S1 and S2 are each a signal peptide, IA1 and IA2 are each an immunomodulatory agent, L1-L3 are each a linker, and C1 and C2 are each a cell membrane anchor moiety. In some embodiments, IA1 and IA2 are the same immunomodulatory agent.
- IA1 and IA2 are different immunomodulatory agents. Suitable immunomodulatory agents including any of those described herein.
- IA1 and IA2 are independently selected from IL-2, IL-12, IL-15, IL-18, IL-21, a CD40 agonist (e.g., CD40L or an agonistic anti-CD40 binding domain (e.g., an anti-CD40 scFv)) or a bioactive variant thereof.
- IA1 and IA2 are selected from the group consisting of: IL-12 and IL-15, IL-15 and IL-18, CD40L and IL-15, IL-15 and IL-21, and IL- 2 and IL-12.
- IA1 and IA2 are independently selected from IL-15 and IL-21. In some embodiments, IA1 is IL-15 and IA2 is IL-21. In some embodiments, IA1 is IL-21 and IA2 is IL-15. In some embodiments, one or more of L1-L3 is a cleavable linker. In some embodiments two or more of L1-L3 are different linkers. In exemplary embodiments L2 is a cleavable linker. In some embodiments, L2 is furin cleavable P2A linker (e.g., SEQ ID NO:251).
- C1 and C2 are independently transmembrane domains and/or transmembrane-intracellular domains. In certain embodiments C1 and C2 are the same. In exemplary embodiments, C1 and C2 are each a B7-1 transmembrane-intracellular domain (e.g., SEQ ID NO:239). In exemplary embodiments, C1 and C2 are different. Exemplary constructs that include two membrane anchored immunomodulatory fusion proteins according to the above formula are depicted in Figure 36.
- Nucleic acids encoding the subject membrane anchored immunomodulatory fusion proteins may be introduced into a population of TILs to produce transiently modified or genetically modified TILs that express the membrane anchored immunomodulatory fusion proteins using any suitable method.
- nucleic acids encoding the membrane anchored immunomodulatory fusion proteins are introduced into a population of TILs using a microfluidic platform.
- the microfluidic platform is a SQZ vector-free microfluidic platform. See, e.g., International Patent Application Publication Nos. WO 2013/059343A1, WO 2017/008063A1, or WO 2017/123663A1, or U.S. Patent Application Publication Nos.
- the nucleic acid encoding the membrane anchored immunomodulatory fusion protein is mRNA and the microfluidic platform (e.g., SQZ vector- free microfluidic platform) is used to deliver the mRNA into TILs to produce transiently modified TILs.
- the nucleic acid encoding the membrane anchored immunomodulatory fusion protein is DNA and the microfluidic platform (e.g., SQZ vector- free microfluidic platform) is used to deliver the DNA into TILs to produce stable genetically-modified TILs.
- the microfluidic platform may be used to deliver the nucleic acid to any population of TILs produced during any steps of the Process 2A method disclosure herein (see, e.g., FIGS.2-6) or GEN 3 method disclosure herein (see, e.g., FIG.7) to produce the modified TILs.
- the membrane anchored immunomodulatory fusion protein includes an IL-2, an IL-12, an IL-15, an IL-18, an IL-21, a CD40 agonist (e.g., CD40L or agonistic anti-CD40 binding domain (e.g., an anti-CD40 scFv)) or any combination thereof.
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-15.
- the second immunomodulatory agent is IL-2, IL-12, IL-18, IL-21, CD40L or an anti-CD40 binding domain (e.g., an anti-CD40 scFv).
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is CD40L.
- the second immunomodulatory agent is IL-2, IL-12, IL-15, IL-18, IL-21, a CD40 agonist (e.g., CD40L or an agonistic anti-CD40 binding domain (e.g., an anti-CD40 scFv)) or a bioactive variant thereof.
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-12.
- the second immunomodulatory agent is IL-2, IL-15, IL-18, IL-21, CD40L or an anti-CD40 binding domain (e.g., an anti-CD40 scFv).
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-18.
- the second immunomodulatory agent is IL-2, IL-12, IL-15, IL-21, CD40L or an anti-CD40 binding domain (e.g., an anti-CD40 scFv).
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-21.
- the second immunomodulatory agent is IL-2, IL-12, IL-15, IL-18, CD40L or an anti-CD40 binding domain (e.g., an anti-CD40 scFv).
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-2.
- the second immunomodulatory agent is IL-2, IL-12, IL-15, IL-18, IL-21, CD40L or an anti-CD40 binding domain (e.g., an anti-CD40 scFv).
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-2 and the second immunomodulatory agent is IL-12.
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-2 and the second immunomodulatory agent is IL-15.
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-2 and the second immunomodulatory agent is IL-18.
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-2 and the second immunomodulatory agent is IL-21.
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-2 and the second immunomodulatory agent is CD40L or an anti-CD40 binding domain (e.g., an anti-CD40 scFv).
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-12 and the second immunomodulatory agent is IL-15.
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-12 and the second immunomodulatory agent is IL-18.
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-12 and the second immunomodulatory agent is IL-21.
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-12 and the second immunomodulatory agent is CD40L or an anti-CD40 binding domain (e.g., an anti-CD40 scFv).
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-15 and the second immunomodulatory agent is IL-18.
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-15 and the second immunomodulatory agent is IL-21.
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-15 and the second immunomodulatory agent is CD40L or an anti-CD40 binding domain (e.g., an anti-CD40 scFv).
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-18 and the second immunomodulatory agent is IL-21.
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-18 and the second immunomodulatory agent is CD40L or an anti-CD40 binding domain (e.g., an anti-CD40 scFv).
- the modified TILs provided herein include two membrane anchored immunomodulatory fusion proteins that each include a different immunomodulatory agent (i.e., a first and second immunomodulatory agent), wherein the first immunomodulatory agents is IL-21 and the second immunomodulatory agent is CD40L or an anti-CD40 binding domain (e.g., an anti-CD40 scFv).
- a first and second immunomodulatory agent i.e., CD40L or an anti-CD40 binding domain
- Additional membrane anchored immunomodulatory fusion proteins that can be included in the modified TILs provided herein are described in WO 2019/157130 A1, which is incorporated by reference in its entirety, particularly in relevant parts related to membrane anchored immunomodulatory fusion proteins.
- the modified TILs provided herein include immunomodulatory fusion proteins, wherein such fusion proteins include one or more immunomodulatory agents linked to a TIL antigen binding domain (ABD).
- ABD TIL antigen binding domain
- the TIL antigen binding domain includes an antibody variable heavy domain (VH) and variable light domain (VL).
- VH variable heavy domain
- VL variable light domain
- the TIL antigen binding domain is a full length antibody that includes a heavy chain according to the formula: VH-CH1-hinge- CH2-CH3 and a light chain according to the formula: VL-CL, wherein VH is a variable heavy domain; CH1, CH2, CH3 are heavy chain constant domains, VL is a variable light domain and CL is a light chain constant domain.
- the TIL antigen binding domain is antibody fragment.
- TIL antigen binding domain is a Fab, Fab′, F(ab′)2, F(ab)2, variable fragment (Fv), domain antibody (dAb), or single chain variable fragment (scFv).
- the TIL antigen binding domain can bind to any suitable TIL antigen that allows for the attachment of the immunomodulatory agent-TIL ABD fusion protein to the surface of the TIL.
- the TIL antigen binding domain is capable of binding to a TIL surface antigen.
- TIL surface antigens include, but are not limited to D16, CD45, CD4, CD8, CD3, CD11a, CD11b, CD11c, CD18, LFA-1, CD25, CD127, CD56, CD19, CD20, CD22, HLA-DR, CD197, CD38, CD27, CD137, OX40, GITR, CD56, CD196, CXCR3, CXCR4, CXCR5, CD84, CD229, CCR1, CCR5, CCR4, CCR6, CCR8, and/or CCR10.
- the ABD binds to CD45.
- the ABD binds to a CD45 isoform selected from CD45RA, CD45RB, CD45RC or CD45R ⁇ .
- the ABD binds to a CD45 expressed primary on T cells.
- the ABD binds to a checkpoint inhibitor.
- exemplary checkpoint inhibitors include, but are not limited to PD-1, PD-L1, LAG-3, TIM-3 and CTLA- 4 (see, e.g., Qin et al., Molecular Cancer 18:155 (2019)).
- the ABD binds to a checkpoint inhibitor expressed on an immune effector cell (e.g., a T cell or NK cell).
- an immune effector cell e.g., a T cell or NK cell.
- Exemplary anti-PD-1 antibodies are disclosed, for example, in US Patent Nos.
- the ABD is an anti-CD45 antibody or a fragment thereof.
- the anti-CD45 antibody is a human anti-CD45 antibody, a humanized anti-CD45 antibody, or a chimeric anti-CD45 antibody.
- the ABD includes the vhCDR1-3 and vlCDR1-3 of anti-CD45 antibody BC8 (see US20170326259, incorporated by reference herein, particularly in relevant parts relating to anti-CD45 antibody sequences).
- the ABD includes the variable heavy domain and variable domain of anti-CD45 antibody BC8.
- the ABD includes the vhCDR1-3 and vlCDR1-3 or VH and VL of one of the following anti- CD45 antibodies: 10G10, UCHL1, 9.4, 4B2, or GAP8.3 (seespertini et al., Immunology 113(4):441-452 (2004), Buzzi et al., Cancer Research 52:4027-4035 (1992)).
- the immunomodulatory fusion proteins can be any suitable immunomodulatory agent including, for example, any of the immunomodulatory agents provided herein.
- the immunomodulatory agent is an interleukin that promotes an anti-tumor response.
- the immunomodulatory agent is a cytokine.
- the immunomodulatory agent is IL-2, IL-12, IL-15, IL-21 or a bioactive variant thereof.
- the fusion protein includes more than one immunomodulatory agents.
- the fusion protein includes 2, 3, 4, 5, 6, 7, 8, 9 or 10 different immunomodulatory agents.
- the TIL antigen binding domain is attached to the immunomodulatory agent using any suitable linker. Suitable linkers include, but are not limited: a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, or a non-helical linker.
- the linker is a peptide linker that optionally comprises Gly and Ser. Suitable linkers include linkers that are at least about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid residues in length. In some embodiments, the linker is 5-10, 10-15, 15-20, 20-25, 25-30, 30- 35, 35-40, 45-50, or 50-60 amino acids in length. In certain embodiments, the peptide linker is a (GGGS) n or (GGGGS) n linker, wherein n indicates the number of repeats of the motif and is an integer selected from 1-10. In some embodiments, the linker is an antibody hinge domain or a fragment thereof.
- the linker is a human immunoglobulin (Ig) hinge domain (e.g., an IgG1, IgG2, IgG3, IgG4, IgD, IgE, IgM or IgA hinge) or a fragment thereof.
- the immunomodulatory agent is directly coupled to the TIL without a linker.
- the immunomodulatory agent can be attached to the TIL antigen binding domain at a suitable position that does not impede binding of the fusion protein to a TIL.
- the antigen binding domain is a full length antibody
- the immunomodulatory agent is attached to the C-terminus or N-terminus of either the heavy chain or light chain.
- the immunomodulatory agent is attached to the C-terminus or N-terminus of the variable heavy domain or variable light domain. In some embodiments wherein the antigen binding domain is an Fab, the immunomodulatory agent is attached to the C-terminus or N-terminus of the variable heavy domain or variable light domain. In some embodiments wherein the antigen binding domain is an Fab’, the immunomodulatory agent is attached to the C- terminus or N-terminus of the variable heavy domain or variable light domain. In some embodiments wherein the antigen binding domain is an Fab’2, the immunomodulatory agent is attached to the C-terminus or N-terminus of the variable heavy domain or variable light domain.
- the immunomodulatory agents are attached to each other using any of the linkers described herein.
- the two or more immunomodulatory agents are attached to different locations of the antigen binding domain.
- the two or more immunomodulatory agents are attached at (i) different locations on the heavy chain (ii) different locations on the light chain or (iii) different locations on the heavy chain and/or light chain.
- the subject immunomodulatory agent-TIL antigen binding domain fusion proteins can be made using any suitable method.
- nucleic acids that encode the subject fusion proteins, expression vectors that include such nucleic acids, and host cells that include the expression vectors.
- Host cells that include the expression vectors encoding the subject fusion proteins are cultured under conditions for the expression of the fusion proteins and the fusion proteins are subsequently isolated and purified.
- the purified fusion proteins are then incubated with a population of TILs under conditions that allow for the binding of the fusion protein to the TILs.
- the subject immunomodulatory agent-TIL antigen binding domain fusion proteins are attached to TILs produced during any of the steps of the Process 2A method disclosure herein (see, e.g., FIGs 2-6).
- the fusion proteins are attached to TILs produced during any of the steps of the GEN 3 method disclosure herein (see, e.g., FIG.7).
- the fusion proteins are attached to TILs produced from the first expansion step in the Process 2A method and/or the priming expansion step in the GEN 3 method provided herein.
- the fusion proteins are attached to TILs produced from the second expansion step in the Process 2A method and/or the rapid expansion step in the GEN 3 method provided herein.
- the TILs are PD-1 positive TILs that have been preselected using the methods described herein.
- Nucleic acids encoding the subject the subject immunomodulatory agent-TIL antigen binding domain fusion proteins may be introduced into a population of TILs to produce transiently modified or genetically modified TILs that express the subject immunomodulatory agent-TIL antigen binding domain fusion proteins using any suitable method.
- nucleic acids encoding the subject immunomodulatory agent-TIL antigen binding domain fusion proteins are introduced into a population of TILs using a microfluidic platform.
- the microfluidic platform is a SQZ vector-free microfluidic platform. See, e.g., International Patent Application Publication Nos.
- the cell membranes of the cells for modification e.g., TILs
- TILs the cell membranes of the cells for modification
- the nucleic acid encoding the subject immunomodulatory agent-TIL antigen binding domain fusion protein is mRNA and the microfluidic platform (e.g., SQZ vector-free microfluidic platform) is used to deliver the mRNA into TILs to produce transiently modified TILs.
- the nucleic acid encoding the subject immunomodulatory agent-TIL antigen binding domain fusion protein is DNA and the microfluidic platform (e.g., SQZ vector-free microfluidic platform) is used to deliver the nucleic acid into TILs to produce stable genetically-modified TILs.
- the microfluidic platform (e.g., SQZ vector-free microfluidic platform) may be used to deliver the nucleic acid to any population of TILs produced during any steps of the Process 2A method disclosure herein (see, e.g., FIGS.2-6) or GEN 3 method disclosure herein (see, e.g., FIG.7) to produce the modified TILs.
- the membrane anchored immunomodulatory fusion protein comprises an IL-2, an IL-12, an IL-15, an IL-21 or combinations thereof (e.g., IL-15 and IL-21).
- the subject modified TILs provided herein include one or more nanoparticles, and those nanoparticles include one or more immunomodulatory agents.
- the nanoparticles provided herein include a plurality of two or more proteins that are coupled to each other and/or a second component of the particle (e.g., reversibly linked through a degradable linker).
- the proteins of the nanoparticles are present in a polymer or silica.
- the nanoparticle includes a nanoshell.
- the nanoparticles provided herein include one or more immunomodulatory agent.
- the immunomodulatory agent is IL-2, IL- 12, IL-15, IL-18, IL-21, a CD40 agonist (e.g., CD40L or agonistic anti-CD40 binding domain (e.g., an anti-CD40 scFv)) or a bioactive variant thereof.
- Nanoparticles are attached to the surface of the TIL using any suitable technique described herein.
- Exemplary nanoparticles of use in the subject modified TILs provided herein include without limitation a liposome, a protein nanogel, a nucleotide nanogel, a polymer nanoparticle, or a solid nanoparticle.
- the nanoparticle includes a liposome.
- the nanoparticle includes an immunomodulatory agent nanogel.
- the nanoparticle is an immunomodulatory agent nanogel with a plurality of immunomodulatory agents (e.g., cytokines) covalently linked to each other.
- the nanoparticle includes at least one polymer, cationic polymer, or cationic block co-polymer on the nanoparticle surface.
- the immunomodulatory agent can be any suitable immunomodulatory agent including, for example, any of the immunomodulatory agents provided herein.
- the immunomodulatory agent is an interleukin that promotes an anti-tumor response.
- the immunomodulatory agent is a cytokine.
- the immunomodulatory agent is IL-2, IL-12, IL-15, IL-21 or a bioactive variant thereof.
- the fusion protein includes more than one immunomodulatory agents. In exemplary embodiments, the fusion protein includes 2, 3, 4, 5, 6, 7, 8, 9 or 10 different immunomodulatory agents.
- the nanoparticle includes proteins that are covalently cross-linked to each other and/or a second component (e.g., a degradable linker). In some embodiments, the nanoparticle includes immunomodulatory agents that are reversibly linked through a degradable linker to a function group or polymer, or “reversibly modified.” In some embodiments, the nanoparticle is a nanogel that includes a plurality of immunomodulatory agents cross-linked to each other through a degradable linker (see US Patent No.9,603,944).
- the protein of the nanogel are cross- linked to a polymer (e.g., polyethylene glycol (PEG)).
- the polymers are cross-linked to the nanogel surface.
- the immunomodulatory agents of the nanoparticles are reversibly linked to each other through a degradable linker (e.g., a disulfide linker) such that under physiological conditions, the linker degrades, thereby releasing the immunomodulatory agent.
- the immunomodulatory agents of the nanoparticles are reversibly linked to functional groups through a degradable linker such that under physiological conditions, the linker degrades and releases the immunomodulatory agent.
- Suitable degradable linkers include, but are not limited to: two N-hydroxysuccinimide (NHS) ester groups joined together by a flexible disulfide-containing linker that is sensitive to a reductive physiological environment; a hydrolysable linker that is sensitive to an acidic physiological environment (pH ⁇ 7, for example, a pH of 4-5, 5-6, or 6- to less than 7, e.g., 6.9), or a protease sensitive linker that is sensitive to one or more enzymes present in biological media such as proteases in a tumor microenvironment such a matrix metalloproteases present in a tumor microenvironment or in inflamed tissue (e.g.
- a crosslinker sensitive to a reductive physiological environment is, for example, a crosslinker with disulfide containing linker that will react with amine groups on proteins by the presence of NHS groups which cross-link the proteins into high density protein nanogels.
- the degradable cross-linker includes Bis[2-(N-succinimidyl- oxycarbonyloxy)ethyl] disulfide.
- the degradable linker includes at least one N- hydroxysuccinimide ester.
- the degradable linker is a redox responsive linker.
- the redox responsive linker includes a disulfide bond.
- the degradable linkers provided herein include at least one N-hydroxysuccinimide ester, which is capable of reacting with proteins at neutral pH (e.g., about 6 to about 8, or about 7) without substantially denaturing the protein.
- the degradable linkers are "redox responsive" linkers, meaning that they degrade in the presence of a reducing agent (e.g., glutathione, GSH) under physiological conditions (e.g., 20-40 °C and/or pH 4-8), thereby releasing intact protein from the compound to which it is reversibly linked.
- a reducing agent e.g., glutathione, GSH
- the protein of the nanoparticles are linked to the degradable linker through a terminal or internal-NH 2 functional group (e.g., a side chain of a lysine).
- the proteins of the nanoparticle are linked by an enzyme-sensitive linker.
- Exemplary cleavable linker include those that are recognized by one of the following enzymes: metalloprotease MMP-1, MMP-2, MMP-3, MMP-8, MMP-9, MMP-14, plasmin, PSA, PSMA, CATHEPSIN D, CATHEPSIN K, CATHEPSIN S, ADAM10, ADAM12, ADAMTS, Caspase-1, Caspase-2, Caspase-3, Caspase-4, Caspase-5, Caspase-6, Caspase-7, Caspase-8, Caspase-9, Caspase-10, Caspase-11, Caspase-12, Caspase- 13, Caspase-14, and TACE.
- metalloprotease MMP-1, MMP-2, MMP-3, MMP-8, MMP-9, MMP-14 plasmin, PSA, PSMA, CATHEPSIN D, CATHEPSIN K, CATHEPSIN S, ADAM10, ADAM12, ADAMTS, Caspase-1
- the nanoparticles are nanogels that include a monodispersed plurality of immunomodulatory agents (e.g., cytokines).
- the immunomodulatory agents of the nanogels are cross-linked to polymer.
- the polymer is cross-linked to the surface of the nanogel.
- the nanogel includes: a) one more immunomodulatory agents reversibly and covalently cross-linked to each other through a degradable linker; and b) polymers cross- linked to surface exposed proteins of the nanogels.
- Such nanogels can be made by contacting the one or more immunomodulatory agents with a degradable linker under conditions that permit reversible covalent crosslinking of the immunomodulatory agents to each other through the degradable linker to form a plurality of immunomodulatory agent nanogels.
- the immunomodulatory agent nanogels are contacted with a polymer (e.g., polyethylene glycol) under conditions that permit crosslinking of the polymer to the immunomodulatory agents of the immunomodulatory agent nanogels, thereby producing a plurality of immunomodulatory agent-polymer nanogels.
- a polymer e.g., polyethylene glycol
- the nanoparticles include one or more polymers.
- Exemplary polymers include, but are not limited to: aliphatic polyesters, poly (lactic acid) (PLA), poly (glycolic acid) (PGA), co-polymers of lactic acid and glycolic acid (PLGA), polycarprolactone (PCL), polyanhydrides, poly(ortho)esters, polyurethanes, poly(butyric acid), poly(valeric acid), and poly(lactide-co-caprolactone), and natural polymers such as alginate and other polysaccharides including dextran and cellulose, collagen, chemical derivatives thereof, including substitutions, additions of chemical groups such as for example alkyl, alkylene, hydroxylations, oxidations, and other modifications routinely made by those skilled in the art), albumin and other hydrophilic proteins, zein and other prolamines and hydrophobic proteins, copolymers and mixtures thereof.
- PLA poly (lactic acid)
- PGA poly (glycolic acid)
- PCL polycarprolactone
- PCL poly
- the immunomodulatory agents of the nanoparticles are linked to hydrophilic polymers.
- hydrophilic polymers include, but are not limited to: polyethylene glycol (PEG), polyethylene glycol-b-poly lysine (PEG-PLL), and/or polyethylene glycol-b-poly arginine (PEG-PArg).
- PEG polyethylene glycol
- PEG-PLL polyethylene glycol-b-poly lysine
- PEG-PArg polyethylene glycol-b-poly arginine
- the nanoparticle e.g., nanogel
- the nanoparticle includes one or more polycations on its surface.
- Exemplary polycations for use in the subject nanoparticles include, but are not limited to, polylysine (poly-L-lysine and/or poly-D-lysine), poly(argininate glyceryl succinate) (PAGS, an arginine-based polymer), polyethyleneimine, polyhistidine, polyarginine, protamine sulfate, polyethylene glycol-b-polylysine (PEG-PLL), and polyethylene glycol-g-polylysine.
- the nanoparticle is associated with the TIL surface by electrostatic attraction to the TIL.
- the nanoparticle includes a ligand that has affinity for a surface molecule of the TIL (e.g., a surface protein, carbohydrate and/or lipid).
- the nanoparticle includes an antigen binding domain that binds a TIL surface antigen as described herein.
- the antigen binding domain is an antibody or fragment thereof.
- the TIL surface antigen is CD45, LFA-1, CD 11a (integrin alpha- L), CD 18 (integrin beta-2), CD11b, CD11c, CD25, CD8, or CD4.
- the antigen binding domain (ABD) is an anti-CD45 antibody or a fragment thereof.
- the anti-CD45 antibody is a human anti-CD45 antibody, a humanized anti-CD45 antibody, or a chimeric anti-CD45 antibody.
- the ABD includes the vhCDR1-3 and vlCDR1-3 of anti-CD45 antibody BC8 (see US20170326259, incorporated by reference herein, particularly in relevant parts relating to anti-CD45 antibody sequences).
- the ABD includes the variable heavy domain and variable domain of anti- CD45 antibody BC8.
- the ABD includes the vhCDR1-3 and vlCDR1- 3 or VH and VL of one of the following anti-CD45 antibodies: 10G10, UCHL1, 9.4, 4B2, or GAP8.3 (seespertini et al., Immunology 113(4):441-452 (2004), Buzzi et al., Cancer Research 52:4027-4035 (1992)).
- the nanoparticles are attached to the surface of a population of TILs by incubating the TILs in the presence of the nanoparticles under conditions wherein the nanoparticles bind to the surface of the TILs.
- the nanoparticle is associated with the TIL cell surface by electrostatic attraction.
- the nanoparticle is covalently conjugated to the TIL. In other embodiments, the nanoparticle is not covalently conjugated to the TIL.
- the subject nanoparticles are attached to TILs produced during any of the steps of the Process 2A method disclosure herein (see, e.g., FIGs 2-6). In exemplary embodiments, the subject nanoparticles are attached to TILs produced during any of the steps of the GEN 3 method disclosure herein (see, e.g., FIG.7). In exemplary embodiments, the subject nanoparticles are attached to TILs produced from the first expansion step in the Process 2A method and/or the priming expansion step in the GEN 3 method provided herein.
- the subject nanoparticles are attached to TILs produced from the second expansion step in the Process 2A method and/or the rapid expansion step in the GEN 3 method provided herein.
- the TILs are PD-1 positive TILs that have been preselected using the methods described herein.
- Additional suitable nanoparticles for use in the modified TILs provided herein are disclosed in US Patent Application Publication No. US20200131239 and WO2020205808, each of which is incorporated by reference in its entirety and in relevant parts related to nanoparticles.
- the modified TILs provided herein may include one or more immunomodulatory agents attached to its surface.
- the immunomodulatory agents can be incorporated into any of the immunomodulatory fusion proteins described herein, including, for example, the membrane anchored immunomodulatory fusion proteins described herein. Any suitable immunomodulatory agent can be included in the subject modified TIL. In some embodiments, the immunomodulatory agent enhances TIL survival and/or anti-tumor activity once transferred to a patient. Exemplary immunomodulatory agents include, for example, cytokines.
- the modified TIL includes one or more of the following cytokines: IL-2, IL-7, IL-12, IL-15, IL-18, IL-21, IL-23, IL-27, IL-4, IL-1 ⁇ , IL-1 ⁇ , IL-5, IFN ⁇ , TNF ⁇ (TNFa), IFN ⁇ , IFN ⁇ , GM-CSF, GCSF, or a biologically active variant thereof.
- the immunomodulatory agent is a costimulatory molecule.
- the costimulatory molecule is one of the following: OX40, CD28, GITR, VISTA, CD40, CD3, or an agonist of CD137.
- the immunomodulatory agent is a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain). Exemplary immunomodulatory agents are discussed in detailed further below. 1.
- the modified TILs provided herein include an IL-15.
- the IL-15 is included as part of an immunomodulatory fusion protein as described herein (e.g., a membrane anchored immunomodulatory fusion protein).
- interleukin 15 refers to an interleukin that binds to and signals through a complex composed of an IL-15 specific receptor alpha chain (IL-15R ⁇ ), an IL-2/IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132) (e.g., Genbank Accession numbers: NM_00000585, NP_000576 and NP_751915 (human); and NM_001254747 and NP_001241676 (mouse)).
- IL-15 has been shown to stimulate T cell proliferation inside tumors.
- IL-15 also is able to extend the survivability of effector memory CD8+ T cells and is critical for the development of NK cells. Therefore, without being bound by any particular theory of operation, it is believed that modified TILs associated with an IL-15s described herein exhibit enhanced survival and/or anti-tumor effects. [00657] IL-15 has a short half-life of less than 40 minutes in vivo. Modifications to IL-15 monomer can improve its in vivo pharmacokinetics in the treatment of cancers. These modifications have generally centered on improving the trans-presentation of IL-15 with the alpha subunit of IL-15 receptor, IL-15R ⁇ .
- Such modifications include: 1) pre-association of IL-15 and its soluble receptor a-subunit-Fc fusion to form IL-15: IL-15R ⁇ -Fc complex (see, e.g., Rubinstein et al., Proc Natl Acad Sci U.S.A.103:9166–71 (2006)); 2) expression of the superagonist IL-15-sIL-15R ⁇ -sushi protein (see, e.g., Bessard et al., Molecular cancer therapeutics 8: 2736-45 (2009)); and 3) pre-association of human IL-15 mutant IL-15N72D with IL-15R ⁇ -Fc sushi-Fc fusion complex (see, e.g., Zhu et al., Journal of Immunology 183: 3598-6007 (2009)).
- the IL-15 associated with the modified TIL is a full length IL-15, a fragment or a variant of IL-15.
- the IL-15 is a human IL-15 or a variant human IL-15.
- the IL-15 is a biological active human IL-15 variant.
- the IL-15 includes a 1, 2, 3,4 ,5 ,67, 8, 9, or 10 mutations as compared to a wild-type IL-15.
- the IL-15 includes an N72D mutation relative to a wild type human IL-15.
- the variant IL-15 exhibits IL-15R ⁇ binding activity.
- the immunomodulatory agent includes an IL-15 and an extracellular domain of an IL-15R ⁇ .
- the immunomodulatory agent includes an IL-15 and an IL-15R ⁇ fused to an Fc domain (IL-15R ⁇ -Fc) TABLE 5 – IL-15 Related Sequences. Description Amino Acid Sequence VTESGCKECEELEEKNIKEFLQSFVHIVQMFI NTS (SEQ ID NO: 262) (IL-15SA) that includes a complex of human IL-15 and soluble human IL-15R ⁇ . The combination of human IL-15 with soluble human IL-15R ⁇ forms an IL-15 SA complex that possesses greater biological activity than human IL-15 alone.
- the IL-15SA includes a complex of human IL-15 and soluble human. IL-15R ⁇ comprising all or a portion of the extracellular domain, without the transmembrane or cytoplasmic domain. In some embodiments, the IL-15SA includes a complex of human IL-15 and soluble human IL-15R ⁇ that includes the full extracellular domain or a truncated form of the extracellular domain which retains IL-15 binding activity.
- the IL-15SA includes a complex of human IL-15 and soluble human IL-15R ⁇ that includes a truncated form of the extracellular domain which retains IL-15 binding activity.
- the soluble human IL-15R ⁇ includes amino acids 1-60, 1-61, 1-62, 1-63, 1-64 or 1-65 of human IL-15R ⁇ .
- the soluble human IL-15R ⁇ includes amino acids 1-80, 1-81, 1-82, 1-83, 1-84 or 1-85 of human IL-15R ⁇ .
- the soluble human IL-15R ⁇ includes amino acids 1- 180, 1-181, or 1-182 of human IL-15R ⁇ .
- the immunomodulatory agent is an IL-15SA comprising a complex of human IL-15 and soluble human IL-15R ⁇ comprising a truncated form of the extracellular domain which retains IL-15 binding activity and comprises a Sushi domain.
- the Sushi domain of IL-15R ⁇ is described in the art as approximately 60 amino acids in length and comprises 4 cysteines. (Wei et al., 2001). Truncated forms of soluble human IL-15R ⁇ which retain IL-15 activity and comprise a Sushi domain are useful in IL- 15SA of the present disclosure.
- the immunomodulatory agent includes a complex comprising soluble human IL-15R ⁇ expressed as a fusion protein, such as an Fc fusion as described herein (e.g., human IgG1 Fc), with IL-15.
- IL-15SA comprises a dimeric human IL-15R ⁇ Fc fusion protein (e.g., human IgG1 Fc) complexed with two human IL-15 molecules.
- the immunomodulatory agent is an IL-15SA cytokine complex that includes an IL-15 molecule comprising an amino acid sequence set forth in SEQ ID NO: 258, SEQ ID NO: 261, SEQ ID NO:262, or SEQ ID NO:263.
- an IL-15SA cytokine complex comprises a soluble IL-15R ⁇ molecule comprising a sequence of SEQ ID NO:260, SEQ ID NO: 264 or SEQ ID NO:265.
- the immunomodulatory agent is an IL-15SA cytokine complex that includes a dimeric IL-15R ⁇ Fc fusion protein complexed with two IL-15 molecules.
- IL-15-SA comprises a dimeric IL-15R ⁇ Su (Sushi domain)/Fc (SEQ ID NO:259) and two IL-15N72D (SEQ ID NO:258) molecules (also known as ALT-803), as described in US20140134128, incorporated herein by reference.
- the IL-15SA comprises a dimeric IL-15R ⁇ Su/Fc molecule (SEQ ID NO: 259) and two IL-15 molecules (SEQ ID NO: 261). In some embodiments, the IL-15SA comprises a dimeric IL-15R ⁇ Su/Fc molecule (SEQ ID NO: 259) and two IL-15 molecules (SEQ ID NO:262). In some embodiments, the IL-15SA comprises a dimeric IL-15R ⁇ Su/Fc molecule (SEQ ID NO:259) and two IL-15 molecules (SEQ ID NO:263).
- the IL-15SA includes a dimeric IL-15R ⁇ Su/Fc molecule (SEQ ID NO:259) and two IL-15 molecules having amino acid sequences selected from SEQ ID NO: 258, 258, 262, and 263.
- the IL-15SA includes a soluble IL-15R ⁇ molecule (SEQ ID NO:260) and two IL-15 molecules (SEQ ID NO:258).
- the IL-15SA comprises a soluble IL-15R ⁇ molecule (SEQ ID NO:260) and two IL-15 molecules (SEQ ID NO:261).
- the IL-15SA comprises a soluble IL-15R ⁇ molecule (SEQ ID NO:260) and two IL-15 molecules (SEQ ID NO:262). In some embodiments, the IL-15SA comprises a soluble IL-15R ⁇ molecule (SEQ ID NO:260) and two IL-15 molecules (SEQ ID NO:263). [00668] In some embodiments, the IL-15SA comprises a soluble IL-15R ⁇ molecule (SEQ ID NO:264) and two IL-15 molecules (SEQ ID NO:258). In some embodiments, the IL-15SA comprises a soluble IL-15R ⁇ molecule (SEQ ID NO:264) and two IL-15 molecules (SEQ ID NO:261).
- the IL-15SA comprises a soluble IL-15R ⁇ molecule (SEQ ID NO:264) and two IL-15 molecules (SEQ ID NO:262). In some embodiments, the IL-15SA comprises a soluble IL-15R ⁇ molecule (SEQ ID NO:264) and two IL-15 molecules (SEQ ID NO:261). [00669] In some embodiments, the IL-15SA includes a soluble IL-15R ⁇ molecule (SEQ ID NO:265) and two IL-15 molecules (SEQ ID NO:258). In some embodiments, the IL-15SA comprises a soluble IL-15R ⁇ molecule (SEQ ID NO:265) and two IL-15 molecules (SEQ ID NO:261).
- the IL-15SA comprises a soluble IL-15R ⁇ molecule (SEQ ID NO:265) and two IL-15 molecules (SEQ ID NO:262). In some embodiments, the IL-15SA comprises a soluble IL-15R ⁇ molecule (SEQ ID NO:265) and two IL-15 molecules (SEQ ID NO:263). [00670] In some embodiments, the IL-15SA comprises a dimeric IL-15R ⁇ Su/Fc (SEQ ID NO:269) molecule and two IL-15 molecules (SEQ ID NO:262).
- the IL-15SA includes a dimeric IL-15R ⁇ Su/Fc (SEQ ID NO:259) molecule and two IL-15 molecules (SEQ ID NO:263).
- the IL-15SA includes SEQ ID NO:259 and SEQ ID NO:260.
- IL-15SA comprises SEQ ID NO:261 or SEQ ID NO:262.
- the IL-15SA comprises SEQ ID NO:261 and SEQ ID NO:259.
- the IL-15SA comprises SEQ ID NO:262 and SEQ ID NO:259.
- the IL-15SA comprises SEQ ID NO:263 and SEQ ID NO:259.
- the IL-15SA comprises SEQ ID NO:261 and SEQ ID NO:260. In some embodiments the IL-15SA comprises SEQ ID NO:262 and SEQ ID NO:260.
- the TIL compositions include an immunomodulatory fusion protein or nanoparticle composition that includes a IL-15 or a bioactive variant thereof. Exemplary fusion proteins that include IL-15 are depicted in Figures 36 and 37, and Tables 58 and 59.
- the TIL compositions provided herein includes a nucleic acid encoding an immunomodulatory fusion protein that includes an IL-15, wherein the nucleic acid is operably linked to a an NFAT promoter, an EF-1a promoter, an MND promoter, or an SSFV promoter, as described herein.
- exemplary NFAT promoter-driven constructs for expression of immunomodulatory fusion proteins that include IL-15 are depicted in Table 59. 2.
- IL-12 [00674]
- the modified TIL is associated with an IL-12 or a variant thereof.
- the IL-12 is included as part of an immunomodulatory fusion protein as described herein (e.g., a membrane anchored immunomodulatory fusion protein).
- immunomodulatory fusion protein e.g., a membrane anchored immunomodulatory fusion protein.
- IL-12 interleukin 12
- IL-12B IL-12B genes
- IL-12 is composed of a bundle of four alpha helices and is involved in the differentiation of native T cells into TH1 cells.
- IL-12A p35
- IL-12B p40
- the active heterodimer referred to as 'p70'
- IL-12 binds to the IL-12 receptor, which is a heterodimeric receptor formed by IL- 12R- ⁇ 1 and IL-12R- ⁇ 2.
- IL-12 is known as a T cell-stimulating factor that can stimulate the growth and function of T cells.
- IL-12 can stimulate the production of interferon gamma (IFN- ⁇ ), and tumor necrosis factor-alpha (TNF- ⁇ ) from T cells and natural killer (NK) cells and reduce IL-4 mediated suppression of IFN- ⁇ .
- IFN- ⁇ interferon gamma
- TNF- ⁇ tumor necrosis factor-alpha
- IL-12 can further mediate enhancement of the cytotoxic activity of NK cells and CD8+ cytotoxic T lymphocytes. Moreover, IL-12 can also have anti-angiogenic activity by increasing production of interferon gamma, which in turn increases the production of the chemokine inducible protein-10 (IP-10 or CXCL10). IP-10 then mediates this anti-angiogenic effect. Thus, without being bound by any particular theory of operation, it is believed that IL-12 can increase the survivability and/or anti-tumor effects of the TIL compositions provided herein. [00676] In some embodiments, the IL-12 associated with the modified TIL is a full length IL-12, a fragment or a variant of IL-12.
- the IL-12 is a human IL-12 or a variant human IL-12.
- the IL-12 is a biological active human IL-12 variant.
- the IL-12 includes a 1, 2, 3,4 ,5 ,67, 8, 9, or 10 mutations as compared to a wild-type IL-12.
- the IL-12 included in the modified TIL compositions include an IL-12 p35 subunit or a variant thereof.
- the IL-12 p35 subunit is a human IL-12 p35 subunit.
- the IL-12 p35 subunit has the amino acid sequence
- the IL-12 included in the modified TIL compositions include an IL-12 p40 subunit or a variant thereof.
- the IL-12 is a single chain IL-12 polypeptide comprising an IL-12 p35 subunit attached to an IL- 12 p40 subunit. Such IL-12 single chain polypeptides advantageously retain one or more of the biological activities of wildtype IL-12.
- the single chain IL-12 polypeptide described herein is according to the formula, from N-terminus to C-terminus, (p40)-(L)-(p35), wherein “p40” is an IL-12 p40 subunit, “p35” is IL-12 p35 subunit and L is a linker.
- the single chain IL-12 is according to the formula from N- terminus to C-terminus, (p35)-(L)-(p40).
- Any suitable linker can be used in the single chain IL-12 polypeptide including those described herein. Suitable linkers can include, for example, linkers having the amino acid sequence (GGGGS)x wherein x is an integer from 1- 10.
- linkers include, for example, the amino acid sequence GGGGGGS.
- Exemplary single chain IL-12 linkers than can be used with the subject single chain IL-12 polypeptides are also described in Lieschke et al., Nature Biotechnology 15: 35-40 (1997), which is incorporated herein in its entirety by reference and particularly for its teaching of IL- 12 polypeptide linkers.
- the single chain IL-12 polypeptide is a single chain human IL-12 polypeptide (i.e., it includes a human p35 and p40 IL-12 subunit). TABLE 6 – IL-12 Related Sequences. Description Amino Acid Sequence fusion protein or nanoparticle composition that includes a IL-12 or a bioactive variant thereof.
- the TIL compositions provided herein includes a nucleic acid encoding an immunomodulatory fusion protein that includes an IL-12, wherein the nucleic acid is operably linked to an NFAT promoter, an EF-1a promoter, an MND promoter, or an SSFV promoter, as described herein. See, e.g., US Patent No.8,556,882, which is incorporated by reference in its entirety and particularly for pertinent parts relating to NFAT promoters for IL-12 expression. Exemplary fusion proteins that include IL-12 are depicted in Figures 36 and 37, and Table 58. 3.
- the modified TIL is associated with an IL-18 or a variant thereof.
- the IL-18 is included as part of an immunomodulatory fusion protein as described herein (e.g., a membrane anchored immunomodulatory fusion protein).
- immunomodulatory fusion protein e.g., a membrane anchored immunomodulatory fusion protein.
- IL-18 immunomodulatory fusion protein
- IGIF immunomodulatory fusion protein
- IL-1g interleukin-1g
- IL1F4 all refer to an interleukin that is a heterodimeric cytokine encoded by the IL-18 gene (e.g., Genbank Accession numbers: NM_001243211, NM_001562 and NM_001386420).
- IL-18 structurally similar to IL-1 ⁇ , is a member of IL-1 superfamily of cytokines.
- IL-18 in combination with IL-12 can activate cytotoxic T cells (CTLs), as well as natural killer (NK) cells, to produce IFN- ⁇ and, therefore, contributes to tumor immunity.
- CTLs cytotoxic T cells
- NK natural killer cells
- IL-18 can enhance the anti-tumor effects of the TIL compositions provided herein.
- the IL-18 associated with the modified TIL is a full length IL-18, a fragment or a variant of IL-18.
- the IL-18 is a human IL-18 or a variant human IL-18.
- the IL-18 is a biological active human IL-18 variant.
- the IL-18 includes 1, 2, 3,4 ,5 ,67, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,.18, 19, or 20 mutations as compared to a wild-type IL-18 (SEQ ID NO:269).
- the bioactive variant is a decoy resistant IL-18 variant (“DR-IL18,” or “DR-IL-18”) that provides IL-18 signaling activity even in the presence of an inhibitory molecule such as IL-18 binding protein (IL-18BP).
- DR-IL18 decoy resistant IL-18 variant
- IL-18BP IL-18 binding protein
- Exemplary IL-18 variants that can be included in the subject modified TILs described herein are shown below in Table 7.
- the variant IL-18 includes a stability mutation pair selection fromL C38S/C68S, C38S/C68G, C38S/C68A, C38S/C68D, and C38S/C68N [relative to the human wild-type IL-18 - SEQ ID NO: 269].
- the variant IL-18 includes mutations at amino acid positions M51 (e.g., M51E, M51R, M51K, M51T, M51D, or M51N), K53 (e.g., K53G, K53S, K53T, or K53R), Q56 (e g., Q56G, Q56R, Q56L, Q56E, Q56A, Q56V, or Q56K), D110 (e.g., D110S, DI 10N, D110G, D110K, D110H, D110Q, or D110E) and N111 (e.g., N111G, N111R, Ni l IS, Ni l ID, N111H, or N111Y) in addition to a stabilizing mutation pair selected from: C38S/C68S, C38S/C68G, C38S/C68A, C38S/C68D, and C38S/C68N [relative to the human wild type IL-18 - SEQ ID NO
- the TIL compositions provided herein includes a nucleic acid encoding an immunomodulatory fusion protein that includes an IL-18, wherein the nucleic acid is operably linked to an NFAT promoter, an EF-1a promoter, an MND promoter, or an SSFV promoter, as described herein.
- exemplary NFAT promoter-driven constructs for expression of immunomodulatory fusion proteins that include IL-21 are depicted in Table 59. 4.
- IL-21 [00686]
- the modified TIL is associated with an IL-21 or a variant thereof.
- the IL-21 is included as part of an immunomodulatory fusion protein as described herein (e.g., a membrane anchored immunomodulatory fusion protein).
- the cytokine-ABD includes an IL-21 molecule or fragment thereof.
- IL-21 interleukin 21
- IL21 e.g., Genbank Accession numbers: NM_001207006 and NP_001193935 (human); and NM_0001291041 and NP_001277970 (mouse)
- NK natural killer
- IL-21 can increase the survivability and/or anti-tumor effects of the TIL compositions provided herein.
- the IL-21 is a human IL-21.
- the IL-21 associated with the modified TIL is a full length IL-21, a fragment or a variant of IL- 21.
- the IL-21 is a human IL-21 or a variant human IL-21.
- the IL-21 is a biological active human IL-21 variant.
- the IL-21 includes a 1, 2, 3,4 ,5 ,67, 8, 9, or 10 mutations as compared to a wild-type IL-21. TABLE 8 – IL-21 Related Sequences. Description Amino Acid Sequence fusion protein or nanoparticle composition that includes a IL-21 or a bioactive variant thereof.
- the TIL compositions provided herein includes a nucleic acid encoding an immunomodulatory fusion protein that includes an IL-21, wherein the nucleic acid is operably linked to an NFAT promoter, an EF-1a promoter, an MND promoter, or an SSFV promoter, as described herein. 5.
- IL-2 [00691] In some embodiments, the modified TIL is associated with an IL-2 or a variant thereof.
- the IL-2 is included as part of an immunomodulatory fusion protein as described herein (e.g., a membrane anchored immunomodulatory fusion protein).
- the cytokine-ABD includes an IL-2 molecule or fragment thereof.
- IL-2 interleukin 2
- IL2 IL2
- TCGF e.g., Genbank Accession numbers: NM_000586 and NP_000577 (human) all refer to a member of a cytokine that binds to IL-2 receptor.
- IL-2 enhances activation-induced cell death (AICD).
- IL-2 also promotes the differentiation of T cells into effector T cells and into memory T cells when the initial T cell is also stimulated by an antigen, thus helping the body fight off infections. Together with other polarizing cytokines, IL-2 stimulates naive CD4+ T cell differentiation into Th1 and Th2 lymphocytes and impedes differentiation into Th17 and follicular Th lymphocytes.. IL-2 also increases the cell killing activity of both natural killer cells and cytotoxic T cells. Thus, without being bound by any particular theory of operation, it is believed that IL-2 can increase the survivability and/or anti-tumor effects of the TIL compositions provided herein. [00693] In some embodiments, the IL-2 is a human IL-2.
- the IL-2 associated with the modified TIL is a full length IL-2, a fragment or a variant of IL-2.
- the IL-2 is a human IL-2 or a variant human IL-2.
- the IL-2 is a biological active human IL-2 variant.
- the IL-2 includes a 1, 2, 3,4 ,5 ,67, 8, 9, or 10 mutations as compared to a wild-type IL-2. TABLE 9 – IL-2 Related Sequences. Description Amino Acid Sequence fusion protein or nanoparticle composition that includes a IL-2 or a bioactive variant thereof. Exemplary fusion proteins that include IL-2 are depicted in Figures 36 and 37.
- the TIL compositions provided herein includes a nucleic acid encoding an immunomodulatory fusion protein that includes an IL-2, wherein the nucleic acid is operably linked to an NFAT promoter, an EF-1a promoter, an MND promoter, or an SSFV promoter, as described herein. 6.
- CD40 Agonists [00696]
- the modified TIL is associated with CD40 agonist.
- the CD40 agonist is included as part of an immunomodulatory fusion protein as described herein (e.g., a membrane anchored immunomodulatory fusion protein).
- CD40 Cluster of differentiation 40
- APCs antigen-presenting cells
- CD40L CD154
- CD40 agonists can enhance the anti-tumor effects of the TIL compositions provided herein.
- CD40 agonists include, for example, CD40L and antibody or antibody fragments thereof (e.g., an scFv) that agonistically binds CD40.
- the TIL compositions include an immunomodulatory fusion protein or nanoparticle composition that includes a CD40L or a bioactive variant thereof.
- the TIL composition includes an immunomodulatory fusion protein that includes an agonistic anti-CD40 binding domain (e.g., an scFv).
- Exemplary CD40 agonist sequences are depicted in the table below. [00698] CD40 agonist activity can be measured using any suitable method known in the art.
- the TIL composition includes an agonistic anti-CD40 binding domain having the VH and VL sequences of an anti-CD40 scFv depicted in Table 10 or a bioactive variant thereof.
- the anti-CD40 binding domain includes a VH sequence that is at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identical to the VH sequence depicted in Table 10.
- the agonistic anti-CD40 binding domain includes a VH sequence that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid substitutions as compared to the VH sequence depicted in Table 10.
- the anti-CD40 binding domain includes a VL sequence that is at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% identical to the VL sequence depicted in Table 10.
- the anti-CD40 binding domain includes a VL sequence that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid substitutions as compared to the VL sequence depicted in Table 10.
- the anti-CD40 binding domain is an anti-CD40 scFv selected from SEQ ID NOs:276, 279, 282, and 285 in Table 10.
- the anti-CD40 binding domain is a variant of an anti- CD40 scFv in Table 10 that is capable of binding to human CD40.
- the variant anti-CD40 scFv is least about 75%, 80%, 85%, 90%, 95%, or 99% identical to an anti-CD40 scFv selected from SEQ ID NOs:276, 279, 282, and 285 in Table 10.
- Assessment of CD40 binding domain binding can be measured using any suitable assay known in the art, including, but not limited to: a Biacore, surface plasmon resonance (SPR) and/or BLI (biolayer interferometry, e.g., Octet assay) assay.
- SPR surface plasmon resonance
- BLI biolayer interferometry, e.g., Octet assay
- CD40 binding domains that are useful as immunomodulatory agents include those described in US Patent Nos. US 6,838,261, US 6,843,989, US 7,338,660, US 8,7778,345, which are incorporated by reference herein, particularly with respect to teachings of anti-CD40 antibodies and VH, VL and CDR sequences.
- the CD40 agonist is a CD40 ligand (CD40L).
- the CD40L is human CD40L (SEQ ID NO:270).
- the CD40L is a variant of a human CD40L that is at least about 75%, 80%, 85%, 90%, 95%, or 99% identical to SEQ ID NO:253. In some embodiments, the CD40L is a variant of a human CD40L that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid substitutions as compared to SEQ ID NO:273. [00704] Exemplary fusion proteins that include CD40 agonists are depicted in Figures 36 and 37.
- the TIL compositions provided herein includes a nucleic acid encoding an immunomodulatory fusion protein that includes a CD40 agonist, wherein the nucleic acid is operably linked to a NFAT promoter, as described herein.
- a nucleic acid encoding an immunomodulatory fusion protein that includes a CD40 agonist, wherein the nucleic acid is operably linked to a NFAT promoter, as described herein.
- the methods comprise one or more steps of gene-editing at least a portion of the TILs in order to enhance their therapeutic effect.
- gene-editing refers to a type of genetic modification in which DNA is permanently modified in the genome of a cell, e.g., DNA is inserted, deleted, modified or replaced within the cell’s genome.
- gene-editing causes the expression of a DNA sequence to be silenced (sometimes referred to as a gene knockout) or inhibited/reduced (sometimes referred to as a gene knockdown).
- gene-editing causes the expression of a DNA sequence to be enhanced (e.g., by causing over- expression).
- gene-editing technology is used to enhance the effectiveness of a therapeutic population of TILs.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., an exemplary TIL expansion method known as process 2A is described below), wherein the method further comprises gene-editing at least a portion of the TILs.
- a method for expanding TILs into a therapeutic population of TILs is carried out in accordance with any embodiment of the methods described in U.S. Pat. No.10,517,894, U.S. Patent Application Publication No. 2020/0121719 A1, or U.S. Pat. No.10,894,063, which are incorporated by reference herein in their entireties, wherein the method further comprises gene-editing at least a portion of the TILs.
- some embodiments of the present invention provides a therapeutic population of TILs that has been expanded in accordance with any embodiment described herein, wherein at least a portion of the therapeutic population has been gene-edited, e.g., at least a portion of the therapeutic population of TILs that is transferred to the infusion bag is permanently gene- edited.
- the methods comprise one or more steps of introducing into at least a portion of the TILs nucleic acids, e.g., mRNAs, for transient expression of an immunomodulatory protein, e.g., an immunomodulatory fusion protein comprising an immunomodulatory protein fused to a membrane anchor, in order to produce modified TILs with (i) reduced dependence on cytokines in when expanded in culture and/or (ii) an enhanced therapeutic effect.
- nucleic acids e.g., mRNAs
- an immunomodulatory protein e.g., an immunomodulatory fusion protein comprising an immunomodulatory protein fused to a membrane anchor
- transient gene-editing refers to a type of cellular modification or phenotypic change in which nucleic acid (e.g., mRNA) is introduced into a cell, such as transfer of nucleic acid into a cell.
- nucleic acid e.g., mRNA
- transient phenotypic alteration technology is used to reduce dependence on cytokines in the expansion of TILs in culture and/or enhance the effectiveness of a therapeutic population of TILs.
- a microfluidic platform is used for intracellular delivery of nucleic acids encoding the immunomodulatory fusion proteins provided herein.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the SQZ platform is capable of delivering nucleic acids and proteins, to a variety of primary human cells, including T cells (Sharei et al. PNAS 2013, as well as Sharei et al. PLOS ONE 2015 and Greisbeck et al. J.
- the cell membranes of the cells for modification e.g., TILs
- TILs the cell membranes of the cells for modification
- Such methods as described in International Patent Application Publication Nos. WO 2013/059343A1, WO 2017/008063A1, or WO 2017/123663A1, or U.S. Patent Application Publication Nos. US 2014/0287509A1, US 2018/0201889A1, or US 2018/0245089A1 can be employed with the present invention for delivering nucleic acids encoding the subject immunomodulatory fusion proteins to a population of TILs.
- the delivered nucleic acid allows for transient protein expression of the immunomodulatory fusion proteins in the modified TILs.
- the SQZ platform is used for stable incorporation of the delivered nucleic acid encoding the immunomodulatory fusion protein into the TIL cell genome.
- a transposon/transposase system is used for both delivery of a gene-editing system and transiently altering protein expression.
- the transposon/transposase system comprises a piggyBac transposons and transposases or piggyBac-like transposons and transposases; a sleeping beauty (SB) transposon and transposase; or a Helraiser transposon and transposase.
- a transposon/transposase system e.g., piggyBac transposons and transposases or piggyBac-like transposons and transposases; a sleeping beauty (SB) transposon and transposase; or a Helraiser transposon and transposase
- a transposon/transposase system e.g., piggyBac transposons and transposases or piggyBac-like transposons and transposases; a sleeping beauty (SB) transposon and transposase; or a Helraiser transposon and transposase
- a transposon/transposase system e.g., piggyBac transposons and transposases or piggyBac-like transposons and transposases; a sleeping beauty (SB) transposon and transposase; or a Helraiser transposon and transposase
- a is used for both for expression
- the immune checkpoint is one of the following: PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, PRDM1, BATF
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2, and optionally OKT-3 (e.g., OKT-3 may be present in the culture medium beginning on the start date of the expansion process), to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, and wherein the transition from step (b) to step
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD- 1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- the gene-editing process may be carried out at any time during the TIL expansion method prior to the transfer to the infusion bag in step (f), which means that the gene editing may be carried out on TILs before, during, or after any of the steps in the expansion method; for example, during any of steps (a)-(f) outlined in the method above, or before or after any of steps (a)-(e) outlined in the method above.
- TILs are collected during the expansion method (e.g., the expansion method is “paused” for at least a portion of the TILs), and the collected TILs are subjected to a gene-editing process, and, in some cases, subsequently reintroduced back into the expansion method (e.g., back into the culture medium) to continue the expansion process, so that at least a portion of the therapeutic population of TILs that are eventually transferred to the infusion bag are permanently gene-edited.
- the gene-editing process may be carried out before expansion by activating TILs, performing a gene-editing step on the activated TILs, and expanding the gene-edited TILs according to the processes described herein.
- nucleic acids for gene editing are delivered to the TILs using a microfluidic platform.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the gene-editing process is carried out after the first TIL expansion step. In some embodiments, the gene-editing process is carried out after the first TIL expansion step and before the second expansion step. In some embodiments, the gene- editing process is carried out after the TILs are activated. In some embodiments, the gene- editing process is carried out after the first expansion step and after the TILs are activated, but before the second expansion step.
- the gene-editing process is carried out after the first expansion step and after the TILs are activated, and the TILs are rested after gene-editing and before the second expansion step. In some embodiments, the TILs are rested for about 1 to 2 days after gene-editing and before the second expansion step. In some embodiments, the TILs are activated by exposure to an anti-CD3 agonist and an anti- CD28 agonist. In some embodiments, the anti-CD3 agonist is an anti-CD3 agonist antibody and the anti-CD28 agonist is an anti-CD28 agonist antibody. In some embodiments, the anti- CD3 agonist antibody is OKT-3.
- the TILs are activated by exposure to anti-CD3 agonist antibody- and anti-CD28 agonist antibody-conjugated beads.
- the anti-CD3 agonist antibody- and anti-CD28 agonist antibody-conjugated beads are the TransAct TM product of Miltenyi.
- the gene-editing process is carried out by viral transduction.
- the gene-editing process is carried out by retroviral transduction.
- the gene-editing process is carried out by lentiviral transduction.
- the immunomodulatory composition is a membrane anchored immunomodulatory fusion protein.
- the immunomodulatory fusion protein comprises IL-15.
- the immunomodulatory fusion protein comprises IL-21. In some embodiments, the immunomodulatory composition comprises two or more different membrane bound fusion proteins. In some embodiments, the immunomodulatory composition comprises a first immunomodulatory protein comprising IL-15 and a second immunomodulatory fusion protein comprising IL-21. In some embodiments, the TILs are gene-edited to express the immunomodulatory composition under the control of an NFAT promoter. In some embodiments, the TILs are gene-edited to express an immunomodulatory fusion protein comprising IL-15 under the control of an NFAT promoter. In some embodiments, the TILs are gene-edited to express an immunomodulatory fusion protein comprising IL-21 under the control of an NFAT promoter.
- the TILs are gene-edited to express a first immunomodulatory fusion protein comprising IL-15 and a second immunomodulatory fusion protein comprising IL-21 under the control of an NFAT promoter.
- the gene-editing process is carried out by viral transduction. In some embodiments, the gene-editing process is carried out by retroviral transduction. In some embodiments, the gene-editing process is carried out by lentiviral transduction.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2, and optionally OKT-3 (e.g., OKT-3 may be present in the culture medium beginning on the start date of the expansion process), to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) gene-editing at least a portion of the TIL cells in
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- the TILs are rested after the gene-editing step and before the second expansion step. In some embodiments, the TILs are rested for about 1 to 2 days after the gene-editing step and before the second expansion step. In some embodiments, the TILs are activated by exposure to an anti-CD3 agonist and an anti-CD28 agonist. In some embodiments, the anti- CD3 agonist is an anti-CD3 agonist antibody and the anti-CD28 agonist is an anti-CD28 agonist antibody. In some embodiments, the anti-CD3 agonist antibody is OKT-3. In some embodiments, the TILs are activated by exposure to anti-CD3 agonist antibody- and anti- CD28 agonist antibody-conjugated beads.
- the anti-CD3 agonist antibody- and anti-CD28 agonist antibody-conjugated beads are the TransAct TM product of Miltenyi.
- the gene-editing process is carried out by viral transduction. In some embodiments, the gene-editing process is carried out by retroviral transduction of the TILs, optionally for about 2 days. In some embodiments, the gene-editing process is carried out by lentiviral transduction of the TILs, optionally for about 2 days.
- the immunomodulatory composition is a membrane anchored immunomodulatory fusion protein. In some embodiments, the immunomodulatory fusion protein comprises IL-15. In some embodiments, the immunomodulatory fusion protein comprises IL-21.
- the immunomodulatory composition comprises two or more different membrane bound fusion proteins.
- the immunomodulatory composition comprises a first immunomodulatory protein comprising IL-15 and a second immunomodulatory fusion protein comprising IL-21.
- the TILs are gene-edited to express the immunomodulatory composition under the control of an NFAT promoter.
- the TILs are gene-edited to express an immunomodulatory fusion protein comprising IL-15 under the control of an NFAT promoter.
- the TILs are gene-edited to express an immunomodulatory fusion protein comprising IL-21 under the control of an NFAT promoter.
- the TILs are gene-edited to express a first immunomodulatory fusion protein comprising IL-15 and a second immunomodulatory fusion protein comprising IL-21 under the control of an NFAT promoter.
- alternative embodiments of the expansion process may differ from the method shown above; e.g., alternative embodiments may not have the same steps (a)-(g), or may have a different number of steps.
- the gene-editing process may be carried out at any time during the TIL expansion method.
- alternative embodiments may include more than two expansions, and it is possible that gene-editing may be conducted on the TILs during a third or fourth expansion, etc.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2, and optionally OKT-3 (e.g., OKT-3 may be present in the culture medium beginning on the start date of the expansion process), to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- nucleic acids for transient phenotypic alteration are delivered to the TILs using a microfluidic platform.
- the microfluidic platform is a SQZ vector- free microfluidic platform.
- TILs are collected during the expansion method (e.g., the expansion method is “paused” for at least a portion of the TILs), and the collected TILs are subjected to a transient modification process, and, in some cases, subsequently reintroduced back into the expansion method (e.g., back into the culture medium) to continue the expansion process, so that at least a portion of the therapeutic population of TILs that are eventually transferred to the infusion bag are transiently altered to express: i) an immunomodulatory composition comprising an immunomodulatory agent (e.g., a membrane anchored immunomodulatory fusion protein described herein) on the surface of the TIL cells, and/or ii) an RNA molecule (e.g., an shRNA) for suppressing expression of an endogenous gene in the TIL cells.
- an immunomodulatory composition comprising an immunomodulatory agent (e.g., a membrane anchored immunomodulatory fusion protein described herein) on the surface of the TIL cells, and/or i
- the transient cellular modification process may be carried out before expansion by activating TILs, performing a transient phenotypic alteration step on the activated TILs, and expanding the modified TILs according to the processes described herein.
- alternative embodiments of the expansion process may differ from the method shown above; e.g., alternative embodiments may not have the same steps (a)-(g), or may have a different number of steps.
- the transient cellular modification process may be carried out at any time during the TIL expansion method.
- alternative embodiments may include more than two expansions, and it is possible that transient cellular modification process may be conducted on the TILs during a third or fourth expansion, etc.
- the gene-editing process is carried out on TILs from one or more of the first population, the second population, and the third population.
- gene-editing may be carried out on the first population of TILs, or on a portion of TILs collected from the first population, and following the gene-editing process those TILs may subsequently be placed back into the expansion process (e.g., back into the culture medium).
- gene-editing may be carried out on TILs from the second or third population, or on a portion of TILs collected from the second or third population, respectively, and following the gene-editing process those TILs may subsequently be placed back into the expansion process (e.g., back into the culture medium).
- gene-editing is performed while the TILs are still in the culture medium and while the expansion is being carried out, i.e., they are not necessarily “removed” from the expansion in order to conduct gene-editing.
- the transient cellular modification process is carried out on TILs from one or more of the first population, the second population, and the third population.
- transient cellular modification may be carried out on the first population of TILs, or on a portion of TILs collected from the first population, and following the gene-editing process those transiently modified TILs may subsequently be placed back into the expansion process (e.g., back into the culture medium).
- transient cellular modification may be carried out on TILs from the second or third population, or on a portion of TILs collected from the second or third population, respectively, and following the transient cellular modification process those modified TILs may subsequently be placed back into the expansion process (e.g., back into the culture medium).
- transient cellular modification is performed while the TILs are still in the culture medium and while the expansion is being carried out, i.e., they are not necessarily “removed” from the expansion in order to effect transient cellular modification.
- the gene-editing process is carried out on TILs from the first expansion, or TILs from the second expansion, or both.
- the transient cellular modification process is carried out on TILs from the first expansion, or TILs from the second expansion, or both.
- transient cellular modification may be carried out on TILs that are collected from the culture medium, and following the transient cellular modification process those modified TILs may subsequently be placed back into the expansion method, e.g., by reintroducing them back into the culture medium.
- the gene-editing process is carried out on at least a portion of the TILs after the first expansion and before the second expansion.
- gene-editing may be carried out on TILs that are collected from the culture medium, and following the gene-editing process those TILs may subsequently be placed back into the expansion method, e.g., by reintroducing them back into the culture medium for the second expansion.
- the transient cellular modification process is carried out on at least a portion of the TILs after the first expansion and before the second expansion.
- transient cellular modification may be carried out on TILs that are collected from the culture medium, and following the transient cellular modification process those modified TILs may subsequently be placed back into the expansion method, e.g., by reintroducing them back into the culture medium for the second expansion.
- the gene-editing process is carried out before step (c) (e.g., before, during, or after any of steps (a)-(b)), before step (d) (e.g., before, during, or after any of steps (a)-(c)), before step (e) (e.g., before, during, or after any of steps (a)-(d)), or before step (f) (e.g., before, during, or after any of steps (a)-(e)).
- step (c) e.g., before, during, or after any of steps (a)-(b)
- step (d) e.g., before, during, or after any of steps (a)-(c)
- step (e) e.g., before, during, or after any of steps (a)-(d)
- step (f) e.g., before, during, or after any of steps (a)-(e)
- the transient cellular modification process is carried out before step (c) (e.g., before, during, or after any of steps (a)-(b)), before step (d) (e.g., before, during, or after any of steps (a)-(c)), before step (e) (e.g., before, during, or after any of steps (a)-(d)), or before step (f) (e.g., before, during, or after any of steps (a)-(e)).
- step (c) e.g., before, during, or after any of steps (a)-(b)
- step (d) e.g., before, during, or after any of steps (a)-(c)
- step (e) e.g., before, during, or after any of steps (a)-(d)
- step (f) e.g., before, during, or after any of steps (a)-(e)
- the cell culture medium may comprise OKT-3 beginning on the start day (Day 0), or on Day 1 of the first expansion, such that the gene-editing or transient cellular modification is carried out on TILs after they have been exposed to OKT-3 in the cell culture medium on Day 0 and/or Day 1.
- the cell culture medium comprises OKT-3 during the first expansion and/or during the second expansion, and the gene-editing or transient cellular modification is carried out before the OKT-3 is introduced into the cell culture medium.
- the cell culture medium may comprise OKT-3 during the first expansion and/or during the second expansion, and the gene-editing or transient cellular modification is carried out after the OKT-3 is introduced into the cell culture medium.
- the cell culture medium may comprise a 4-1BB agonist beginning on the start day (Day 0), or on Day 1 of the first expansion, such that the gene-editing or transient cellular modification is carried out on TILs after they have been exposed to a 4-1BB agonist in the cell culture medium on Day 0 and/or Day 1.
- the cell culture medium comprises a 4-1BB agonist during the first expansion and/or during the second expansion, and the gene-editing or transient cellular modification is carried out before the 4-1BB agonist is introduced into the cell culture medium.
- the cell culture medium may comprise a 4-1BB agonist during the first expansion and/or during the second expansion, and the gene-editing or transient cellular modification is carried out after the 4- 1BB agonist is introduced into the cell culture medium.
- the cell culture medium may comprise IL-2 beginning on the start day (Day 0), or on Day 1 of the first expansion, such that the gene-editing or transient cellular modification is carried out on TILs after they have been exposed to IL-2 in the cell culture medium on Day 0 and/or Day 1.
- the cell culture medium comprises IL-2 during the first expansion and/or during the second expansion, and the gene-editing or transient cellular modification is carried out before the IL-2 is introduced into the cell culture medium.
- the cell culture medium may comprise IL-2 during the first expansion and/or during the second expansion, and the gene-editing or transient cellular modification is carried out after the IL-2 is introduced into the cell culture medium.
- one or more of OKT-3, 4-1BB agonist and IL-2 may be included in the cell culture medium beginning on Day 0 or Day 1 of the first expansion.
- OKT-3 is included in the cell culture medium beginning on Day 0 or Day 1 of the first expansion
- a 4-1BB agonist is included in the cell culture medium beginning on Day 0 or Day 1 of the first expansion
- IL-2 is included in the cell culture medium beginning on Day 0 or Day 1 of the first expansion.
- the cell culture medium comprises OKT-3 and a 4-1BB agonist beginning on Day 0 or Day 1 of the first expansion.
- the cell culture medium comprises OKT-3, a 4-1BB agonist and IL-2 beginning on Day 0 or Day 1 of the first expansion.
- OKT-3, 4-1BB agonist and IL-2 may be added to the cell culture medium at one or more additional time points during the expansion process, as set forth in various embodiments described herein.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas- permeable surface area; (d) activating the second population of TILs by adding OKT-3 and culturing for about 1 to 2 days, wherein the transition from step (c) to step (d) occurs without opening the system; (e) gene-editing at least a portion of the TIL cells in the second population of TILs to express: i) an immunomodulatory composition comprising an immunomodulatory composition comprising an immunomodulatory
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- the TILs are rested after the gene-editing step and before the second expansion step. In some embodiments, the TILs are rested for about 1 to 2 days after the gene-editing step and before the second expansion step. In some embodiments, the TILs are activated by exposure to an anti-CD3 agonist and an anti-CD28 agonist for about 2 days. In some embodiments, the anti-CD3 agonist is an anti-CD3 agonist antibody and the anti-CD28 agonist is an anti-CD28 agonist antibody. In some embodiments, the anti-CD3 agonist antibody is OKT-3. In some embodiments, the TILs are activated by exposure to anti-CD3 agonist antibody- and anti-CD28 agonist antibody-conjugated beads.
- the anti-CD3 agonist antibody- and anti-CD28 agonist antibody-conjugated beads are the TransAct TM product of Miltenyi.
- the gene-editing process is carried out by viral transduction. In some embodiments, the gene-editing process is carried out by retroviral transduction of the TILs, optionally for about 2 days. In some embodiments, the gene-editing process is carried out by lentiviral transduction of the TILs, optionally for about 2 days.
- the immunomodulatory composition is a membrane anchored immunomodulatory fusion protein. In some embodiments, the immunomodulatory fusion protein comprises IL-15. In some embodiments, the immunomodulatory fusion protein comprises IL-21.
- the immunomodulatory composition comprises two or more different membrane bound fusion proteins.
- the immunomodulatory composition comprises a first immunomodulatory protein comprising IL- 15 and a second immunomodulatory fusion protein comprising IL-21.
- the TILs are gene-edited to express the immunomodulatory composition under the control of an NFAT promoter.
- the TILs are gene-edited to express an immunomodulatory fusion protein comprising IL-15 under the control of an NFAT promoter.
- the TILs are gene-edited to express an immunomodulatory fusion protein comprising IL-21 under the control of an NFAT promoter.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days, wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the second population of TILs to effect transfer of
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days, wherein the transition from step (c) to step (d) occurs without opening the system; (e) temporarily disrupting the cell membranes of the second population of TILs to effect transfer
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days, wherein the transition from step (c) to step (d) occurs without opening the system; (e) temporarily disrupting the cell membranes of the second population of TILs to effect transfer
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) sterile electroporating the third population of TILs to effect transfer of at least one gene editor into a portion of cells of the third population of TILs to produce a fourth
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- TILs expanded tumor infiltrating lymphocytes
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) gene-editing at least a portion of the TIL cells in the second population of TILs to express: i) an immunomodulatory composition comprising an immunomodulatory agent (e.g., a membrane anchored immunomodulatory fusion protein described herein) on the surface of the TIL cells, and/or ii) an RNA molecule (e.g., an shRNA) for suppressing expression of an immunomodulatory agent
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD- 1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- the TILs are rested after the gene-editing step and before the second expansion step. In some embodiments, the TILs are rested for about 1 to 2 days after the gene-editing step and before the second expansion step. In some embodiments, the TILs are activated by exposure to an anti-CD3 agonist and an anti-CD28 agonist for about 2 days. In some embodiments, the anti-CD3 agonist is an anti-CD3 agonist antibody and the anti-CD28 agonist is an anti-CD28 agonist antibody. In some embodiments, the anti-CD3 agonist antibody is OKT-3. In some embodiments, the TILs are activated by exposure to anti-CD3 agonist antibody- and anti-CD28 agonist antibody-conjugated beads.
- the anti-CD3 agonist antibody- and anti-CD28 agonist antibody- conjugated beads are the TransAct TM product of Miltenyi.
- the gene- editing process is carried out by viral transduction. In some embodiments, the gene-editing process is carried out by retroviral transduction of the TILs, optionally for about 2 days. In some embodiments, the gene-editing process is carried out by lentiviral transduction of the TILs, optionally for about 2 days.
- the immunomodulatory composition is a membrane anchored immunomodulatory fusion protein. In some embodiments, the immunomodulatory fusion protein comprises IL-15. In some embodiments, the immunomodulatory fusion protein comprises IL-21.
- the immunomodulatory composition comprises two or more different membrane bound fusion proteins.
- the immunomodulatory composition comprises a first immunomodulatory protein comprising IL-15 and a second immunomodulatory fusion protein comprising IL-21.
- the TILs are gene-edited to express the immunomodulatory composition under the control of an NFAT promoter.
- the TILs are gene-edited to express an immunomodulatory fusion protein comprising IL-15 under the control of an NFAT promoter.
- the TILs are gene-edited to express an immunomodulatory fusion protein comprising IL-21 under the control of an NFAT promoter.
- the TILs are gene-edited to express a first immunomodulatory fusion protein comprising IL-15 and a second immunomodulatory fusion protein comprising IL-21 under the control of an NFAT promoter.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) sterile electroporating the third population of TILs to effect transfer of at least one nucleic acid molecule into a portion of cells of the third population of TILs
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (d) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (e) gene-editing at least a portion of the TIL cells in the second population of TILs to express: i) an immunomodulatory composition comprising an immuno
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD- 1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- the TILs are rested after the gene-editing step and before the second expansion step. In some embodiments, the TILs are rested for about 1 to 2 days after the gene-editing step and before the second expansion step. In some embodiments, the TILs are activated by exposure to an anti-CD3 agonist and an anti-CD28 agonist for about 2 days. In some embodiments, the anti-CD3 agonist is an anti-CD3 agonist antibody and the anti-CD28 agonist is an anti-CD28 agonist antibody. In some embodiments, the anti-CD3 agonist antibody is OKT-3. In some embodiments, the TILs are activated by exposure to anti-CD3 agonist antibody- and anti-CD28 agonist antibody-conjugated beads.
- the anti-CD3 agonist antibody- and anti-CD28 agonist antibody- conjugated beads are the TransAct TM product of Miltenyi.
- the gene- editing process is carried out by viral transduction. In some embodiments, the gene-editing process is carried out by retroviral transduction of the TILs, optionally for about 2 days. In some embodiments, the gene-editing process is carried out by lentiviral transduction of the TILs, optionally for about 2 days.
- the immunomodulatory composition is a membrane anchored immunomodulatory fusion protein. In some embodiments, the immunomodulatory fusion protein comprises IL-15. In some embodiments, the immunomodulatory fusion protein comprises IL-21.
- the immunomodulatory composition comprises two or more different membrane bound fusion proteins.
- the immunomodulatory composition comprises a first immunomodulatory protein comprising IL-15 and a second immunomodulatory fusion protein comprising IL-21.
- the TILs are gene-edited to express the immunomodulatory composition under the control of an NFAT promoter.
- the TILs are gene-edited to express an immunomodulatory fusion protein comprising IL-15 under the control of an NFAT promoter.
- the TILs are gene-edited to express an immunomodulatory fusion protein comprising IL-21 under the control of an NFAT promoter.
- the TILs are gene-edited to express a first immunomodulatory fusion protein comprising IL-15 and a second immunomodulatory fusion protein comprising IL-21 under the control of an NFAT promoter.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (d) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (e) sterile electroporating the third population of TILs to effect transfer of at least one gene
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (d) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (e) sterile electroporating the third population of TILs to effect transfer of at least one nucleic acid molecule into a portion of cells
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD- 1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- TILs expanded tumor infiltrating lymphocytes
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) temporarily disrupting the cell membranes of the third population of TILs to effect transfer of at least one gene editor into a portion of cells of the third population of TILs to produce a fourth population of TILs; and (e) culturing the fourth population of TILs in a second cell culture medium comprising antigen presenting cells (APCs), OKT-3, and IL-2 for about 5-15 days, to
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) temporarily disrupting the cell membranes of the third population of TILs to effect transfer of at least one nucleic acid molecule into a portion of cells of the third population of TILs
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- TILs expanded tumor infiltrating lymphocytes
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (d) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (e) temporarily disrupting the cell membranes of the third population of TILs to effect transfer of at least one gene editor into a portion of cells of the third population of TILs to produce a fourth population of TILs; and (f) culturing the fourth population of TILs in a second cell culture medium comprising antigen presenting cells (AP).
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- any of the foregoing methods is modified such that the step of culturing the fourth population of TILs is replaced with the steps of: (f) culturing the fourth population of TILs in a second cell culture medium comprising antigen presenting cells (APCs), OKT-3, and IL-2 for about 1-7 days, to produce a culture of a fifth population of TILs; and (g) splitting the culture of the fifth population of TILs into a plurality of subcultures, culturing each of the plurality of subcultures in a third cell culture medium comprising IL-2 for about 3-7 days, and combining the plurality of subcultures to provide an expanded number of TILs.
- APCs antigen presenting cells
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days or 7 days. [00765] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 2-7 days. [00766] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 3-7 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 4-7 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 5-7 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 6-7 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 1-6 days. [00771] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 1-5 days. [00772] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 1-4 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 1-3 days. [00774] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 1-2 days. [00775] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 2-6 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 3-6 days. [00777] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 4-6 days. [00778] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 5-6 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 3-5 days. [00780] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 3-4 days. [00781] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 2-5 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 2-4 days. [00783] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 2-3 days. [00784] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 4-5 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 1 day. [00786] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 2 days. [00787] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 3 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 4 days. [00789] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 5 days. [00790] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 6 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of activating the second population of TILs is performed for about 7 days.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 and OKT-3 for about 3-9 days to produce a second population of TILs; (c) sterile electroporating the second population of TILs to effect transfer of at least one gene editor into a portion of cells of the second population of TILs to produce a third population of TILs; and (d) culturing the third population of TILs in a second cell culture medium comprising antigen presenting cells (APCs), OKT-3,
- APCs antigen presenting cells
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- TILs expanded tumor infiltrating lymphocytes
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 and OKT-3 for about 3-9 days to produce a second population of TILs; (c) sterile electroporating the second population of TILs to effect transfer of at least one nucleic acid molecule into a portion of cells of the second population of TILs to produce a third population of TILs; and (d) culturing the third population of TILs in a second cell culture medium comprising antigen presenting cells (APCs), OKT-3, and IL-2 for about 5-15 days, to produce an expanded number of TILs, [00795] wherein the sterile electroporation of the at least one nucleic acid
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- TILs expanded tumor infiltrating lymphocytes
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 and OKT-3 for about 3-9 days to produce a second population of TILs; (d) sterile electroporating the second population of TILs to effect transfer of at least one gene editor into a portion of cells of the second population of TILs to produce a third population of TILs; and (e) culturing the third population of TILs in a second cell culture medium comprising antigen presenting cells (APCs), OKT-3, and IL-2 for about 5-15 days, to produce an expanded number of TILs, [00797] wherein the ster
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- a membrane anchor e.g., a membrane anchored immunomodulatory fusion protein described herein.
- the cytokine is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the cytokine is selected from the group consisting of IL-2, IL-12, IL-15, IL-18 and IL-21.
- the cytokine is selected from the group consisting of IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the endogenous gene encodes an immune checkpoint.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- TILs expanded tumor infiltrating lymphocytes
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 and OKT-3 for about 3-9 days to produce a second population of TILs; (d) sterile electroporating the second population of TILs to effect transfer of at least one nucleic acid molecule into a portion of cells of the second population of TILs to produce a third population of TILs; and (e) culturing the third population of TILs in a second cell culture medium comprising antigen presenting cells (APCs), OKT-3, and IL-2 for about 5-15 days, to produce an expanded number of TILs, [00799] where
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- TILs expanded tumor infiltrating lymphocytes
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 and OKT-3 for about 3-9 days to produce a second population of TILs; (c) temporarily disrupting the cell membranes of the second population of TILs to effect transfer of at least one gene editor into a portion of cells of the second population of TILs to produce a third population of TILs; and (d) culturing the third population of TILs in a second cell culture medium comprising antigen presenting cells (APCs), OKT-3, and IL-2 for about 5-15 days, to produce an expanded number of TILs, [00801] wherein the transfer of the at least one gene editor into the portion of cells of the second population of TILs
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 and OKT-3 for about 3-9 days to produce a second population of TILs; (c) temporarily disrupting the cell membranes of the second population of TILs to effect transfer of at least one nucleic acid molecule into a portion of cells of the second population of TILs to produce a third population of TILs; and (d) culturing the third population of TILs in a second cell culture medium comprising antigen
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 and OKT-3 for about 3-9 days to produce a second population of TILs; (d) temporarily disrupting the cell membranes of the second population of TILs to effect transfer of at least one gene editor into a portion of cells of the second population of TILs to produce a third population of TILs; and (e) culturing the third population
- TILs expanded tumor infiltrating lymphocytes
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA- 4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 and OKT-3 for about 3-9 days to produce a second population of TILs; (d) temporarily disrupting the cell membranes of the second population of TILs to effect transfer of at least one nucleic acid molecule into a portion of cells of the second population of TILs to produce a third population of TILs; and (e) cult
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL- 18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the step of culturing the third population of TILs is performed by culturing the third population of TILs in the second cell culture medium for a first period of about 1-7 days, at the end of the first period the culture is split into a plurality of subcultures, each of the plurality of subcultures is cultured in a third culture medium comprising IL-2 for a second period of about 3-7 days, and at the end of the second period the plurality of subcultures are combined to provide the expanded number of TILs.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days or 11 days. [00810] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 4-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 5-11 days. [00812] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 6-11 days. [00813] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 7-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 8-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 9-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 10-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 4-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 5-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 6-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 7-10 days. [00821] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 8-10 days. [00822] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 9-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 4-9 days. [00824] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 5-9 days. [00825] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 6-9 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 7-9 days. [00827] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 8-9 days. [00828] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 3-8 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 3-7 days. [00830] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 3-6 days. [00831] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 3-5 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 3-4 days. [00833] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 4-8 days. [00834] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 4-7 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 4-6 days. [00836] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 4-6 days. [00837] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 5-8 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 5-7 days. [00839] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 5-6 days. [00840] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 6-8 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 6-7 days. [00842] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 7-8 days. [00843] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 4-5 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 3 days. [00845] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 4 days. [00846] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 5 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 6 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 7 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 8 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 9 days. [00851] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 10 days. [00852] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs in the first cell culture medium is performed for about 11 days.
- TILs expanded tumor infiltrating lymphocytes
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3 days to produce a second population of TILs; (c) culturing the second population of TILs in a second cell culture medium comprising IL-2 and OKT-3 for 2-4 days to produce a third population of TILs; (d) ) sterile electroporating the third population of TILs to effect transfer of at least one gene editor into a portion of cells of the third population of TILs to produce a fourth population of TILs; and (e) culturing the fourth population of TILs in a third cell culture medium comprising antigen presenting cells (APCs), OKT-3, and IL-2 for about 5
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL- 18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof.
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- TILs expanded tumor infiltrating lymphocytes
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3 days to produce a second population of TILs; (c) culturing the second population of TILs in a second cell culture medium comprising IL-2 and OKT-3 for 2-4 days to produce a third population of TILs; (d) ) sterile electroporating the third population of TILs to effect transfer of at least one nucleic acid molecule into a portion of cells of the third population of TILs to produce a fourth population of TILs; and (e) culturing the fourth population of TILs in a third cell culture medium comprising antigen presenting cells (APCs), OKT-3, and IL
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3 days to produce a second population of TILs; (d) culturing the second population of TILs in a second cell culture medium comprising IL-2 and OKT-3 for 2-4 days to produce a third population of TILs; (e) sterile electroporating the third population of TILs to effect transfer of at least one gene editor into a portion of cells of the third population of TILs to produce a fourth population of TILs; and (f) culturing the fourth population of TILs in a third cell culture medium comprising antigen presenting
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3 days to produce a second population of TILs; (d) culturing the second population of TILs in a second cell culture medium comprising IL-2 and OKT-3 for 2-4 days to produce a third population of TILs; (e) sterile electroporating the third population of TILs to effect transfer of at least one nucleic acid molecule into a portion of cells of the third population of TILs to produce a fourth population of TILs; and (f) culturing the fourth population of TILs in a third cell culture medium comprising
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- TILs expanded tumor infiltrating lymphocytes
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3 days to produce a second population of TILs; (c) culturing the second population of TILs in a second cell culture medium comprising IL-2 and OKT-3 for 2-4 days to produce a third population of TILs; (d) ) temporarily disrupting the cell membranes of the third population of TILs to effect transfer of at least one gene editor into a portion of cells of the third population of TILs to produce a fourth population of TILs; and (e) culturing the fourth population of TILs in a third cell culture medium comprising antigen presenting cells (APCs), OKT-3, and IL-2 for about
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3 days to produce a second population of TILs; (c) culturing the second population of TILs in a second cell culture medium comprising IL-2 and OKT-3 for 2-4 days to produce a third population of TILs; (d) ) temporarily disrupting the cell membranes of the third population of TILs to effect transfer of at least one nucleic acid molecule into a portion of cells of the third
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3 days to produce a second population of TILs; (d) culturing the second population of TILs in a second cell culture medium comprising IL-2 and OKT-3 for 2-4 days to produce a third population of TILs; (e) temporarily disrupting the cell membranes of the third population of TILs to effect transfer of at
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3 days to produce a second population of TILs; (d) culturing the second population of TILs in a second cell culture medium comprising IL-2 and OKT-3 for 2-4 days to produce a third population of TILs; (e) temporarily disrupting the cell membranes of the third population of TILs to effect transfer of at
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist (e.g., CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21 and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist. In some embodiments, the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immune checkpoint is selected from PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof (e.g., two or more of the above immune checkpoints, such as PD-1 and TIGIT, PD-1 and LAG3, PD-1 and TIM3, TIM3 and CTLA-4, etc.).
- the endogenous gene is selected from PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY1A2, GUCY1A3, GUCY
- a microfluidic platform is used to temporarily disrupt the cell membranes of the second population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the step of culturing the fourth population of TILs is performed by culturing the fourth population of TILs in the third cell culture medium for a first period of about 1-7 days, at the end of the first period the culture is split into a plurality of subcultures, each of the plurality of subcultures is cultured in a fourth culture medium comprising IL-2 for a second period of about 3-7 days, and at the end of the second period the plurality of subcultures are combined to provide the expanded number of TILs.
- the first culture medium further comprises anti-CD3 and anti-CD28 beads or antibodies.
- the anti-CD3 and anti-CD28 beads or antibodies comprise the OKT-3 in the first culture medium.
- the second culture medium further comprises anti-CD3 and anti- CD28 beads or antibodies.
- the anti-CD3 and anti-CD28 beads or antibodies comprise the OKT-3 in the second culture medium.
- the foregoing method further comprises cryopreserving the harvested TIL population using a cryopreservation medium.
- the cryopreservation medium is a dimethylsulfoxide-based cryopreservation medium.
- the cryopreservation medium is CS10.
- the invention provides the method described in any preceding paragraph above modified as applicable such that the step of culturing the second population of TILs in the second culture medium is performed for about 2-3 days.
- the invention provides the method described in any preceding paragraph above modified as applicable such that the step of culturing the second population of TILs in the second culture medium is performed for about 3-4 days.
- the invention provides the method described in any preceding paragraph above modified as applicable such that the step of culturing the second population of TILs in the second culture medium is performed for about 2 days. [00878] In some embodiments, the invention provides the method described in any preceding paragraph above modified as applicable such that the step of culturing the second population of TILs in the second culture medium is performed for about 3 days. [00879] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the second population of TILs in the second culture medium is performed for about 4 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs, as applicable, in the second or third cell culture medium, applicable, is performed for about 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days or 15 days. [00881] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 6-15 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 7-15 days. [00883] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 8-15 days. [00884] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 9-15 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 10-15 days. [00886] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 11-15 days. [00887] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 12-15 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 13-15 days. [00889] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 14-15 days. [00890] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 5-14 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 6-14 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 7-14 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 8-14 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 9-14 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 10-14 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 11-14 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 12-14 days. [00898] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 13-14 days. [00899] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 5-13 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 5-12 days. [00901] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 5-11 days. [00902] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 5-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 5-9 days. [00904] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 5-8 days. [00905] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 5-7 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 5-6 days. [00907] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 6-13 days. [00908] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 6-12 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 6-11 days. [00910] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 6-10 days. [00911] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 6-9 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 6-8 days. [00913] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 6-7 days. [00914] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 7-13 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 7-12 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 7-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 7-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 7-9 days. [00919] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 7-8 days. [00920] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 8-13 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 8-12 days. [00922] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 8-11 days. [00923] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 8-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 8-9 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 9-13 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 9-12 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 9-11 days. [00928] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 9-10 days. [00929] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 10-13 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 10-12 days. [00931] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 10-11 days. [00932] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 11-13 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 11-12 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 12-13 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 5 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 6 days. [00937] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 7 days. [00938] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 8 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 9 days. [00940] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 10 days. [00941] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 12 days. [00943] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 13 days. [00944] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 14 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs in the second or third cell culture medium is performed for about 15 days.
- any of the foregoing methods may be used to provide an autologous harvested TIL population for the treatment of a human subject with cancer.
- C. Transient Cellular Modification [00947]
- the expanded TILs of the present invention are further manipulated before, during, or after an expansion step, including during closed, sterile manufacturing processes, each as provided herein, in order to alter protein expression in a transient manner.
- the present invention includes transient cellular modification through nucleotide insertion, such as through ribonucleic acid (RNA) insertion, including insertion of messenger RNA (mRNA), into a population of TILs for promotion of the expression of one or more proteins or inhibition of the expression of one or more proteins, as well as simultaneous combinations of both promotion of one set of proteins with inhibition of another set of proteins.
- nucleotide insertion such as through ribonucleic acid (RNA) insertion, including insertion of messenger RNA (mRNA), into a population of TILs for promotion of the expression of one or more proteins or inhibition of the expression of one or more proteins, as well as simultaneous combinations of both promotion of one set of proteins with inhibition of another set of proteins.
- RNA messenger RNA
- the expanded TILs of the present invention undergo transient alteration of protein expression.
- the transient alteration of protein expression occurs in the bulk TIL population prior to first expansion.
- the transient alteration of protein expression occurs after the first expansion.
- the transient alteration of protein expression occurs in the bulk TIL population prior to second expansion. In some embodiments, the transient alteration of protein expression occurs after the second expansion. [00949] In some embodiments, the transient alteration of protein expression results in transient expression of an immunomodulatory composition.
- the immunomodulatory composition is an immunomodulatory fusion protein. In some embodiments, the immunomodulatory fusion protein comprises a membrane anchor fused to an immunomodulatory agent.
- the immunomodulatory agent is selected from the group consisting of: IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18 and IL-21.
- the immunomodulatory agent is an interleukin selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is an interleukin selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- a CD40 agonist e.g., a CD40L or an agonistic CD40 binding domain.
- embodiments of the present invention provide tumor infiltrating lymphocytes (TILs) that have been transiently modified via transient alteration of protein expression to enhance their therapeutic effect.
- TILs tumor infiltrating lymphocytes
- Embodiments of the present invention embrace transient modification through nucleotide insertion (e.g., RNA) into a population of TILs for expression of an immunomodulatory composition.
- Embodiments of the present invention also provide methods for expanding TILs into a therapeutic population, wherein the methods comprise transient modification of the TILs.
- the methods comprise transient modification of the TILs.
- a method of transiently altering protein expression in a population of TILs includes contacting the TILs with nucleic acid (e.g., mRNA) encoding the immunomodulatory composition and then subjecting the cells to the step of electroporation. Electroporation methods are known in the art and are described, e.g., in Tsong, Biophys. J. 1991, 60, 297-306, and U.S.
- Patent Application Publication No.2014/0227237 A1 the disclosures of each of which are incorporated by reference herein.
- Other electroporation methods known in the art such as those described in U.S. Patent Nos.5,019,034; 5,128,257; 5,137,817; 5,173,158; 5,232,856; 5,273,525; 5,304,120; 5,318,514; 6,010,613 and 6,078,490, the disclosures of which are incorporated by reference herein, may be used.
- the electroporation method is a sterile electroporation method.
- the electroporation method is a pulsed electroporation method.
- the electroporation method is a pulsed electroporation method comprising the steps of treating TILs with pulsed electrical fields to alter, manipulate, or cause defined and controlled, permanent or temporary changes in the TILs, comprising the step of applying a sequence of at least three single, operator-controlled, independently programmed, DC electrical pulses, having field strengths equal to or greater than 100 V/cm, to the TILs, wherein the sequence of at least three DC electrical pulses has one, two, or three of the following characteristics: (1) at least two of the at least three pulses differ from each other in pulse amplitude; (2) at least two of the at least three pulses differ from each other in pulse width; and (3) a first pulse interval for a first set of two of the at least three pulses is different from a second pulse interval for a second set of two of the at least three pulses.
- the electroporation method is a pulsed electroporation method comprising the steps of treating TILs with pulsed electrical fields to alter, manipulate, or cause defined and controlled, permanent or temporary changes in the TILs, comprising the step of applying a sequence of at least three single, operator-controlled, independently programmed, DC electrical pulses, having field strengths equal to or greater than 100 V/cm, to the TILs, wherein at least two of the at least three pulses differ from each other in pulse amplitude.
- the electroporation method is a pulsed electroporation method comprising the steps of treating TILs with pulsed electrical fields to alter, manipulate, or cause defined and controlled, permanent or temporary changes in the TILs, comprising the step of applying a sequence of at least three single, operator-controlled, independently programmed, DC electrical pulses, having field strengths equal to or greater than 100 V/cm, to the TILs, wherein at least two of the at least three pulses differ from each other in pulse width.
- the electroporation method is a pulsed electroporation method comprising the steps of treating TILs with pulsed electrical fields to alter, manipulate, or cause defined and controlled, permanent or temporary changes in the TILs, comprising the step of applying a sequence of at least three single, operator-controlled, independently programmed, DC electrical pulses, having field strengths equal to or greater than 100 V/cm, to the TILs, wherein a first pulse interval for a first set of two of the at least three pulses is different from a second pulse interval for a second set of two of the at least three pulses.
- the electroporation method is a pulsed electroporation method comprising the steps of treating TILs with pulsed electrical fields to induce pore formation in the TILs, comprising the step of applying a sequence of at least three DC electrical pulses, having field strengths equal to or greater than 100 V/cm, to TILs, wherein the sequence of at least three DC electrical pulses has one, two, or three of the following characteristics: (1) at least two of the at least three pulses differ from each other in pulse amplitude; (2) at least two of the at least three pulses differ from each other in pulse width; and (3) a first pulse interval for a first set of two of the at least three pulses is different from a second pulse interval for a second set of two of the at least three pulses, such that induced pores are sustained for a relatively long period of time, and such that viability of the TILs is maintained.
- a method of transiently altering protein expression in population of TILs includes the step of calcium phosphate transfection.
- Calcium phosphate transfection methods (calcium phosphate nucleic acid precipitation, cell surface coating, and endocytosis) are known in the art and are described in Graham and van der Eb, Virology 1973, 52, 456-467; Wigler, et al., Proc. Natl. Acad. Sci.1979, 76, 1373-1376; and Chen and Okayarea, Mol. Cell. Biol.1987, 7, 2745-2752; and in U.S. Patent No.5,593,875, the disclosures of each of which are incorporated by reference herein.
- a method of transiently altering protein expression in a population of TILs includes the step of liposomal transfection.
- Liposomal transfection methods such as methods that employ a 1:1 (w/w) liposome formulation of the cationic lipid N-[1-(2,3-dioleyloxy)propyl]-n,n,n- trimethylammonium chloride (DOTMA) and dioleoyl phophotidylethanolamine (DOPE) in filtered water, are known in the art and are described in Rose, et al., Biotechniques 1991, 10, 520-525 and Felgner, et al., Proc. Natl. Acad. Sci.
- DOTMA dioleoyl phophotidylethanolamine
- a method of transiently altering protein expression in a population of TILs includes the step of transfection using methods described in U.S. Patent Nos.5,766,902; 6,025,337; 6,410,517; 6,475,994; and 7,189,705; the disclosures of each of which are incorporated by reference herein.
- the TILs may be a first population, a second population and/or a third population of TILs as described herein.
- a SQZ vector-free microfluidic platform is used for transiently altering protein expression. See, e.g., International Patent Application Publication Nos. WO 2013/059343A1, WO 2017/008063A1, or WO 2017/123663A1, or U.S. Patent Application Publication Nos. US 2014/0287509A1, US 2018/0201889A1, or US 2018/0245089A1, all of which are incorporated by reference herein in their entireties, and particularly for disclosures of microfluidic platforms for nucleic acid delivery.
- the cell membranes of the TILs for modification are temporarily disrupted by microfluidic constriction, thereby allowing the delivery of nucleic acids encoding the transiently expressed protein.
- the TILs may be a first population, a second population and/or a third population of TILs as described herein.
- a transposon/transposase system is used for transiently altering protein expression.
- the transposon/transposase system comprises a piggyBac transposons and transposases or piggyBac-like transposons and transposases; a sleeping beauty (SB) transposon and transposase; or a Helraiser transposon and transposase.
- a TIL population is gene-edited to express one or more immunomodulatory compositions at the cell surface of TIL cells in the TIL population and to genetically modify one or more immune checkpoint genes in the TIL population.
- a DNA sequence within the TIL that encodes one or more of the TIL’s immune checkpoints is permanently modified, e.g., inserted, deleted or replaced, in the TIL’s genome, or transiently modified.
- Immune checkpoints are molecules expressed by lymphocytes that regulate an immune response via inhibitory or stimulatory pathways. In the case of cancer, immune checkpoint pathways are often activated to inhibit the anti-tumor response, i.e., the expression of certain immune checkpoints by malignant cells inhibits the anti-tumor immunity and favors the growth of cancer cells.
- TILs are gene-edited to block or stimulate certain immune checkpoint pathways and thereby enhance the body’s immunological activity against tumors.
- an immune checkpoint gene comprises a DNA sequence encoding an immune checkpoint molecule.
- gene-editing TILs during the TIL expansion method causes expression of one or more immune checkpoint genes to be silenced or reduced in at least a portion of the therapeutic population of TILs.
- gene-editing may cause the expression of an inhibitory receptor, such as PD-1 or CTLA-4, to be silenced or reduced in order to enhance an immune reaction.
- an inhibitory receptor such as PD-1 or CTLA-4
- the most broadly studied checkpoints include programmed cell death receptor-1 (PD-1) and cytotoxic T lymphocyte-associated molecule-4 (CTLA-4), which are inhibitory receptors on immune cells that inhibit key effector functions (e.g., activation, proliferation, cytokine release, cytotoxicity, etc.) when they interact with an inhibitory ligand.
- PD-1 programmed cell death receptor-1
- CTLA-4 cytotoxic T lymphocyte-associated molecule-4
- Numerous checkpoint molecules, in addition to PD-1 and CTLA-4, have emerged as potential targets for immunotherapy, as discussed in more detail below.
- Non-limiting examples of immune checkpoint genes that may be silenced or inhibited by permanently gene-editing TILs of the present invention include PD-1, CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, TET2, BAFF (BR3), CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, GUCY
- immune checkpoint genes that may be silenced or inhibited in TILs of the present invention may be selected from the group comprising PD-1, CTLA-4, LAG-3, TIM-3, Cish, CBL-B, TIGIT, TET2, TGF ⁇ , and PKA.
- BAFF BAFF
- immune checkpoint genes that may be silenced or inhibited in TILs of the present invention may be selected from the group comprising PD-1, LAG-3, TIM-3, CTLA-4, TIGIT, TET2, CISH, TGF ⁇ R2, PRA, CBLB, BAFF (BR3), and combinations thereof.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days, wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the second population of TILs to effect transfer of
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- PD-1 programmed death receptor
- PD1 or PD-1 also known as PDCD1
- PD-L1 and PD-L2 are expressed on a variety of tumor cells, including melanoma.
- the interaction of PD-1 with PD-L1 inhibits T-cell effector function, results in T-cell exhaustion in the setting of chronic stimulation, and induces T-cell apoptosis in the tumor microenvironment.
- PD1 may also play a role in tumor- specific escape from immune surveillance.
- expression of PD1 in TILs is silenced or reduced in accordance with compositions and methods of the present invention.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene-editing at least a portion of the TILs by silencing or repressing the expression of PD1.
- the gene-editing process may involve the use of a programmable nuclease that mediates the generation of a double-strand or single-strand break at an immune checkpoint gene, such as PD1.
- a CRISPR method for example, a CRISPR method, a TALE method, an RNA interference method (e.g., shRNA), a Cas-CLOVER method, or a zinc finger method may be used to silence or reduce the expression of PD1 in the TILs.
- CTLA-4 [00962] CTLA-4 expression is induced upon T-cell activation on activated T-cells, and competes for binding with the antigen presenting cell activating antigens CD80 and CD86. Interaction of CTLA-4 with CD80 or CD86 causes T-cell inhibition and serves to maintain balance of the immune response. However, inhibition of the CTLA-4 interaction with CD80 or CD86 may prolong T-cell activation and thus increase the level of immune response to a cancer antigen.
- TILs tumor infiltrating lymphocytes
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene-editing at least a portion of the TILs to express at least one immunomodulatory composition at the cell surface of and silence or repress the expression of CTLA-4 in the TILs.
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double-strand or single-strand break at an immune checkpoint gene, such as CTLA-4.
- a CRISPR method, a TALE method, an RNA interference method (e.g., shRNA), a Cas-CLOVER method, or a zinc finger method may be used to silence or repress the expression of CTLA-4 in the TILs.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- a CD40 agonist e.g., a CD40L or an agonistic CD40 binding domain.
- LAG-3 Lymphocyte activation gene-3 (LAG-3, CD223) is expressed by T cells and natural killer (NK) cells after major histocompatibility complex (MHC) class II ligation. Although its mechanism remains unclear, its modulation causes a negative regulatory effect over T cell function, preventing tissue damage and autoimmunity. LAG-3 and PD-1 are frequently co- expressed and upregulated on TILs, leading to immune exhaustion and tumor growth.
- LAG-3 blockade improves anti-tumor responses. See, e.g., Marin-Acevedo et al., Journal of Hematology & Oncology (2016) 11:39. [00965] According to particular embodiments, expression of LAG-3 in TILs is silenced or reduced in accordance with compositions and methods of the present invention.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene-editing at least a portion of the TILs to express at least one immunomodulatory composition at the cell surface of and silence or repress the expression of LAG-3 in the TILs.
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double-strand or single-strand break at an immune checkpoint gene, such as LAG-3.
- a CRISPR method a TALE method, an RNA interference method (e.g., shRNA), a Cas-CLOVER method, or a zinc finger method may be used to silence or repress the expression of LAG-3 in the TILs.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- TGIT T cell immunoreceptor with Ig and ITIM domains
- NK natural killer cells
- TGIT and PD-1 have been shown to be over-expressed on tumor antigen-specific CD8+ T cells and CD8+ TILs from individuals with melanoma. Blockage of TGIT and PD-1 has lead to increased cell proliferation, cytokine production, and degranulation of TA-specific CD8+ T cells and TIL CD8+ T cells.
- expression of TGIT in TILs is silenced or reduced in accordance with compositions and methods of the present invention.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene-editing at least a portion of the TILs to express at least one immunomodulatory composition at the cell surface of and silence or repress the expression of TGIT the TILs.
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double- strand or single-strand break at an immune checkpoint gene, such as TGIT.
- a CRISPR method a TALE method, an RNA interference method (e.g., shRNA), a Cas-CLOVER method, or a zinc finger method may be used to silence or repress the expression of TGIT in the TILs.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain). 5.
- T cell immunoglobulin-3 (TIM-3) is a direct negative regulator of T cells and is expressed on NK cells and macrophages. TIM-3 indirectly promotes immunosuppression by inducing expansion of myeloid-derived suppressor cells (MDSCs). Its levels have been found to be particularly elevated on dysfunctional and exhausted T-cells, suggesting an important role in malignancy.
- MDSCs myeloid-derived suppressor cells
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene-editing at least a portion of the TILs to express at least one immunomodulatory composition at the cell surface of and silence or repress the expression of TIM-3 in the TILs.
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double-strand or single-strand break at an immune checkpoint gene, such as TIM-3.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- Cish a member of the suppressor of cytokine signaling (SOCS) family, is induced by TCR stimulation in CD8+ T cells and inhibits their functional avidity against tumors. Genetic deletion of Cish in CD8+ T cells may enhance their expansion, functional avidity, and cytokine polyfunctionality, resulting in pronounced and durable regression of established tumors. See, e.g., Palmer et al., Journal of Experimental Medicine, 212 (12): 2095 (2015). [00971] According to particular embodiments, expression of Cish in TILs is silenced or reduced in accordance with compositions and methods of the present invention.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene-editing at least a portion of the TILs to express at least one immunomodulatory composition at the cell surface of and silence or repress the expression of Cish in the TILs.
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double- strand or single-strand break at an immune checkpoint gene, such as Cish.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain). 7.
- TGF ⁇ signaling pathway has multiple functions in regulating cell growth, differentiation, apoptosis, motility and invasion, extracellular matrix production, angiogenesis, and immune response. TGF ⁇ signaling deregulation is frequent in tumors and has crucial roles in tumor initiation, development and metastasis. At the microenvironment level, the TGF ⁇ pathway contributes to generate a favorable microenvironment for tumor growth and metastasis throughout carcinogenesis. See, e.g., Neuzillet et al., Pharmacology & Therapeutics, Vol.147, pp.22-31 (2015). [00973] According to particular embodiments, expression of TGF ⁇ in TILs is silenced or reduced in accordance with compositions and methods of the present invention.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene-editing at least a portion of the TILs to express at least one immunomodulatory composition at the cell surface of and silence or reduce the expression of TGF ⁇ in the TILs.
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double- strand or single-strand break at an immune checkpoint gene, such as TGF ⁇ .
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- TGF ⁇ R2 (TGF beta receptor 2) may be suppressed by silencing TGF ⁇ R2 using a CRISPR/Cas9 system or by using a TGF ⁇ R2 dominant negative extracellular trap, using methods known in the art.
- PKA Protein Kinase A
- cAMP-dependent protein kinase is a multi-unit protein kinase that mediates signal transduction of G-protein coupled receptors through its activation upon cAMP binding.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene-editing at least a portion of the TILs to express at least one immunomodulatory composition at the cell surface of and silence or repress the expression of PKA in the TILs.
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double- strand or single-strand break at an immune checkpoint gene, such as PKA.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- CBLB (or CBL-B) is a E3 ubiquitin-protein ligase and is a negative regulator of T cell activation. Bachmaier, et al., Nature, 2000, 403, 211–216; Wallner, et al., Clin. Dev. Immunol.2012, 692639. According to particular embodiments, expression of CBLB in TILs is silenced or reduced in accordance with compositions and methods of the present invention.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene-editing at least a portion of the TILs to express at least one immunomodulatory composition at the cell surface of and silencing or repressing the expression of CBLB in TILs.
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double- strand or single-strand break at an immune checkpoint gene, such as CBLB.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- CBLB is silenced using a TALEN knockout. In some embodiments, CBLB is silenced using a TALE-KRAB transcriptional inhibitor knock in. More details on these methods can be found in Boettcher and McManus, Mol. Cell Review, 2015, 58, 575-585.
- TIGIT T-cell immunoreceptor with Ig and ITIM (immunoreceptor tyrosine-based inhibitory motif) domain or TIGIT is a transmembrane glycoprotein receptor with an Ig-like V-type domain and an ITIM in its cytoplasmic domain.
- TIGIT is expressed by some T cells and Natural Killer Cells. Additionally, TIGIT has been shown to be overexpressed on antigen-specific CD8+ T cells and CD8+ TILs, particularly from individuals with melanoma. Studies have shown that the TIGIT pathway contributes to tumor immune evasion and TIGIT inhibition has been shown to increase T-cell activation and proliferation in response to polyclonal and antigen-specific stimulation. Khalil, et al., Advances in Cancer Research, 2015, 128, 1-68.
- TIGIT coblockade of TIGIT with either PD-1 or TIM3 has shown synergistic effects against solid tumors in mouse models. Id.; see also Kurtulus, et al., The Journal of Clinical Investigation, 2015, Vol.125, No.11, 4053- 4062. [00979] According to particular embodiments, expression of TIGIT in TILs is silenced or reduced in accordance with compositions and methods of the present invention.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene-editing at least a portion of the TILs to express at least one immunomodulatory composition at the cell surface of and silence or repress the expression of TIGIT in the TILs.
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double- strand or single-strand break at an immune checkpoint gene, such as TIGIT.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- Thymocyte selection associated high mobility group (HMG) box is a transcription factor containing an HMG box DNA binding domain.
- TOX is a member of the HMG box superfamily that is thought to bind DNA in a sequence-independent but structure- dependent manner.
- TOX was identified as a critical regulator of tumor-specific CD8 + T cell dysfunction or T cell exhaustion and was found to transcriptionally and epigenetically program CD8 + T cell exhaustion, as described, for example in Scott, et al., Nature, 2019, 571, 270-274 and Khan, et al., Nature, 2019, 571, 211-218, both of which are herein incorporated by reference in their entireties.
- TOX was also found to be critical factor for progression of T cell dysfunction and maintenance of exhausted T cells during chronic infection, as described in Alfei, et al., Nature, 2019, 571, 265-269, which is herein incorporated by reference in its entirety.
- TOX is highly expressed in dysfunctional or exhausted T cells from tumors and chronic viral infection. Ectopic expression of TOX in effector T cells in vitro induced a transcriptional program associated with T cell exhaustion, whereas deletion of TOX in T cells abrogated the T exhaustion program. [00982] According to particular embodiments, expression of TOX in TILs is silenced or reduced in accordance with compositions and methods of the present invention.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene-editing at least a portion of the TILs to express at least one immunomodulatory composition at the cell surface of and silence or repress the expression of TOX.
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double-strand or single-strand break at an immune checkpoint gene, such as TOX.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- gene-editing TILs during the TIL expansion method causes expression of at least one immunomodulatory composition at the cell surface and causes expression of one or more co-stimulatory receptors, adhesion molecules and/or cytokines to be enhanced in at least a portion of the therapeutic population of TILs.
- gene-editing may cause the expression of a co-stimulatory receptor, adhesion molecule or cytokine to be enhanced, which means that it is overexpressed as compared to the expression of a co-stimulatory receptor, adhesion molecule or cytokine that has not been genetically modified.
- Non-limiting examples of co-stimulatory receptor, adhesion molecule or cytokine genes that may exhibit enhanced expression by permanently gene-editing TILs of the present invention include certain chemokine receptors and interleukins, such as CCR2, CCR4, CCR5, CXCR2, CXCR3, CX3CR1, IL-2, IL-4, IL-7, IL-10, IL-15, IL-18, IL-21, the NOTCH 1/2 intracellular domain (ICD), and/or the NOTCH ligand mDLL1.
- CCRs [00984]
- T cells need to be trafficked properly into tumors by chemokines.
- chemokines secreted by tumor cells is important for successful trafficking of T cells into a tumor bed.
- gene-editing methods of the present invention may be used to increase the expression of certain chemokine receptors in the TILs, such as one or more of CCR2, CCR4, CCR5, CXCR2, CXCR3 and CX3CR1. Over-expression of CCRs may help promote effector function and proliferation of TILs following adoptive transfer.
- TILs tumor infiltrating lymphocytes
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene- editing at least a portion of the TILs to express at least one immunomodulatory composition at the cell surface of and enhance the expression of one or more of CCR2, CCR4, CCR5, CXCR2, CXCR3 and CX3CR1 in the TILs.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double-strand or single-strand break at a chemokine receptor gene.
- CRISPR method a CRISPR method, a TALE method, or a zinc finger method may be used to enhance the expression of certain chemokine receptors in the TILs.
- CCR4 and/or CCR5 adhesion molecules are inserted into a TIL population using a gamma-retroviral or lentiviral method as described herein.
- CXCR2 adhesion molecule are inserted into a TIL population using a gamma- retroviral or lentiviral method as described in Forget, et al., Frontiers Immunology 2017, 8, 908 or Peng, et al., Clin. Cancer Res.2010, 16, 5458, the disclosures of which are incorporated by reference herein.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days to obtain the second population of TILs, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the second population of TILs to effect transfer of
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days to obtain the second population of TILs, wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the second
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- a CD40 agonist e.g., a CD40L or an agonistic CD40 binding domain.
- TIL-2, IL-4, IL-7, IL-10, IL-15, IL-18 and IL-21 in TILs is enhanced in accordance with compositions and methods of the present invention.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A, process Gen 3, or the methods shown in Figures 34 and 35), wherein the method comprises gene-editing at least a portion of the TILs by enhancing the expression of one or more of IL-2, IL-4, IL-7, IL-10, IL-15, IL-18 and IL-21.
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double-strand or single-strand break at an interleukin gene.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days to
- the at least one immunomodulatory composition comprises a cytokine fused to a membrane anchor.
- the cytokine is selected from the group consisting of IL-12, IL-15, IL-18 and IL-21.
- TILs tumor infiltrating lymphocytes
- Embodiments of the present invention embrace genetic editing through nucleotide insertion (RNA or DNA) into a population of TILs for both promotion of the expression of one or more proteins and inhibition of the expression of one or more proteins, as well as combinations thereof.
- Embodiments of the present invention also provide methods for expanding TILs into a therapeutic population, wherein the methods comprise gene-editing the TILs, or wherein the methods comprise transiently gene-editing the TILs to transiently alter protein expression in the modified TILs.
- the methods comprise gene-editing the TILs, or wherein the methods comprise transiently gene-editing the TILs to transiently alter protein expression in the modified TILs.
- There are several gene-editing technologies that may be used to genetically modify a population of TILs including transient gene-editing technologies to transiently alter protein expression in a population of TILs, which are suitable for use in accordance with the present invention.
- a method of genetically modifying a population of TILs includes the step of stable incorporation of genes for production of one or more proteins or nucleic acid (e.g., an immunomodulatory fusion protein and/or an RNA (e.g., an shRNA) for modifying gene expression as described herein).
- a method of genetically modifying a population of TILs includes the step of retroviral transduction.
- a method of genetically modifying a population of TILs includes the step of lentiviral transduction. Lentiviral transduction systems are known in the art and are described, e.g., in Levine, et al., Proc. Nat’l Acad.
- Lentiviral vector for genetically modify the subject TILs can be made using any suitable technique known in the art.
- the lentiviral vector is made using a stable lentiviral producer cell line.
- the stable lentiviral producer cell line is made using transposon/transposase (e.g., piggyBac and Sleeping Beauty systems described herein) to integrate various genes for lentiviral vector production (e.g., VSV-g/ BaEV-TR, gag, and pol genes, gene of interest, etc.) into the producer cell line genome.
- the genes for lentiviral vector production are under the control of inducible expression systems (e.g., Tet-on and Tet-off systems) that allow for inducible production of the lentiviral vectors.
- Exemplary inducible stable producer cell lines for lentiviral production include for example, the EuLV ® (Eureka Bio) system, see, e.g., Xue et al., Cell & Gene Therapy Insights 8(2):199-209 (2022), WO2021218000A1, WO2021232632A1, and WO2021232633A1, which are incorporated by reference in their entireties, particularly for pertinent parts relating to the production of inducible stable producer cell line for lentiviral production.
- a method of genetically modifying a population of TILs includes the step of gamma-retroviral transduction.
- a method of genetically modifying a population of TILs includes the step of transposon-mediated gene transfer.
- Transposon-mediated gene transfer systems are known in the art and include systems wherein the transposase is provided as DNA expression vector or as an expressible RNA or a protein such that long-term expression of the transposase does not occur in the transgenic cells, for example, a transposase provided as an mRNA (e.g., an mRNA comprising a cap and poly-A tail).
- a transposase provided as an mRNA e.g., an mRNA comprising a cap and poly-A tail.
- Suitable transposon-mediated gene transfer systems including the salmonid-type Tel-like transposase (SB or Sleeping Beauty transposase), such as SB10, SB11, and SB100x, and engineered enzymes with increased enzymatic activity, are described in, e.g., Fishett, et al., Mol.
- a method of genetically modifying a population of TILs includes the step of stable incorporation of genes for production or inhibition (e.g., silencing) of one or more proteins.
- a method of genetically modifying such as a method of transient genetic modification by transiently altering protein expression in, a population of TILs includes the step of electroporation. Electroporation methods are known in the art and are described, e.g., in Tsong, Biophys. J.1991, 60, 297-306, and U.S.
- Patent Application Publication No.2014/0227237 A1 the disclosures of each of which are incorporated by reference herein.
- Other electroporation methods known in the art such as those described in U.S. Patent Nos.5,019,034; 5,128,257; 5,137,817; 5,173,158; 5,232,856; 5,273,525; 5,304,120; 5,318,514; 6,010,613 and 6,078,490, the disclosures of which are incorporated by reference herein, may be used.
- the electroporation method is a sterile electroporation method.
- the electroporation method is a pulsed electroporation method.
- the electroporation method is a pulsed electroporation method comprising the steps of treating TILs with pulsed electrical fields to alter, manipulate, or cause defined and controlled, permanent or temporary changes in the TILs, comprising the step of applying a sequence of at least three single, operator-controlled, independently programmed, DC electrical pulses, having field strengths equal to or greater than 100 V/cm, to the TILs, wherein the sequence of at least three DC electrical pulses has one, two, or three of the following characteristics: (1) at least two of the at least three pulses differ from each other in pulse amplitude; (2) at least two of the at least three pulses differ from each other in pulse width; and (3) a first pulse interval for a first set of two of the at least three pulses is different from a second pulse interval for a second set of two of the at least three pulses.
- the electroporation method is a pulsed electroporation method comprising the steps of treating TILs with pulsed electrical fields to alter, manipulate, or cause defined and controlled, permanent or temporary changes in the TILs, comprising the step of applying a sequence of at least three single, operator-controlled, independently programmed, DC electrical pulses, having field strengths equal to or greater than 100 V/cm, to the TILs, wherein at least two of the at least three pulses differ from each other in pulse amplitude.
- the electroporation method is a pulsed electroporation method comprising the steps of treating TILs with pulsed electrical fields to alter, manipulate, or cause defined and controlled, permanent or temporary changes in the TILs, comprising the step of applying a sequence of at least three single, operator-controlled, independently programmed, DC electrical pulses, having field strengths equal to or greater than 100 V/cm, to the TILs, wherein at least two of the at least three pulses differ from each other in pulse width.
- the electroporation method is a pulsed electroporation method comprising the steps of treating TILs with pulsed electrical fields to alter, manipulate, or cause defined and controlled, permanent or temporary changes in the TILs, comprising the step of applying a sequence of at least three single, operator- controlled, independently programmed, DC electrical pulses, having field strengths equal to or greater than 100 V/cm, to the TILs, wherein a first pulse interval for a first set of two of the at least three pulses is different from a second pulse interval for a second set of two of the at least three pulses.
- the electroporation method is a pulsed electroporation method comprising the steps of treating TILs with pulsed electrical fields to induce pore formation in the TILs, comprising the step of applying a sequence of at least three DC electrical pulses, having field strengths equal to or greater than 100 V/cm, to TILs, wherein the sequence of at least three DC electrical pulses has one, two, or three of the following characteristics: (1) at least two of the at least three pulses differ from each other in pulse amplitude; (2) at least two of the at least three pulses differ from each other in pulse width; and (3) a first pulse interval for a first set of two of the at least three pulses is different from a second pulse interval for a second set of two of the at least three pulses, such that induced pores are sustained for a relatively long period of time, and such that viability of the TILs is maintained.
- a method of genetically modifying such as a method of transient genetic modification by transiently altering protein expression in, a population of TILs includes the step of calcium phosphate transfection.
- Calcium phosphate transfection methods (calcium phosphate DNA precipitation, cell surface coating, and endocytosis) are known in the art and are described in Graham and van der Eb, Virology 1973, 52, 456-467; Wigler, et al., Proc. Natl. Acad. Sci.1979, 76, 1373-1376; and Chen and Okayarea, Mol. Cell. Biol.1987, 7, 2745-2752; and in U.S.
- a method of genetically modifying such as a method of transient genetic modification by transiently altering protein expression in, a population of TILs includes the step of liposomal transfection.
- Liposomal transfection methods such as methods that employ a 1:1 (w/w) liposome formulation of the cationic lipid N-[1-(2,3-dioleyloxy)propyl]-n,n,n-trimethylammonium chloride (DOTMA) and dioleoyl phophotidylethanolamine (DOPE) in filtered water, are known in the art and are described in Rose, et al., Biotechniques 1991, 10, 520-525 and Felgner, et al., Proc. Natl. Acad. Sci. USA, 1987, 84, 7413-7417 and in U.S.
- DOTMA cationic lipid N-[1-(2,3-dioleyloxy)propyl]-n,n,n-trimethylammonium chloride
- DOPE dioleoyl phophotidylethanolamine
- a method of genetically modifying such as a method of transient genetic modification by transiently altering protein expression in, a population of TILs includes the step of transfection using methods described in U.S. Patent Nos.5,766,902; 6,025,337; 6,410,517; 6,475,994; and 7,189,705; the disclosures of each of which are incorporated by reference herein.
- the gene-editing process may comprise the use of a programmable nuclease that mediates the generation of a double-strand or single-strand break at one or more immune checkpoint genes.
- programmable nucleases enable precise genome editing by introducing breaks at specific genomic loci, i.e., they rely on the recognition of a specific DNA sequence within the genome to target a nuclease domain to this location and mediate the generation of a double-strand break at the target sequence.
- a double-strand break in the DNA subsequently recruits endogenous repair machinery to the break site to mediate genome editing by either non-homologous end-joining (NHEJ) or homology-directed repair (HDR).
- NHEJ non-homologous end-joining
- HDR homology-directed repair
- the repair of the break can result in the introduction of insertion/deletion mutations that disrupt (e.g., silence, repress, or enhance) the target gene product.
- Major classes of nucleases that have been developed to enable site-specific genomic editing include zinc finger nucleases (ZFNs), transcription activator-like nucleases (TALENs), and CRISPR-associated nucleases (e.g., CRISPR/Cas9).
- Non-limiting examples of gene-editing methods that may be used in accordance with TIL expansion methods of the present invention include CRISPR methods, TALE methods, ZFN methods, Cas-CLOVER methods, shRNA methods, or a combination thereof, embodiments of which are described in more detail below.
- a method for expanding TILs into a therapeutic population may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A) or as described in PCT/US2017/058610, PCT/US2018/012605, or PCT/US2018/012633, wherein the method further comprises gene-editing at least a portion of the TILs by one or more of a CRISPR method, a TALE method, a ZFN method, a Cas-CLOVER method, or an shRNA method, in order to generate TILs that can provide an enhanced therapeutic effect.
- gene-edited TILs can be evaluated for an improved therapeutic effect by comparing them to non-modified TILs in vitro, e.g., by evaluating in vitro effector function, cytokine profiles, etc. compared to unmodified TILs.
- electroporation is used for delivery of a gene editing system, such as CRISPR, TALEN, ZFN, Cas-CLOVER, and shRNA systems.
- the electroporation system is a flow electroporation system.
- An example of a suitable flow electroporation system suitable for use with some embodiments of the present invention is the commercially-available MaxCyte STX system.
- electroporation instruments which may be suitable for use with the present invention, such as the AgilePulse system or ECM 830 available from BTX-Harvard Apparatus, Cellaxess Elektra (Cellectricon), Nucleofector (Lonza/Amaxa), GenePulser MXcell (BIORAD), iPorator-96 (Primax) or siPORTer96 (Ambion).
- the electroporation system forms a closed, sterile system with the remainder of the TIL expansion method.
- the electroporation system is a pulsed electroporation system as described herein, and forms a closed, sterile system with the remainder of the TIL expansion method.
- a microfluidic platform is used for delivery of the gene editing system.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- Transposon/Transposase Delivery Methods [001006] In some embodiments of the present invention, a transposon/transposase system is used for delivery of a gene editing system, such as CRISPR, TALEN, ZFN, Cas-CLOVER, and shRNA systems.
- a method for expanding TILs into a therapeutic population may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A) or as described in PCT/US2017/058610, PCT/US2018/012605, or PCT/US2018/012633, wherein the method further comprises gene-editing at least a portion of the TILs by a transposon/transposase system (e.g., piggyBac transposons and transposases or piggyBac-like transposons and transposases; sleeping beauty (SB) transposon and transposase; Helraiser transposon and transposase, etc.).
- a transposon/transposase system e.g., piggyBac transposons and transposases or piggyBac-like transposons and transposases; sleeping beauty (SB) transposon and transposase; Helraiser transposon and transposase, etc.
- the use of a piggyBac, Sleeping Beauty or Helraiser method during the TIL expansion process causes expression of at least one immunomodulatory composition at the cell surface of at least a portion of the therapeutic population of TILs.
- the use of a piggyBac, Sleeping Beauty or Helraiser method during the TIL expansion process causes expression of at least one immunomodulatory composition at the cell surface of, and optionally causes one or more immune checkpoint genes to be enhanced in, at least a portion of the therapeutic population of TILs.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the use of a piggyBac, Sleeping Beauty or Helraiser method during the TIL expansion process causes reduced expression of a target gene in at least a portion of the therapeutic population of TILs.
- the target gene is an immune checkpoint.
- the piggyBac transposon is a mobile genetic element that efficiently transposes between the donor vector and host chromosomes. This system has almost no cargo limit, and is fully reversible, leaving no footprint in the genome after excision.
- the piggyBac transposon/transposase system consists of a transposase that recognizes piggyBac-specific inverted terminal repeat sequences (ITRs) located on both sides of the transposon cassette.
- the transposase excises the transposable element to integrate it into TT/AA chromosomal sites that are preferentially located in euchromatic regions of mammalian genomes (Ding et al.2005; Cadina ⁇ os and Bradley 2007; Wilson et al.2007; Wang et al.2008; Li et al.2011).
- Exemplary piggyBac systems include those described in WO2019/046815, the contents of which are incorporated herein by reference in their entirety.
- the piggyBac system comprises a transposon/transposase system.
- a piggyBac method comprises delivering to the TILs, (a) a nucleic acid or amino acid sequence comprising a sequence encoding a transposase enzyme and (b) a recombinant and non-naturally occurring DNA sequence comprising a DNA sequence encoding a transposon.
- the sequence encoding a transposase enzyme is an mRNA sequence.
- the sequence encoding a transposase enzyme is a DNA sequence.
- the DNA sequence is a cDNA sequence.
- the sequence encoding a transposase enzyme is an amino acid sequence.
- a protein Super piggybac transposase (SPB) may be delivered following pre-incubation with transposon DNA.
- SPB Super piggybac transposase
- Exemplary transposon/transposase systems include, but are not limited to, piggyBac transposons and transposases, Sleeping Beauty transposons and transposases, Helraiser transposons and transposases and Tol2 transposons and transposases.
- the piggyBac transposase recognizes transposon-specific inverted terminal repeat sequences (ITRs) on the ends of the transposon, and moves the contents between the ITRs into TTAA chromosomal sites.
- ITRs inverted terminal repeat sequences
- the piggyBac transposon system has no payload limit for the genes of interest that can be included between the ITRs.
- the transposon is a piggyBac transposon or a piggyBac-like transposon.
- Examples of piggyBac and piggyBac-like transposases and transposons include, for example, those disclosed in WO2019/046815, the contents of which are incorporated herein by reference in their entirety.
- the piggyBac or piggyBac-like transposase is hyperactive.
- a hyperactive piggyBac or piggyBac-like transposase is a transposase that is more active than the naturally occurring variant from which it is derived.
- the hyperactive piggyBac or piggyBac-like transposase enzyme is isolated or derived from Bombyx mori.
- a list of hyperactive amino acid substitutions can be found in US patent No.10,041,077, the contents of which are incorporated herein by reference in their entirety.
- the piggyBac or piggyBac-like transposase is integration deficient.
- an integration deficient piggyBac or piggyBac-like transposase is a transposase that can excise its corresponding transposon, but that integrates the excised transposon at a lower frequency than a corresponding wild-type transposase.
- a list of integration deficient amino acid substitutions can be found in US patent No.10,041,077, the contents of which are incorporated by reference in their entirety.
- the piggyBac or piggyBac-like transposon is capable of insertion by a piggyBac or piggyBac-like transposase at the sequence 5'-TTAT-3 within a target nucleic acid.
- the transposase is a piggyBac transposase. In some embodiments, and, in particular, embodiments wherein the transposon is a piggyBac- like transposon, the transposase is a piggyBac-like transposase. In some embodiments, and, in particular, embodiments wherein the transposon is a piggyBac transposon, the transposase is a piggyBacTM or a Super piggyBacTM (SPB) transposase.
- SPB Super piggyBacTM
- the sequence encoding the transposase is an mRNA sequence.
- the sleeping beauty (SB) transposon is transposed into the target genome by the Sleeping Beauty transposase that recognizes ITRs, and moves the contents between the ITRs into TA chromosomal sites.
- the transposon is a Sleeping Beauty transposon.
- the transposase enzyme is a Sleeping Beauty transposase enzyme (see, for example, US Patent No.9,228,180, the contents of which are incorporated herein in their entirety).
- the Sleeping Beauty transposase is a hyperactive Sleeping Beauty (SB100X) transposase.
- the Helraiser transposon is transposed by the Helitron transposase. Unlike other transposases, the Helitron transposase does not contain an RNase-H like catalytic domain, but instead comprises a RepHel motif made up of a replication initiator domain (Rep) and a DNA helicase domain.
- the Rep domain is a nuclease domain of the HUH superfamily of nucleases.
- the transposon is a Helraiser transposon.
- the transposase is flanked by left and right terminal sequences termed LTS and RTS. In some embodiments, these sequences terminate with a conserved 5'- TC/CTAG-3' motif. In some embodiments, a 19 bp palindromic sequence with the potential to form the hairpin termination structure is located 11 nucleotides upstream of the RTS and comprises the sequence GTGCACGAATTTCGTGCACCGGGCCACTAG. In some embodiments, and, in particular embodiments wherein the transposon is a Helraiser transposon, the transposase enzyme is a Helitron transposase enzyme.
- Tol2 transposons may be isolated or derived from the genome of the medaka fish, and may be similar to transposons of the hAT family. Exemplary Tol2 transposons of the disclosure are encoded by a sequence comprising about 4.7 kilobases and contain a gene encoding the Tol2 transposase, which contains four exons. In some embodiments, the transposon is a Tol2 transposon. In certain embodiments of the methods of the disclosure, and, in particular those embodiments wherein the transposon is a Tol2 transposon, the transposase enzyme is a Tol2 transposase enzyme.
- a vector comprises the recombinant and non-naturally occurring DNA sequence encoding the transposon.
- the vector comprises any form of DNA and wherein the vector comprises at least 100 nucleotides (nts), 500 nts, 1000 nts, 1500 nts, 2000 nts, 2500 nts, 3000 nts, 3500 nts, 4000 nts, 4500 nts, 5000 nts, 6500 nts, 7000 nts, 7500 nts, 8000 nts, 8500 nts, 9000 nts, 9500 nts, 10,000 nts or any number of nucleotides in between.
- the vector comprises single- stranded or double-stranded DNA. In some embodiments, the vector comprises circular DNA. In some embodiments, the vector is a plasmid vector, a nanoplasmid vector, a minicircle. In some embodiments, the vector comprises linear or linearized DNA. In some embodiments, the vector is a double-stranded doggyboneTM DNA sequence. [001023] In some embodiments, the recombinant and non-naturally occurring DNA sequence encoding a transposon further comprises a sequence encoding one or more immune checkpoint genes.
- the nucleic acid sequence encoding the transposase enzyme is a DNA sequence
- an amount of the DNA sequence encoding the transposase enzyme and an amount of the DNA sequence encoding the transposon is equal to or less than 10.0 ⁇ g per 100 ⁇ L, less than 7.5 ⁇ g per 100 ⁇ L, less than 6.0 ⁇ g per 100 ⁇ L, less than 5.0 ⁇ g per 100 ⁇ L, less than 2.5 ⁇ g per 100 ⁇ L, or less than 1.67 ⁇ g per 100 ⁇ L, less than 0.55 ⁇ g per 100 ⁇ L, less than 0.19 ⁇ g per 100 ⁇ L, less than 0.10 ⁇ g per 100 ⁇ L of an electroporation or nucleofection reaction.
- a concentration of the amount of the DNA sequence encoding the transposase enzyme and an amount of the DNA sequence encoding the transposon in the electroporation or nucleofection reaction is equal to or less than 100 ⁇ g/mL, equal to or less than 75 ⁇ g/mL, equal to or less than 60 ⁇ g/mL, equal to or less than 50 ⁇ g/mL, equal to or less than 25 ⁇ g/mL, equal to or less than 16.7 ⁇ g/mL, equal to or less than 5.5 ⁇ g/mL, equal to or less than 1.9 ⁇ g/mL, equal to or less than 1.0 ⁇ g/mL.
- the nucleic acid sequence encoding the transposase enzyme is an RNA sequence
- an amount of the RNA sequence encoding the transposase enzyme and an amount of the RNA sequence encoding the transposon is equal to or less than 10.0 ⁇ g per 100 ⁇ L, less than 7.5 ⁇ g per 100 ⁇ L, less than 6.0 ⁇ g per 100 ⁇ L, less than 5.0 ⁇ g per 100 ⁇ L, less than 2.5 ⁇ g per 100 ⁇ L, or less than 1.67 ⁇ g per 100 ⁇ L, less than 0.55 ⁇ g per 100 ⁇ L, less than 0.19 ⁇ g per 100 ⁇ L, less than 0.10 ⁇ g per 100 ⁇ L of an electroporation or nucleofection reaction.
- a concentration of the amount of the RNA sequence encoding the transposase enzyme and an amount of the RNA sequence encoding the transposon in the electroporation or nucleofection reaction is equal to or less than 100 ⁇ g/mL, equal to or less than 75 ⁇ g/mL, equal to or less than 60 ⁇ g/mL, equal to or less than 50 ⁇ g/mL, equal to or less than 25 ⁇ g/mL, equal to or less than 16.7 ⁇ g/mL, equal to or less than 5.5 ⁇ g/mL, equal to or less than 1.9 ⁇ g/mL, equal to or less than 1.0 ⁇ g/mL.
- the TILs are further modified by a second gene editing tool, including, but not limited to those described herein.
- the second gene editing tool may include an excision-only piggyBac transposase to re-excise the inserted sequences or any portion thereof.
- the excision-only piggyBac transposase may be used to “re-excise” the transposon.
- a piggyBac system comprises a transposon/transposase system, wherein the transposase recognizes the ITRs located on both sides of the transposon cassette comprising a cargo encoding one or more immune checkpoint genes, and excises the transposable element to integrate it into TT/AA chromosomal sites, resulting in genomic insertion of the transposon cassette and expression of the one or more immune checkpoint genes.
- the cargo encodes two or more immune checkpoint molecules.
- Non-limiting examples of genes that may be enhanced by permanently gene-editing TILs via a piggyBac method include CCR2, CCR4, CCR5, CXCR2, CXCR3, CX3CR1, IL-2, IL-4, IL-7, IL-10, IL-15, IL-18, IL-21, the NOTCH 1/2 intracellular domain (ICD), and/or the NOTCH ligand mDLL1.
- Additional genes that may be enhanced by gene-editing TILs via a piggyBac method include immune checkpoint genes such, such as, PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3,
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days, wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the second population of TILs to effect transfer of
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days to obtain the second population of TILs, wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the second
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method of genetically modifying a polulation of TILs includes the use of a non-viral technique such as a piggyBac method (e.g., piggyBac transposons and transposases or piggyBac-like transposons and transposases).
- the method comprises delivering to the TILs: (a) a nucleic acid or amino acid sequence comprising a sequence encoding a transposase enzy; and (b) a recombinant and non-naturally occurring DNA sequence comprising a DNA sequence encoding a transposon.
- the sequence encoding a transposase enzyme is an mRNA sequence.
- the mRNA sequence encoding a transposase enzyme may be produced in vitro.
- the sequence encoding a transposase enzyme is a DNA sequence.
- the DNA sequence encoding a transposase enzyme may be produced in vitro.
- the DNA sequence may be a cDNA sequence.
- the sequence encoding a transposase enzyme is an amino acid sequence.
- the amino acid sequence encoding a transposase enzyme may be produced in vitro.
- a protein Super piggybac transposase (SPB) may be delivered following pre-incubation with transposon DNA.
- the transposon is a piggyBac transposon or a piggyBac-like transposon.
- the transposase is a piggyBac transposase.
- the transposase is a piggyBac-like transposase.
- the piggyBac transposase comprises an amino acid sequence comprising SEQ ID NO:387 (SEQ ID NO: 14487 of WO2019046815).
- the transposase is a piggyBacTM or a Super piggyBacTM (SPB) transposase.
- the sequence encoding the transposase is an mRNA sequence.
- the transposase enzyme is a piggyBacTM (PB) transposase enzyme.
- the piggyBac (PB) transposase enzyme may comprise or consist of an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to: MGSSLDDEHILSALLQSDDELVGEDSDSEISDHVSEDDVQSDTEEAFIDEVHEVQPTSSGSEILDEQN VIEQPGSSLASNRILTLPQRTIRGKNKHCWSTSKSTRRSRVSALNIVRSQRGPTRMCRNIYDPLLCFKL FFTDEIISEIVKWTNAEISLKRRESMTGATFRDTNEDEIYAFFGILVMTAVRKDNHMSTDDLFDRSLSM VYVSVMSRDRFDFLIRCLRMDDKSIRPTLRENDVFTPVRKIWDLFIHQCIQNYTPGAHLTIDEQLLGFR GRCPFRMYIPNKPSKYGIKILMMCDSGTKYMINGMPYLGRGTQTNGVPLGEYYVKELSKPVHGSCRN ITCDNWFTSIPLAKNLL
- the transposon is a Sleeping Beauty transposon.
- the transposase enzyme is a Sleeping Beauty transposase enzyme (see, for example, US Patent No.9,228,180, the contents of which are incorporated herein in their entirety).
- the Sleeping Beauty transposase is a hyperactive Sleeping Beauty (SB100X) transposase.
- the Sleeping Beauty transposase enzyme comprises an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to: MGKSKEISQDLRKKIVDLHKSGSSLGAISKRLKVPRSSVQTIVRKYKHHGTTQPSYRSGRRRVLSPRD ERTLVRKVQINPRTTAKDLVKMLEETGTKVSISTVKRVLYRHNLKGRSARKKPLLQNRHKKARLRFAT AHGDKDRTFWRNVLWSDETKIELFGHNDHRYVWRKKGEACKPKNTIPTVKHGGGSIMLWGCFAAG GTGALHKIDGIMRKENYVDILKQHLKTSVRKLKLGRKWVFQMDNDPKHTSKVVAKWLKDNKVKVLEW PSQSPDLNPIENLWAELKKRVRARRPTNLTQLHQLCQEEWAKIHPTYCGKLVEGYPKRLTQVKQFKG NATKY (SEQ ID NO:
- the Sleeping Beauty transposase is a hyperactive Sleeping Beauty (SB100X) transposase
- the Sleeping Beauty transposase enzyme comprises an amino acid sequence at least at least 75%, 80%, 85%, 90%, 95%, 99% or any percentage in between identical to: MGKSKEISQDLRKRIVDLHKSGSSLGAISKRLAVPRSSVQTIVRKYKHHGTTQPSYRSGRRRVLSPRD ERTLVRKVQINPRTTAKDLVKMLEETGTKVSISTVKRVLYRHNLKGHSARKKPLLQNRHKKARLRFAT AHGDKDRTFWRNVLWSDETKIELFGHNDHRYVWRKKGEACKPKNTIPTVKHGGGSIMLWGCFAAG GTGALHKIDGIMDAVQYVDILKQHLKTSVRKLKLGRKWVFQHDNDPKHTSKVVAKWLKDNKVKVLEW PSQSPDLNPIENL
- a method for expanding TILs into a therapeutic population may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A) or as described in PCT/US2017/058610, PCT/US2018/012605, or PCT/US2018/012633, wherein the method further comprises gene-editing at least a portion of the TILs by a CRISPR method (e.g., CRISPR/Cas9 or CRISPR/Cpf1).
- a CRISPR method e.g., CRISPR/Cas9 or CRISPR/Cpf1
- the use of a CRISPR method during the TIL expansion process causes expression of at least one immunomodulatory composition at the cell surface of, and optionally causes one or more immune checkpoint genes to be silenced or reduced in, at least a portion of the therapeutic population of TILs.
- the use of a CRISPR method during the TIL expansion process causes expression of at least one immunomodulatory composition at the cell surface of, and optionally causes one or more immune checkpoint genes to be enhanced in, at least a portion of the therapeutic population of TILs.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- CRISPR stands for “Clustered Regularly Interspaced Short Palindromic Repeats.”
- a method of using a CRISPR system for gene editing is also referred to herein as a CRISPR method.
- CRISPR systems can be divided into two main classes, Class 1 and Class 2, which are further classified into different types and sub-types.
- the classification of the CRISPR systems is based on the effector Cas proteins that are capable of cleaving specific nucleic acids.
- the effector module consists of a multi-protein complex, whereas Class 2 systems only use one effector protein.
- Class 1 CRISPR includes Types I, III, and IV and Class 2 CRISPR includes Types II, V, and VI.
- CRISPR systems which incorporate RNAs and Cas proteins that are preferred for use in accordance with the present invention: Types I (exemplified by Cas3), II (exemplified by Cas9), and III (exemplified by Cas10).
- Type II CRISPR is one of the most well- characterized systems.
- CRISPR technology was adapted from the natural defense mechanisms of bacteria and archaea (the domain of single-celled microorganisms). These organisms use CRISPR- derived RNA and various Cas proteins, including Cas9, to foil attacks by viruses and other foreign bodies by chopping up and destroying the DNA of a foreign invader.
- a CRISPR is a specialized region of DNA with two distinct characteristics: the presence of nucleotide repeats and spacers. Repeated sequences of nucleotides are distributed throughout a CRISPR region with short segments of foreign DNA (spacers) interspersed among the repeated sequences. In the type II CRISPR/Cas system, spacers are integrated within the CRISPR genomic loci and transcribed and processed into short CRISPR RNA (crRNA). These crRNAs anneal to trans-activating crRNAs (tracrRNAs) and direct sequence-specific cleavage and silencing of pathogenic DNA by Cas proteins.
- crRNA short CRISPR RNA
- Cas9 serves as an RNA-guided DNA endonuclease that cleaves DNA upon crRNA-tracrRNA recognition.
- the crRNA and tracrRNA in the native system can be simplified into a single guide RNA (sgRNA) of approximately 100 nucleotides for use in genetic engineering.
- the sgRNA is a synthetic RNA that includes a scaffold sequence necessary for Cas-binding and a user- defined approximately 17- to 20-nucleotide spacer that defines the genomic target to be modified.
- a user can change the genomic target of the Cas protein by changing the target sequence present in the sgRNA.
- the CRISPR/Cas system is directly portable to human cells by co-delivery of plasmids expressing the Cas9 endo-nuclease and the RNA components (e.g., sgRNA).
- Different variants of Cas proteins may be used to reduce targeting limitations (e.g., orthologs of Cas9, such as Cpf1).
- an engineered, programmable, non-naturally occurring Type II CRISPR-Cas system comprises a Cas9 protein and at least one guide RNA that targets and hybridizes to a target sequence of a DNA molecule in a TIL, wherein the DNA molecule encodes and the TIL expresses at least one immune checkpoint molecule, and the Cas9 protein cleaves the DNA molecules, whereby expression of the at least one immune checkpoint molecule is altered; and, wherein the Cas9 protein and the guide RNA do not naturally occur together.
- the expression of two or more immune checkpoint molecules is altered.
- the guide RNA(s) comprise a guide sequence fused to a tracr sequence.
- the guide RNA may comprise crRNA-tracrRNA or sgRNA.
- the terms "guide RNA”, “single guide RNA” and “synthetic guide RNA” may be used interchangeably and refer to the polynucleotide sequence comprising the guide sequence, which is the approximately 17-20 bp sequence within the guide RNA that specifies the target site.
- Variants of Cas9 having improved on-target specificity compared to Cas9 may also be used in accordance with embodiments of the present invention. Such variants may be referred to as high-fidelity Cas-9s.
- a dual nickase approach may be utilized, wherein two nickases targeting opposite DNA strands generate a DSB within the target DNA (often referred to as a double nick or dual nickase CRISPR system).
- this approach may involve the mutation of one of the two Cas9 nuclease domains, turning Cas9 from a nuclease into a nickase.
- high-fidelity Cas9s include eSpCas9, SpCas9-HF1 and HypaCas9.
- Such variants may reduce or eliminate unwanted changes at non-target DNA sites. See, e.g., Slaymaker IM, et al.
- Cas9 scaffolds may be used that improve gene delivery of Cas9 into cells and improve on-target specificity, such as those disclosed in U.S. Patent Application Publication No.2016/0102324, which is incorporated by reference herein.
- Cas9 scaffolds may include a RuvC motif as defined by (D- [I/L]-G-X-X-S-X-G-W-A) and/or a HNH motif defined by (Y-X-X-D-H-X-X-P-X-S-X-X-X- D-X-S), where X represents any one of the 20 naturally occurring amino acids and [I/L] represents isoleucine or leucine.
- the HNH domain is responsible for nicking one strand of the target dsDNA and the RuvC domain is involved in cleavage of the other strand of the dsDNA.
- each of these domains nick a strand of the target DNA within the protospacer in the immediate vicinity of PAM, resulting in blunt cleavage of the DNA.
- These motifs may be combined with each other to create more compact and/or more specific Cas9 scaffolds. Further, the motifs may be used to create a split Cas9 protein (i.e., a reduced or truncated form of a Cas9 protein or Cas9 variant that comprises either a RuvC domain or a HNH domain) that is divided into two separate RuvC and HNH domains, which can process the target DNA together or separately.
- a CRISPR method comprises silencing or reducing the expression of one or more immune checkpoint genes in TILs by introducing a Cas9 nuclease and a guide RNA (e.g., crRNA-tracrRNA or sgRNA) containing a sequence of approximately 17-20 nucleotides specific to a target DNA sequence of the immune checkpoint gene(s).
- the guide RNA may be delivered as RNA or by transforming a plasmid with the guide RNA-coding sequence under a promoter.
- the CRISPR/Cas enzymes introduce a double-strand break (DSB) at a specific location based on a sgRNA-defined target sequence.
- DSB double-strand break
- DSBs may be repaired in the cells by non-homologous end joining (NHEJ), a mechanism which frequently causes insertions or deletions (indels) in the DNA. Indels often lead to frameshifts, creating loss of function alleles; for example, by causing premature stop codons within the open reading frame (ORF) of the targeted gene. According to certain embodiments, the result is a loss-of-function mutation within the targeted immune checkpoint gene.
- NHEJ non-homologous end joining
- Indels often lead to frameshifts, creating loss of function alleles; for example, by causing premature stop codons within the open reading frame (ORF) of the targeted gene.
- ORF open reading frame
- the result is a loss-of-function mutation within the targeted immune checkpoint gene.
- DSBs induced by CRISPR/Cas enzymes may be repaired by homology-directed repair (HDR) instead of NHEJ.
- HDR homology-directed repair
- HDR homology directed repair
- the repair template preferably contains the desired edit as well as additional homologous sequence immediately upstream and downstream of the target gene (often referred to as left and right homology arms).
- an enzymatically inactive version of Cas9 may be targeted to transcription start sites in order to repress transcription by blocking initiation.
- targeted immune checkpoint genes may be repressed without the use of a DSB.
- a dCas9 molecule retains the ability to bind to target DNA based on the sgRNA targeting sequence.
- a CRISPR method comprises silencing or reducing the expression of one or more immune checkpoint genes by inhibiting or preventing transcription of the targeted gene(s).
- a CRISPR method may comprise fusing a transcriptional repressor domain, such as a Kruppel-associated box (KRAB) domain, to an enzymatically inactive version of Cas9, thereby forming, e.g., a dCas9-KRAB, that targets the immune checkpoint gene’s transcription start site, leading to the inhibition or prevention of transcription of the gene.
- a transcriptional repressor domain such as a Kruppel-associated box (KRAB) domain
- KRAB Kruppel-associated box
- the repressor domain is targeted to a window downstream from the transcription start site, e.g., about 500 bp downstream.
- CRISPR interference CRISPR interference
- an enzymatically inactive version of Cas9 may be targeted to transcription start sites in order to activate transcription.
- This approach may be referred to as CRISPR activation (CRISPRa).
- CRISPRa CRISPR activation
- a CRISPR method comprises increasing the expression of one or more immune checkpoint genes by activating transcription of the targeted gene(s).
- targeted immune checkpoint genes may be activated without the use of a DSB.
- a CRISPR method may comprise targeting transcriptional activation domains to the transcription start site; for example, by fusing a transcriptional activator, such as VP64, to dCas9, thereby forming, e.g., a dCas9-VP64, that targets the immune checkpoint gene’s transcription start site, leading to activation of transcription of the gene.
- a transcriptional activator such as VP64
- the activator domain is targeted to a window upstream from the transcription start site, e.g., about 50-400 bp downstream
- Additional embodiments of the present invention may utilize activation strategies that have been developed for potent activation of target genes in mammalian cells.
- Non- limiting examples include co-expression of epitope-tagged dCas9 and antibody-activator effector proteins (e.g., the SunTag system), dCas9 fused to a plurality of different activation domains in series (e.g., dCas9-VPR) or co-expression of dCas9-VP64 with a modified scaffold gRNA and additional RNA-binding helper activators (e.g., SAM activators).
- CRISPR-mediated genome editing method referred to as CRISPR assisted rational protein engineering (CARPE) may be used in accordance with embodiments of the present invention, as disclosed in US Patent No.
- CARPE involves the generation of “donor” and “destination” libraries that incorporate directed mutations from single-stranded DNA (ssDNA) or double-stranded DNA (dsDNA) editing cassettes directly into the genome.
- Construction of the donor library involves cotransforming rationally designed editing oligonucleotides into cells with a guide RNA (gRNA) that hybridizes to a target DNA sequence.
- the editing oligonucleotides are designed to couple deletion or mutation of a PAM with the mutation of one or more desired codons in the adjacent gene. This enables the entire donor library to be generated in a single transformation.
- the donor library is retrieved by amplification of the recombinant chromosomes, such as by a PCR reaction, using a synthetic feature from the editing oligonucleotide, namely, a second PAM deletion or mutation that is simultaneously incorporated at the 3’ terminus of the gene. This covalently couples the codon target mutations directed to a PAM deletion.
- the donor libraries are then co-transformed into cells with a destination gRNA vector to create a population of cells that express a rationally designed protein library.
- GEn-TraCER Genome Engineering by Trackable CRISPR Enriched Recombineering
- US Patent No.9,982,278 which is incorporated by reference herein.
- the GEn-TraCER methods and vectors combine an editing cassette with a gene encoding gRNA on a single vector.
- the cassette contains a desired mutation and a PAM mutation.
- the vector which may also encode Cas9, is the introduced into a cell or population of cells.
- Non-limiting examples of genes that may be silenced or inhibited by permanently gene-editing TILs via a CRISPR method include PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, TET2, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD
- Non-limiting examples of genes that may be enhanced by permanently gene-editing TILs via a CRISPR method include CCR2, CCR4, CCR5, CXCR2, CXCR3, CX3CR1, IL-2, IL-4, IL-7, IL-10, IL-15, IL-18, IL-21, the NOTCH 1/2 intracellular domain (ICD), and/or the NOTCH ligand mDLL1.
- ICD the NOTCH 1/2 intracellular domain
- Examples of systems, methods, and compositions for altering the expression of a target gene sequence by a CRISPR method, and which may be used in accordance with embodiments of the present invention, are described in U.S.
- Resources for carrying out CRISPR methods such as plasmids for expressing CRISPR/Cas9 and CRISPR/Cpf1
- GenScript GenScript
- genetic modifications of populations of TILs may be performed using the CRISPR/Cpf1 system as described in U.S. Patent No.
- the CRISPR/Cpf1 system is functionally distinct from the CRISPR-Cas9 system in that Cpf1-associated CRISPR arrays are processed into mature crRNAs without the need for an additional tracrRNA.
- the crRNAs used in the CRISPR/Cpf1 system have a spacer or guide sequence and a direct repeat sequence.
- the Cpf1p-crRNA complex that is formed using this method is sufficient by itself to cleave the target DNA.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days, wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the second population of TILs to effect transfer of
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days to obtain the second population of TILs, wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the second
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- TALE Methods A method for expanding TILs into a therapeutic population may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A) or as described in WO2018081473, WO2018129332, or WO2018182817, wherein the method further comprises gene-editing at least a portion of the TILs by a TALE method.
- the use of a TALE method during the TIL expansion process causes expression of at least one immunomodulatory composition at the cell surface, and optionally causes expression of one or more immune checkpoint genes to be silenced or reduced, in at least a portion of the therapeutic population of TILs.
- the use of a TALE method during the TIL expansion process causes expression of at least one immunomodulatory composition at the cell surface, and optionally causes expression of one or more immune checkpoint genes to be enhanced, in at least a portion of the therapeutic population of TILs.
- TALE stands for “Transcription Activator-Like Effector” proteins, which include TALENs (“Transcription Activator-Like Effector Nucleases”).
- TALEs are naturally occurring proteins from the plant pathogenic bacteria genus Xanthomonas, and contain DNA-binding domains composed of a series of 33–35-amino-acid repeat domains that each recognizes a single base pair. TALE specificity is determined by two hypervariable amino acids that are known as the repeat-variable di-residues (RVDs). Modular TALE repeats are linked together to recognize contiguous DNA sequences. A specific RVD in the DNA-binding domain recognizes a base in the target locus, providing a structural feature to assemble predictable DNA-binding domains.
- RVDs repeat-variable di-residues
- TALE Transcription activator-like effector
- the DNA binding domains of a TALE are fused to the catalytic domain of a type IIS FokI endonuclease to make a targetable TALE nuclease.
- two individual TALEN arms separated by a 14- 20 base pair spacer region, bring FokI monomers in close proximity to dimerize and produce a targeted double-strand break.
- TALE repeats can be combined to recognize virtually any user-defined sequence.
- Strategies that enable the rapid assembly of custom TALE arrays include Golden Gate molecular cloning, high-throughput solid-phase assembly, and ligation-independent cloning techniques.
- Custom-designed TALE arrays are also commercially available through Cellectis Bioresearch (Paris, France), Transposagen Biopharmaceuticals (Lexington, KY, USA), and Life Technologies (Grand Island, NY, USA). Additionally web-based tools, such as TAL Effector-Nucleotide Target 2.0, are available that enable the design of custom TAL effector repeat arrays for desired targets and also provides predicted TAL effector binding sites. See Doyle, et al., Nucleic Acids Research, 2012, Vol.40, W117-W122. Examples of TALE and TALEN methods suitable for use in the present invention are described in U.S. Patent Application Publication Nos.
- a TALE method comprises silencing or reducing the expression of one or more immune checkpoint genes by inhibiting or preventing transcription of the targeted gene(s).
- a TALE method may include utilizing KRAB-TALEs, wherein the method comprises fusing a transcriptional Kruppel-associated box (KRAB) domain to a DNA binding domain that targets the gene’s transcription start site, leading to the inhibition or prevention of transcription of the gene.
- KRAB transcriptional Kruppel-associated box
- a TALE method comprises silencing or reducing the expression of one or more immune checkpoint genes by introducing mutations in the targeted gene(s).
- a TALE method may include fusing a nuclease effector domain, such as Fokl, to the TALE DNA binding domain, resulting in a TALEN.
- Fokl is active as a dimer; hence, the method comprises constructing pairs of TALENs to position the FOKL nuclease domains to adjacent genomic target sites, where they introduce DNA double strand breaks. A double strand break may be completed following correct positioning and dimerization of Fokl.
- DNA repair can be achieved via two different mechanisms: the high-fidelity homologous recombination pair (HRR) (also known as homology-directed repair or HDR) or the error-prone non-homologous end joining (NHEJ).
- HRR high-fidelity homologous recombination pair
- NHEJ error-prone non-homologous end joining
- Repair of double strand breaks via NHEJ preferably results in DNA target site deletions, insertions or substitutions, i.e., NHEJ typically leads to the introduction of small insertions and deletions at the site of the break, often inducing frameshifts that knockout gene function.
- the TALEN pairs are targeted to the most 5’ exons of the genes, promoting early frame shift mutations or premature stop codons.
- the genetic mutation(s) introduced by TALEN are preferably permanent.
- the method comprises silencing or reducing expression of an immune checkpoint gene by utilizing dimerized TALENs to induce a site-specific double strand break that is repaired via error-prone NHEJ, leading to one or more mutations in the targeted immune checkpoint gene.
- TALENs are utilized to introduce genetic alterations via HRR, such as non-random point mutations, targeted deletion, or addition of DNA fragments. The introduction of DNA double strand breaks enables gene editing via homologous recombination in the presence of suitable donor DNA.
- the method comprises co-delivering dimerized TALENs and a donor plasmid bearing locus-specific homology arms to induce a site-specific double strand break and integrate one or more transgenes into the DNA.
- a TALEN that is a hybrid protein derived from FokI and AvrXa7, as disclosed in U.S. Patent Publication No.2011/0201118, may be used in accordance with embodiments of the present invention.
- This TALEN retains recognition specificity for target nucleotides of AvrXa7 and the double-stranded DNA cleaving activity of FokI.
- the same methods can be used to prepare other TALEN having different recognition specificity.
- compact TALENs may be generated by engineering a core TALE scaffold having different sets of RVDs to change the DNA binding specificity and target a specific single dsDNA target sequence. See U.S. Patent Publication No. 2013/0117869.
- a selection of catalytic domains can be attached to the scaffold to effect DNA processing, which may be engineered to ensure that the catalytic domain is capable of processing DNA near the single dsDNA target sequence when fused to the core TALE scaffold.
- a peptide linker may also be engineered to fuse the catalytic domain to the scaffold to create a compact TALEN made of a single polypeptide chain that does not require dimerization to target a specific single dsDNA sequence.
- a core TALE scaffold may also be modified by fusing a catalytic domain, which may be a TAL monomer, to its N-terminus, allowing for the possibility that this catalytic domain might interact with another catalytic domain fused to another TAL monomer, thereby creating a catalytic entity likely to process DNA in the proximity of the target sequences.
- a catalytic domain which may be a TAL monomer
- This architecture allows only one DNA strand to be targeted, which is not an option for classical TALEN architectures.
- conventional RVDs may be used create TALENs that are capable of significantly reducing gene expression.
- RVDs are used to target adenine, cytosine, guanine, and thymine, respectively.
- These conventional RVDs can be used to, for instance, create TALENs targeting the PD-1 gene.
- TALENs using conventional RVDs include the T3v1 and T1 TALENs disclosed in Gautron et al., Molecular Therapy: Nucleic Acids Dec.2017, Vol.9:312-321 (Gautron), which is incorporated by reference herein.
- the T3v1 and T1 TALENs target the second exon of the PDCD1 locus where the PD-L1 binding site is located and are able to considerably reduce PD-1 production.
- the T1 TALEN does so by using target SEQ ID NO:256 and the T3v1 TALEN does so by using target SEQ ID NO:257.
- TALENs are modified using non-conventional RVDs to improve their activity and specificity for a target gene, such as disclosed in Gautron.
- Naturally occurring RVDs only cover a small fraction of the potential diversity repertoire for the hypervariable amino acid locations.
- Non-conventional RVDs provide an alternative to natural RVDs and have novel intrinsic targeting specificity features that can be used to exclude the targeting of off-site targets (sequences within the genome that contain a few mismatches relative to the targeted sequence) by TALEN.
- Non-conventional RVDs may be identified by generating and screening collections of TALEN containing alternative combinations of amino acids at the two hypervariable amino acid locations at defined positions of an array as disclosed in Juillerat, et al., Scientific Reports 5, Article Number 8150 (2015), which is incorporated by reference herein. Next, non-conventional RVDs may be selected that discriminate between the nucleotides present at the position of mismatches, which can prevent TALEN activity at off-site sequences while still allowing appropriate processing of the target location. The selected non-conventional RVDs may then be used to replace the conventional RVDs in a TALEN.
- TALENs where conventional RVDs have been replaced by non-conventional RVDs include the T3v2 and T3v3 PD-1 TALENs produced by Gautron. These TALENs had increased specificity when compared to TALENs using conventional RVDs.
- TALEN may be utilized to introduce genetic alterations to silence or reduce the expression of two genes. For instance, two separate TALEN may be generated to target two different genes and then used together. The molecular events generated by the two TALEN at their respective loci and potential off-target sites may be characterized by high-throughput DNA sequencing. This enables the analysis of off-target sites and identification of the sites that might result from the use of both TALEN.
- RVDs may be selected to engineer TALEN that have increased specificity and activity even when used together.
- Gautron discloses the combined use of T3v4 PD-1 and TRAC TALEN to produce double knockout CAR T cells, which maintained a potent in vitro anti- tumor function.
- the method of Gautron or other methods described herein may be employed to genetically-edit TILs, which may then be expanded by any of the procedures described herein.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises the steps of: (a) activating a first population of TILs obtained from a tumor resected from a patient using CD3 and CD28 activating beads or antibodies for 1 to 5 days; (b) gene-editing at least a portion of the first population of TILs using electroporation of transcription activator-like effector nuclease-encoding nucleic acids to obtain a second population of TILs, wherein the gene-editing effects expression of at least one immunomodulatory composition at the cell surface, and inhibits expression of at least one immune checkpoint protein, in the portion of the cells of the second population of TILs; (c) optionally incubating the second population of TILs; (d) performing a first expansion by culturing the second population of TILs in a cell culture medium comprising IL-2, and optionally OKT-3, to produce a third population of TILs, wherein the
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises the steps of: (a) activating a first population of TILs obtained from a tumor resected from a patient using CD3 and CD28 activating beads or antibodies for 1 to 5 days; (b) gene-editing at least a portion of the first population of TILs using electroporation of transcription activator-like effector nuclease-encoding nucleic acids in cytoporation medium to obtain a second population of TILs, wherein the gene- editing effects expression of at least one immunomodulatory composition at the cell surface, and inhibits expression of at least one immune checkpoint protein, in the portion of the cells of the second population of TILs; (c) optionally incubating the second population of TILs;
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises the steps of: (a) activating a first population of TILs obtained from a tumor resected from a patient using CD3 and CD28 activating beads or antibodies for 1 to 5 days; (b) gene-editing at least a portion of the first population of TILs using electroporation of transcription activator-like effector nuclease-encoding nucleic acids in cytoporation medium to obtain a second population of TILs, wherein the gene- editing effects expression of at least one immunomodulatory composition at the cell surface, and inhibits expression of at least one immune checkpoint protein, in the portion of the cells of the second population of TILs; (c) optionally incubating the second population of TILs,
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) gene-editing at least a portion of the third population of TILs using electroporation of transcription activator-like effector nuclease-encoding nucleic acids in cytoporation medium to obtain a fourth population of
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) digesting in an enzyme media the tumor tissue to produce a tumor digest; (c) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (d) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (e) gene-editing at least a portion of the third population of TILs using electroporation of transcription activator-like effector nuclease-en
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) gene-editing the third population of TILs by temporarily disrupting the cell membranes of the third population of TILs to effect transfer of transcription activator- like effector nuclease-encoding nucleic acids into the third population of TILs
- a microfluidic platform is used to temporarily disrupt the cell membranes of the third population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) gene-editing the third population of TILs by temporarily disrupting the cell membranes of the third population of TILs to effect transfer of transcription activator- like effector nucleas
- a microfluidic platform is used to temporarily disrupt the cell membranes of the third population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the step of culturing the fourth population of TILs is performed by culturing the fourth population of TILs in the second cell culture medium for a first period of about 1-7 days, at the end of the first period the culture is split into a plurality of subcultures, each of the plurality of subcultures is cultured in a third culture medium comprising IL-2 for a second period of about 3-7 days, and at the end of the second period the plurality of subcultures are combined to provide the expanded number of TILs.
- TALENs may be specifically designed, which allows higher rates of DSB events within the target cell(s) that are able to target a specific selection of genes. See U.S. Patent Publication No.2013/0315884.
- the use of such rare cutting endonucleases increases the chances of obtaining double inactivation of target genes in transfected cells, allowing for the production of engineered cells, such as T-cells.
- additional catalytic domains can be introduced with the TALEN to increase mutagenesis and enhance target gene inactivation.
- the TALENs described in U.S. Patent Publication No. 2013/0315884 were successfully used to engineer T-cells to make them suitable for immunotherapy.
- TALENs may also be used to inactivate various immune checkpoint genes in T-cells, including the inactivation of at least two genes in a single T-cell. See U.S. Patent Publication No.2016/0120906. Additionally, TALENs may be used to inactivate genes encoding targets for immunosuppressive agents and T-cell receptors, as disclosed in U.S. Patent Publication No.2018/0021379, which is incorporated by reference herein. Further, TALENs may be used to inhibit the expression of beta 2-microglobulin (B2M) and/or class II major histocompatibility complex transactivator (CIITA), as disclosed in U.S. Patent Publication No.2019/0010514, which is incorporated by reference herein.
- B2M beta 2-microglobulin
- CIITA major histocompatibility complex transactivator
- Non-limiting examples of genes that may be silenced or inhibited by permanently gene-editing TILs via a TALE method include PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, TET2, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT
- TALE-nucleases targeting the PD-1 gene are provided in the following table.
- the targeted genomic sequences contain two 17-base pair (bp) long sequences (referred to as half targets, shown in upper case letters) separated by a 15-bp spacer (shown in lower case letters).
- Each half target is recognized by repeats of half TALE-nucleases listed in Table 11.
- TALE- nucleases according to the invention recognize and cleave the target sequence selected from the group consisting of: SEQ ID NO: 286 and SEQ ID NO: 287.
- TALEN sequences and gene-editing methods are also described in Gautron, discussed above.
- TALEN PD-1 No.1 Sequences NNGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETV QRLLPVLCQAHGLTPQQVVAIASNGGGRPALE AGCCACGATGGCGGCAAGCAGGCGCTGGAGACGGTCCAGCGGC TGTTGCCGGTGCTGTGCCAGGCCCACGGCTTGACCCCGGAGCAG AAGGTGTACCCCTCCAGCGTGACCGAGTTCAAGTTCCTGTTCGT GTCCGGCCACTTCAAGGGCAACTACAAGGCCCAGCTGACCAGGC GCTCACTCCCGAACAGGTCGTGGCAATCGCCTCCAACGGAGGGA AGCAGGCTCTGGAGACCGTGCAGAGACTGCTGCCCGTCTTGTGC (SEQ ID NO:287) GGGAGAGTTGAGAGGTCCACCGTTACAGTTGGACACAGGCCAA CTTCTCAAGATTGCAAAACGTGGCGGCGTGACCGCAGTGGAG
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) gene-editing at least a portion of the third population of TILs, wherein the gene- editing comprises using electroporation of transcription activator-like effector nuclease-encoding nucleic acids targeting PD-1 in
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) gene-editing at least a portion of the third population of TILs by temporarily disrupting the cell membranes of the third population of TILs to effect transfer of transcription activator-like effector nuclease-encoding nucleic acids
- a microfluidic platform is used to temporarily disrupt the cell membranes of the third population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist. In some embodiments, the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises the steps of: (a) activating a first population of TILs obtained from a tumor resected from a patient using CD3 and CD28 activating beads or antibodies for 1 to 5 days; (b) gene-editing at least a portion of the first population of TILs, wherein the gene- editing comprises using electroporation of transcription activator-like effector nuclease-encoding nucleic acids targeting SEQ ID NO:149 or SEQ ID NO:150 in cytoporation medium to obtain a second population of TILs, and wherein the gene-editing effects expression of at least one immunomodulatory composition at the cell surface, and inhibits expression of PD-1, in the portion of the cells of the second population of TILs; (c) optionally incubating the second population of TILs, wherein the incubation is performed at about 30-40 °C with about 5% CO 2
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) gene-editing at least a portion of the third population of TILs, wherein the gene- editing comprises using electroporation of transcription activator-like effector nuclease-encoding nucleic acids targeting SEQ ID NO:
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) gene-editing at least a portion of the third population of TILs by temporarily disrupting the cell membranes of the third population of TILs to effect transfer of transcription activator-like effector nuclease-encoding nucleic acids
- a microfluidic platform is used to temporarily disrupt the cell membranes of the third population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist. In some embodiments, the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises the steps of: (a) activating a first population of TILs obtained from a tumor resected from a patient using CD3 and CD28 activating beads or antibodies for 1 to 5 days; (b) gene-editing at least a portion of the first population of TILs, wherein the gene- editing comprises using electroporation of transcription activator-like effector nuclease-encoding mRNAs according to SEQ ID NO:157 and SEQ ID NO:158 or SEQ ID NO: 153 and SEQ ID NO:154 in cytoporation medium to obtain a second population of TILs, and wherein the gene-editing effects expression of at least one immunomodulatory composition at the cell surface, and inhibits expression of PD- 1, in the portion of the cells of the second population of TILs; (c) optionally incubating the second population of TILs, wherein the incubation
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) gene-editing at least a portion of the third population of TILs, wherein the gene- editing comprises using electroporation of transcription activator-like effector nuclease-encoding mRNAs according to SEQ ID NO
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for preparing expanded tumor infiltrating lymphocytes comprising: (a) obtaining and/or receiving a first population of TILs from a tumor tissue resected from a subject or patient; (b) culturing the first population of TILs in a first cell culture medium comprising IL- 2 for about 3-9 days to produce a second population of TILs; (c) activating the second population of TILs using anti-CD3 and anti-CD28 beads or antibodies for 1-7 days, to produce a third population of TILs; (d) gene-editing at least a portion of the third population of TILs by temporarily disrupting the cell membranes of the third population of TILs to effect transfer of transcription activator-like effector nuclease-encoding mRNAs
- a microfluidic platform is used to temporarily disrupt the cell membranes of the third population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist. In some embodiments, the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- genes that may be enhanced by permanently gene- editing TILs via a TALE method include CCR2, CCR4, CCR5, CXCR2, CXCR3, CX3CR1, IL-2, IL-4, IL-7, IL-10, IL-15, IL-21, the NOTCH 1/2 intracellular domain (ICD), and/or the NOTCH ligand mDLL1.
- TALEN designs and design strategies, activity assessments, screening strategies, and methods that can be used to efficiently perform TALEN-mediated gene integration and inactivation, and which may be used in accordance with embodiments of the present invention, are described in Valton, et al., Methods, 2014, 69, 151-170, which is incorporated by reference herein.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the second population of TILs to effect transfer
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days
- a microfluidic platform is used to temporarily disrupt the cell membranes of the third population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist. In some embodiments, the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days to obtain the second population of TILs, wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating step on
- the at least one immunomodulatory composition comprises a cytokine fused to a membrane anchor.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist. In some embodiments, the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days to obtain the second population of TILs, wherein the transition from step (c) to step (d) occurs without opening the system; (e) temporarily disrupting the cell membranes of the
- a microfluidic platform is used to temporarily disrupt the cell membranes of the third population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist. In some embodiments, the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist. 3.
- a method for expanding TILs into a therapeutic population may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A) or as described in PCT/US2017/058610, PCT/US2018/012605, or PCT/US2018/012633, wherein the method further comprises gene-editing at least a portion of the TILs by a zinc finger or zinc finger nuclease method.
- the use of a zinc finger method during the TIL expansion process causes expression of at least one immunomodulatory composition at the cell surface, and optionally causes expression of one or more immune checkpoint genes to be silenced or reduced in at least a portion of the therapeutic population of TILs.
- a zinc finger method during the TIL expansion process causes expression of at least one immunomodulatory composition at the cell surface, and optionally causes expression of one or more immune checkpoint genes to be enhanced in at least a portion of the therapeutic population of TILs.
- An individual zinc finger contains approximately 30 amino acids in a conserved ⁇ configuration. Several amino acids on the surface of the ⁇ -helix typically contact 3 bp in the major groove of DNA, with varying levels of selectivity.
- Zinc fingers have two protein domains. The first domain is the DNA binding domain, which includes eukaryotic transcription factors and contain the zinc finger. The second domain is the nuclease domain, which includes the FokI restriction enzyme and is responsible for the catalytic cleavage of DNA.
- the DNA-binding domains of individual ZFNs typically contain between three and six individual zinc finger repeats and can each recognize between 9 and 18 base pairs. If the zinc finger domains are specific for their intended target site then even a pair of 3-finger ZFNs that recognize a total of 18 base pairs can, in theory, target a single locus in a mammalian genome.
- One method to generate new zinc-finger arrays is to combine smaller zinc-finger "modules" of known specificity. The most common modular assembly process involves combining three separate zinc fingers that can each recognize a 3 base pair DNA sequence to generate a 3-finger array that can recognize a 9 base pair target site.
- selection-based approaches such as oligomerized pool engineering (OPEN) can be used to select for new zinc-finger arrays from randomized libraries that take into consideration context-dependent interactions between neighboring fingers.
- Engineered zinc fingers are available commercially; Sangamo Biosciences (Richmond, CA, USA) has developed a propriety platform (CompoZr®) for zinc-finger construction in partnership with Sigma–Aldrich (St. Louis, MO, USA).
- Non-limiting examples of genes that may be silenced or inhibited by permanently gene-editing TILs via a zinc finger method include include PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FO
- Non-limiting examples of genes that may be enhanced by permanently gene-editing TILs via a zinc finger method include CCR2, CCR4, CCR5, CXCR2, CXCR3, CX3CR1, IL- 2, IL-4, IL-7, IL-10, IL-15, IL-18, IL-21, the NOTCH 1/2 intracellular domain (ICD), and/or the NOTCH ligand mDLL1.
- Examples of systems, methods, and compositions for altering the expression of a target gene sequence by a zinc finger method, which may be used in accordance with embodiments of the present invention, are described in U.S.
- Other examples of systems, methods, and compositions for altering the expression of a target gene sequence by a zinc finger method which may be used in accordance with embodiments of the present invention, are described in Beane, et al., Mol.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days to obtain the second population of TILs, wherein the transition from step (c) to
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days to
- a microfluidic platform is used to temporarily disrupt the cell membranes of the third population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL- 7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist. In some embodiments, the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days, wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the second population of TILs to effect transfer of at
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- a method for expanding TILs into a therapeutic population may be carried out in accordance with any embodiment of the methods described herein (e.g., process 2A) or as described in PCT/US2017/058610, PCT/US2018/012605, or PCT/US2018/012633, wherein the method further comprises gene-editing at least a portion of the TILs by a Cas-CLOVER method.
- the use of a Cas-CLOVER method during the TIL expansion process causes expression of one or more immune checkpoint genes to be silenced or reduced in at least a portion of the therapeutic population of TILs.
- the use of a Cas-CLOVER method during the TIL expansion process causes expression of one or more immune checkpoint genes to be enhanced in at least a portion of the therapeutic population of TILs.
- Cas-CLOVER is a dimeric, high-fidelity site-specific nuclease (SSN) that consists of a fusion of catalytically dead SpCas9 (dCas9) with the nuclease domain from a Clostridium Clo051 type IIs restriction endonuclease (Madison, et al., “Cas-CLOVER is a novel high-fidelity nuclease for safe and robust generation of T SCM-enriched allogeneic CAR-T cells, Molecular Therapy - Nucleic Acids, 2022).
- Cas-CLOVER has been shown to have low off-target nuclease activity.
- Exemplary Cas-CLOVER systems include those described in WO2019/126578, the contents of which are incorporated herein by reference in their entirety.
- the Cas-CLOVER system comprises a fusion protein comprising, consisting essentially of, or consisting of a DNA localization component and an effector molecule.
- DNA localization components are capable of binding a specific DNA sequence.
- the DNA localization component is selected from, for example, a DNA-binding oligonucleotide, a DNA-binding protein, a DNA binding protein complex, and combinations thereof. Other suitable DNA binding components will be recognized by one of ordinary skill in the art.
- the DNA localization components comprise an oligonucleotide directed to a specific locus or loci in the genome.
- the oligonucleotide may be selected from DNA, RNA, DNA/RNA hybrids, and combinations thereof.
- the DNA localization components comprise a nucleotide binding protein or protein complex that binds an oligonucleotide when bound to a target DNA.
- the protein or protein complex may be capable of recognizing a feature selected from RNA-DNA heteroduplexes, R-loops, or combinations thereof.
- the DNA localization component comprises a protein or protein complex capable of recognizing an R-loop selected from Cas9, Cascade complex, RecA, RNase H, RNA polymerase, DNA polymerase, or a combination thereof.
- the DNA localization component comprises an engineered protein capable of binding to target DNA.
- the DNA localization component comprises a protein capable of binding a DNA sequence selected from meganuclease, zinc finger array, transcription activator-like (TAL) array, and combinations thereof.
- the DNA localization component comprises a protein that contains a naturally occurring DNA binding domain.
- the DNA localization component comprises a bZIP domain, a Helix- loop-helix, a Helix-turn-helix, a HMG-box, a Leucine zipper, a Zinc finger, or a combination thereof.
- the DNA localization component comprises an oligonucleotide directed to a specific locus in the genome.
- Exemplary oligonucleotides include, but are not limited to, DNA, RNA, DNA/RNA hybrids, and any combination thereof.
- the DNA localization component comprises a protein or a protein complex capable of recognizing a feature selected from RNA-DNA heteroduplexes, R-loops, and any combination thereof.
- Exemplary proteins or protein complexes capable of recognizing an R-loop include, but are not limited to, Cas9, Cascade complex, RecA, RNase H, RNA polymerase, DNA polymerase, and any combination thereof.
- the protein or protein complex capable of recognizing an R-loop comprises Cas9.
- the DNA localization component comprises a protein capable of binding a DNA sequence selected from meganuclease, Zinc Finger array, TAL array, and any combination thereof.
- the DNA localization component comprises an oligonucleotide directed to a target location in a genome and a protein capable of binding to a target DNA sequence.
- the DNA localization components comprise, consist essentially of, or consist of, at least one guide RNA (gRNA).
- the DNA localization components comprise, consist essentially of, or consist of, two gRNAs, wherein a first gRNA specifically binds to a first strand of a double-stranded DNA target sequence and a second gRNA specifically binds to a second strand of the double-stranded DNA target sequence.
- DNA localization components comprise, consist essentially of, or consist of, a DNA binding domain of a transcription activator-like effector nuclease (TALEN, also referred to as a TAL protein).
- TALEN transcription activator-like effector nuclease
- DNA localization components comprise, consist essentially of, or consist of, a DNA-binding domain of a TALEN, or TAL protein, derived from Xanthomonas or Ralstonia.
- Effector molecules [001111] In some embodiments, effector molecules are capable of a predetermined effect at a specific locus in the genome.
- effector molecules are not limited to, a transcription factor (activator or repressor), chromatin remodeling factor, nuclease, exonuclease, endonuclease, transposase, methytransferase, demethylase, acetyltransferase, deacetylase, kinase, phosphatase, integrase, recombinase, ligase, topoisomerase, gyrase, helicase, fluorophore, or any combination thereof.
- effector molecules comprise a transposase.
- effector molecules comprise a PB transposase (PBase).
- effector molecules comprise a nuclease.
- nucleases include restriction endonucleases, homing endonucleases, S1 nuclease, mung bean nuclease, pancreatic DNase I, micrococcal nuclease, yeast HO endonuclease, or any combination thereof.
- the effector molecule comprises a restriction endonuclease.
- the effector molecule comprises a Type IIS restriction endonuclease.
- effector molecules comprise an endonuclease.
- Non-limiting examples of the endonuclease include AciI, Mn1I, AlwI, BbvI, BccI, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, HgaI, HphI, HpyAV, Mbo1I, My1I, PleI, SfaNI, AcuI, BciVI, BfuAI, BmgBI, BmrI, BpmI, BpuEI, BsaI, BseRI, BsgI, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, BtsI, EarI, EciI, MmeI, NmeAIII, BbvCI, Bpu10I, BspQI, SapI, BaeI, BsaXI, CspCI, BfiI, MboII, Acc36I and Clo05
- effector molecule comprises BmrI, BfiI, or Clo051.
- effector molecules comprise, consist essentially of, or consist of, a homodimer or a heterodimer.
- effector molecules comprise, consist essentially of, or consist of, a nuclease, optionally an endonuclease.
- effector molecules including those effector molecules comprising a homodimer or a heterodimer, comprise, consist essentially of, or consist of, a Cas9, a Cas9 nuclease domain or a fragment thereof.
- the Cas9 is a catalytically inactive or “inactivated” Cas9 (dCas9 (SEQ ID NO: 302 and 303 of WO2019/126578)). In some embodiments, the Cas9 is a catalytically inactive or “inactivated” nuclease domain of Cas9. In some embodiments, the dCas9 is encoded by a shorter sequence that is derived from a full length, catalytically inactivated, Cas9, referred to herein as a “small” dCas9 or dSaCas9 (SEQ ID NO: 23 of WO2019/126578).
- the effector molecule comprises, consists essentially of, or consists of a homodimer or a heterodimer of one or more Type II nucleases. In some embodiments of the fusion protein, the effector molecule comprises, consists essentially of, or consists of a homodimer or a heterodimer of a Type II nuclease.
- the Type II nuclease comprises one or more of AciI, Mn1I, AlwI, BbvI, BccI, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, HgaI, HphI, HpyAV, Mbo1I, My1I, PleI, SfaNI, AcuI, BciVI, BfuAI, BmgBI, BmrI, BpmI, BpuEI, BsaI, BseRI, BsgI, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, BtsI, EarI, EciI, MmeI, NmeAIII, BbvCI, Bpu10I, BspQI, SapI, BaeI, BsaXI, CspCI, BfiI, MboII, Acc36I
- effector molecules comprising those effector molecules comprising a homodimer or a heterodimer, comprise, consist essentially of, or consist of, Clo051, BfiI or BmrI.
- effector molecules including those effector molecules comprising a homodimer or a heterodimer, comprise, consist essentially of, or consist of, a Cas9, a Cas9 nuclease domain or a fragment thereof that forms a heterodimer with Clo051, BfiI or BmrI.
- effector molecules comprising a homodimer or a heterodimer, comprise, consist essentially of, or consist of, a catalytically-inactive form of Cas9 (e.g. dCas9 or dSaCas9) or a fragment thereof that forms a heterodimer with Clo051.
- Cas9 e.g. dCas9 or dSaCas9
- An exemplary Clo05 l nuclease domain may comprise, consist essentially of or consist of, the amino acid sequence of: EGIKSNISLLKDELRGQISHISHEYLSLIDLAFDSKQNRLFEMKVLELLVNEYGFKGRH LGGSRKPDGIVYSTTLEDNFGIIVDTKAYSEGYSLPISQADEMERYVRENSNRDEEVN PNKWWENFSEEVKKYYFVFISGSFKGKFEEQLRRLSMTTGVNGSAVNVVNLLLGAE KIRSGEMTIEELERAMFNNSEFILKY (SEQ ID NO:386, SEQ ID NO: 34 of WO2018/169948).
- effector molecules comprising those effector molecules comprising a homodimer or a heterodimer, comprise, consist essentially of, or consist of, a DNA-binding domain of a TALEN, or TAL protein, derived from Xanthomonas or Ralstonia.
- effector molecules including those effector molecules comprising a homodimer or a heterodimer, comprise, consist essentially of, or consist of, a DNA-binding domain of a TALEN, or TAL protein, derived from Xanthomonas or Ralstonia that forms a homodimer or a heterodimer with Clo051, BfiI or BmrI.
- effector molecules comprising a homodimer or a heterodimer, comprise, consist essentially of, or consist of, a DNA-binding domain of a TALEN, or TAL protein, derived from Xanthomonas or Ralstonia that forms a homodimer or a heterodimer with Clo051.
- the fusion protein comprises, consists essentially of, or consists of, a DNA localization component and an effector molecule.
- the nucleic acid sequences encoding one or more components of the fusion protein can be operably linked, for example, in an expression vector.
- the fusion proteins are chimeric proteins.
- the fusion proteins are encoded by one or more recombinant nucleic acid sequences.
- the fusion proteins also include a linker region to operatively-link two components of the fusion protein.
- the fusion protein comprises, consists essentially of, or consists, of a DNA localization component and an effector molecule, operatively-linked by a linker region.
- the DNA localization component, the linker region, and the effector molecule can be encoded by one or more nucleic acid sequences inserted into an expression cassette and/or expression vector such that translation of the nucleic acid sequence results in the fusion protein.
- the fusion protein can comprise a non-covalent linkage between the DNA localization component and the effector molecule.
- the non- covalent linkage can comprise an antibody, an antibody fragment, an antibody mimetic, or a scaffold protein.
- Fusion proteins [001120]
- the DNA localization component comprises, consists essentially of or consists of, at least one gRNA
- the effector molecule comprises, consists essentially of, or consists of a Cas9, a Cas9 nuclease domain, or a fragment thereof.
- the DNA localization component comprises, consists essentially of, or consists of, at least one gRNA
- the effector molecule comprises, consists essentially of, or consist of an inactivated Cas9 (dCas9) or an inactivated nuclease domain.
- the DNA localization component comprises, consists essentially of, or consists of, at least one gRNA
- the effector molecule comprises, consists essentially of, or consist of an inactivated small Cas9 (dSaCas9).
- the effector molecule comprises, consists essentially of, or consists of a Cas9, dCas9, dSaCas9, or nuclease domain thereof, and a second endonuclease.
- the second endonuclease can comprise, consist essentially of, or consist of a Type IIS endonuclease, including, but not limited to, one or more of AciI, Mn1I, AlwI, BbvI, BccI, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, HgaI, HphI, HpyAV, Mbo1I, My1I, PleI, SfaNI, AcuI, BciVI, BfuAI, BmgBI, BmrI, BpmI, BpuEI, BsaI, BseRI, BsgI, BsmI, BspMI, BsrBI, BsrBI, BsrDI, BtgZI, BtsI, EarI, EciI, MmeI, NmeAIII, BbvCI, Bpu10I, BspQI, SapI, BaeI
- the DNA localization component comprises, consists essentially of, or consists of, a DNA-binding domain of a transcription activator-like effector nuclease (TALEN, also referred to as a TAL protein), and the effector molecule comprises, consists essentially of, or consists of, an endonuclease.
- TALEN transcription activator-like effector nuclease
- the DNA localization component comprises, consists essentially of, or consists of, a DNA-binding domain of a TALEN, or TAL protein, derived from Xanthomonas or Ralstonia
- the effector molecule comprises, consists essentially of, or consists of, a Type IIS endonuclease, including, but not limited to, one or more of AciI, Mn1I, AlwI, BbvI, BccI, BceAI, BsmAI, BsmFI, BspCNI, BsrI, BtsCI, HgaI, HphI, HpyAV, Mbo1I, My1I, PleI, SfaNI, AcuI, BciVI, BfuAI, BmgBI, BmrI, BpmI, BpuEI, BsaI, BseRI, BsgI, BsmI, BspMI, Bs
- an exemplary dCas9-Clo051 fusion protein may comprise, consist essentially of or consist of the amino acid sequence of SEQ ID NO: 305 or 307 of WO2019/126578 or the nucleic acid sequence of SEQ ID NO: 306 or 308 of WO2019/126578.
- the nuclease domain comprises, consists essentially of, or consists of, a dCas9 and Clo051.
- the nuclease domain comprises, consists essentially of, or consists of, a dSaCas9 and Clo051.
- the nuclease domain comprises, consists essentially of, or consists of, a Xanthomonas-TALE and Clo051. In some embodiments, the nuclease domain comprises, consists essentially of, or consists of, a Ralstonia-TALE and Clo051. In some embodiments, the fusion protein comprises dCas9-Clo051, dSaCas9-Clo051, Xanthomonas-TALE-Clo051, or Ralstonia- TALE-Clo051.
- a vector encoding the fusion protein comprises Csy4- T2A-Clo051-G4Slinker-dCas9 (Streptoccocus pyogenes) or pRT1-Clo051-dCas9 double NLS.
- a Cas-CLOVER system comprises a fusion protein comprising a DNA localization component and an effector molecule, wherein the DNA localization component hybridizes to a target sequence of a DNA molecule in a TIL, wherein the DNA molecule encodes and the TIL expresses at least one immune checkpoint molecule, and the effector molecule cleaves the DNA molecule, whereby expression of the at least one immune checkpoint molecule is altered.
- a Cas-CLOVER method comprises silencing or reducing the expression of one or more immune checkpoint genes in TILs by introducing a Cas-CLOVER system (e.g., dCas9-Clo051, dSaCas9-Clo051, Xanthomonas-TALE-Clo051, or Ralstonia-TALE-Clo051 fusion protein) specific to a target DNA sequence of the immune checkpoint gene(s).
- the fusion protein may be delivered as DNA, mRNA, protein.
- the Cas-CLOVER method either interrupts gene expression or modifies the genomic sequence by insertion, deletion, or substitution of one or more base pairs.
- DSBs may be repaired in the cells by non-homologous end joining (NHEJ), a mechanism which frequently causes insertions or deletions (indels) in the DNA. Indels often lead to frameshifts, creating loss of function alleles; for example, by causing premature stop codons within the open reading frame (ORF) of the targeted gene.
- the result is a loss-of-function mutation within the targeted immune checkpoint gene.
- HDR homology-directed repair
- the repair template preferably contains the desired edit as well as additional homologous sequence immediately upstream and downstream of the target gene (often referred to as left and right homology arms).
- Non-limiting examples of genes that may be silenced or inhibited by permanently gene-editing TILs via a Cas-CLOVER method include PD-1, TGIT, TET2, TGF ⁇ R2, PRA, BAFF (BR3), CTLA-4, LAG-3, HAVCR2 (TIM-3), Cish, TGF ⁇ , PKA, CBL-B, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, BTLA, CD160, TIGIT, TET2, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244, TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days, wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the second population of TILs to effect transfer of at
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days to obtain the second population of TILs, wherein the transition from step (c) to step (d) occurs without opening the system; (e) sterile electroporating the second population
- a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprises: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 and optionally comprising OKT-3 and/or a 4-1BB agonist antibody for about 3 to 11 days to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area; (d) stimulating the second population of TILs by adding OKT-3 and culturing for about 1 to 3 days, wherein the transition from step (c) to step (d) occurs without opening the system; (e) temporarily disrupting the cell membranes of the second population of TILs to effect transfer of
- a microfluidic platform is used to temporarily disrupt the cell membranes of the third population of TILs.
- the microfluidic platform is a SQZ vector-free microfluidic platform.
- the at least one immunomodulatory composition comprises an immunomodulatory agent fused to a membrane anchor (e.g., a membrane anchored immunomodulatory fusion protein described herein).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-7, IL-10, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist (e.g., a CD40L or an agonistic CD40 binding domain).
- the immunomodulatory agent is selected from the group consisting of IL-2, IL-12, IL-15, IL-18, IL-21, and a CD40 agonist. In some embodiments, the immunomodulatory agent is selected from the group consisting of IL-12, IL-15, IL-18, IL-21, and a CD40 agonist.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the third or fourth population of TILs or the second expansion step is performed by culturing the third or fourth population of TILs or performing the second expansion for a first period of about 1-7 days, at the end of the first period the culture is split into a plurality of subcultures, each of the plurality of subcultures is cultured with additional IL-2 for a second period of about 3-7 days, and at the end of the second period the plurality of subcultures are combined to provide the expanded number of TILs or the therapeutic population of TILs.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, or 11 days. [001135] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 4-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 5-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 6-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 7-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 8-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 9-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 10-11 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 4-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 5-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 6-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 7-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 8-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 9-10 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 4-9 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 5-9 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 6-9 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 7-9 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 8-9 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 3-8 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 3-7 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 3-6 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 3-5 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 3-4 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 4-8 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 4-7 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 4-6 days. [001161] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 4-6 days. [001162] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 5-8 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 5-7 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 5-6 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 6-8 days.
- the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 6-7 days. [001167] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 7-8 days. [001168] In some embodiments, the invention provides the method described in any of the preceding paragraphs as applicable above modified such that the step of culturing the first population of TILs or the first expansion step is performed for about 4-5 days.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Immunology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Hematology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Virology (AREA)
- Pharmacology & Pharmacy (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Developmental Biology & Embryology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2024544388A JP2025504908A (ja) | 2022-01-28 | 2023-01-27 | サイトカイン関連腫瘍浸潤リンパ球組成物及び方法 |
| EP23708111.2A EP4469065A1 (en) | 2022-01-28 | 2023-01-27 | Cytokine associated tumor infiltrating lymphocytes compositions and methods |
| US18/832,493 US20250099588A1 (en) | 2022-01-28 | 2023-01-27 | Cytokine associated tumor infiltrating lymphocytes compositions and methods |
| CA3243419A CA3243419A1 (en) | 2022-01-28 | 2023-01-27 | CYTOKINE-ASSOCIATED TUMOR-INFILTRATING LYMPHOCYTE COMPOSITIONS AND PROCESSES |
| TW112103170A TW202346573A (zh) | 2022-01-28 | 2023-01-30 | 細胞介素相關之腫瘤浸潤性淋巴球組合物及方法 |
Applications Claiming Priority (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202263304498P | 2022-01-28 | 2022-01-28 | |
| US63/304,498 | 2022-01-28 | ||
| US202263356933P | 2022-06-29 | 2022-06-29 | |
| US63/356,933 | 2022-06-29 | ||
| US202263394267P | 2022-08-01 | 2022-08-01 | |
| US63/394,267 | 2022-08-01 | ||
| US202263382493P | 2022-11-04 | 2022-11-04 | |
| US63/382,493 | 2022-11-04 | ||
| US202263429114P | 2022-11-30 | 2022-11-30 | |
| US63/429,114 | 2022-11-30 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023147488A1 true WO2023147488A1 (en) | 2023-08-03 |
Family
ID=85410360
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2023/061474 Ceased WO2023147488A1 (en) | 2022-01-28 | 2023-01-27 | Cytokine associated tumor infiltrating lymphocytes compositions and methods |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US20250099588A1 (enExample) |
| EP (1) | EP4469065A1 (enExample) |
| JP (1) | JP2025504908A (enExample) |
| CA (1) | CA3243419A1 (enExample) |
| TW (1) | TW202346573A (enExample) |
| WO (1) | WO2023147488A1 (enExample) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025054540A1 (en) * | 2023-09-08 | 2025-03-13 | Iovance Biotherapeutics, Inc. | Methods of gene-editing using programmable nucleases |
| WO2025113643A1 (en) | 2023-12-01 | 2025-06-05 | Gilead Sciences Inc. | Anti-fap-light fusion protein and use thereof |
| WO2025259871A1 (en) | 2024-06-14 | 2025-12-18 | Gilead Sciences, Inc. | Anti-ccr8 antibodies and uses thereof |
Citations (162)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0154316A2 (en) | 1984-03-06 | 1985-09-11 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US4704692A (en) | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| WO1988007089A1 (en) | 1987-03-18 | 1988-09-22 | Medical Research Council | Altered antibodies |
| US4902502A (en) | 1989-01-23 | 1990-02-20 | Cetus Corporation | Preparation of a polymer/interleukin-2 conjugate |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| US5019034A (en) | 1988-01-21 | 1991-05-28 | Massachusetts Institute Of Technology | Control of transport of molecules across tissue using electroporation |
| US5089261A (en) | 1989-01-23 | 1992-02-18 | Cetus Corporation | Preparation of a polymer/interleukin-2 conjugate |
| US5128257A (en) | 1987-08-31 | 1992-07-07 | Baer Bradford W | Electroporation apparatus and process |
| US5137817A (en) | 1990-10-05 | 1992-08-11 | Amoco Corporation | Apparatus and method for electroporation |
| US5173158A (en) | 1991-07-22 | 1992-12-22 | Schmukler Robert E | Apparatus and methods for electroporation and electrofusion |
| US5206344A (en) | 1985-06-26 | 1993-04-27 | Cetus Oncology Corporation | Interleukin-2 muteins and polymer conjugation thereof |
| WO1993011161A1 (en) | 1991-11-25 | 1993-06-10 | Enzon, Inc. | Multivalent antigen-binding proteins |
| US5232856A (en) | 1990-06-25 | 1993-08-03 | Firth Kevin L | Electroporation device |
| US5273525A (en) | 1992-08-13 | 1993-12-28 | Btx Inc. | Injection and electroporation apparatus for drug and gene delivery |
| US5279833A (en) | 1990-04-04 | 1994-01-18 | Yale University | Liposomal transfection of nucleic acids into animal cells |
| US5304120A (en) | 1992-07-01 | 1994-04-19 | Btx Inc. | Electroporation method and apparatus for insertion of drugs and genes into endothelial cells |
| US5318514A (en) | 1992-08-17 | 1994-06-07 | Btx, Inc. | Applicator for the electroporation of drugs and genes into surface cells |
| WO1996014339A1 (en) | 1994-11-05 | 1996-05-17 | The Wellcome Foundation Limited | Antibodies |
| US5593875A (en) | 1994-09-08 | 1997-01-14 | Genentech, Inc. | Methods for calcium phosphate transfection |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| WO1998005787A1 (en) | 1996-08-02 | 1998-02-12 | Bristol-Myers Squibb Company | A method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| US5766902A (en) | 1993-08-20 | 1998-06-16 | Therexsys Limited | Transfection process |
| WO1998040510A1 (en) | 1997-03-11 | 1998-09-17 | Regents Of The University Of Minnesota | Dna-based transposon system for the introduction of nucleic acid into dna of a cell |
| US5834250A (en) | 1988-10-28 | 1998-11-10 | Genentech, Inc. | Method for identifying active domains and amino acid residues in polypeptides and hormone variants |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5908635A (en) | 1994-08-05 | 1999-06-01 | The United States Of America As Represented By The Department Of Health And Human Services | Method for the liposomal delivery of nucleic acids |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| US6010613A (en) | 1995-12-08 | 2000-01-04 | Cyto Pulse Sciences, Inc. | Method of treating materials with pulsed electrical fields |
| US6025337A (en) | 1994-06-27 | 2000-02-15 | Johns Hopkins University | Solid microparticles for gene delivery |
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| US6056938A (en) | 1995-02-21 | 2000-05-02 | Imarx Pharaceutical Corp. | Cationic lipids and the use thereof |
| WO2000032767A1 (en) | 1998-12-03 | 2000-06-08 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | RECOMBINANT SOLUBLE Fc RECEPTORS |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6096871A (en) | 1995-04-14 | 2000-08-01 | Genentech, Inc. | Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US6242195B1 (en) | 1998-04-02 | 2001-06-05 | Genentech, Inc. | Methods for determining binding of an analyte to a receptor |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| WO2001081565A2 (de) | 2000-04-27 | 2001-11-01 | Max-Delbrück-Centrum für Molekulare Medizin | Sleeping beauty, ein transposonvektor mit breitem wirtsbereich für die genetische transformation bei wirbeltieren |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| WO2002044215A2 (en) | 2000-12-01 | 2002-06-06 | Cockbain, Julian | Hybrid antibodies |
| WO2002060919A2 (en) | 2000-12-12 | 2002-08-08 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| US6475994B2 (en) | 1998-01-07 | 2002-11-05 | Donald A. Tomalia | Method and articles for transfection of genetic material |
| US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
| US6534484B1 (en) | 1995-06-07 | 2003-03-18 | Inex Pharmaceuticals Corp. | Methods for encapsulating plasmids in lipid bilayers |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| WO2003074569A2 (en) | 2002-03-01 | 2003-09-12 | Immunomedics, Inc. | Bispecific antibody point mutations for enhancing rate of clearance |
| US6627442B1 (en) | 2000-08-31 | 2003-09-30 | Virxsys Corporation | Methods for stable transduction of cells with hiv-derived viral vectors |
| WO2004016750A2 (en) | 2002-08-14 | 2004-02-26 | Macrogenics, Inc. | FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| US6706289B2 (en) | 2000-10-31 | 2004-03-16 | Pr Pharmaceuticals, Inc. | Methods and compositions for enhanced delivery of bioactive molecules |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| WO2004035752A2 (en) | 2002-10-15 | 2004-04-29 | Protein Design Labs, Inc. | ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US20040110704A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells of which genome is modified |
| WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
| WO2004074455A2 (en) | 2003-02-20 | 2004-09-02 | Applied Molecular Evolution | Fc REGION VARIANTS |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| US6838261B1 (en) | 1999-06-08 | 2005-01-04 | Seattle Genetics, Inc. | Nucleic acids encoding anti-CD40 proteins and methods of producing recombinant anti-CD40 proteins |
| WO2005040217A2 (en) | 2003-10-17 | 2005-05-06 | Cambridge University Technical Services Limited | Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions |
| WO2005070963A1 (en) | 2004-01-12 | 2005-08-04 | Applied Molecular Evolution, Inc | Fc region variants |
| WO2005077981A2 (en) | 2003-12-22 | 2005-08-25 | Xencor, Inc. | Fc POLYPEPTIDES WITH NOVEL Fc LIGAND BINDING SITES |
| WO2005092925A2 (en) | 2004-03-24 | 2005-10-06 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
| US20050238649A1 (en) | 2003-11-06 | 2005-10-27 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| WO2005123780A2 (en) | 2004-04-09 | 2005-12-29 | Protein Design Labs, Inc. | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| US6984720B1 (en) | 1999-08-24 | 2006-01-10 | Medarex, Inc. | Human CTLA-4 antibodies |
| US20060024317A1 (en) | 2004-05-19 | 2006-02-02 | Medarex, Inc | Chemical linkers and conjugates thereof |
| WO2006019447A1 (en) | 2004-07-15 | 2006-02-23 | Xencor, Inc. | Optimized fc variants |
| US20060074008A1 (en) | 2002-07-31 | 2006-04-06 | Senter Peter D | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| WO2006047350A2 (en) | 2004-10-21 | 2006-05-04 | Xencor, Inc. | IgG IMMUNOGLOBULIN VARIANTS WITH OPTIMIZED EFFECTOR FUNCTION |
| WO2006085967A2 (en) | 2004-07-09 | 2006-08-17 | Xencor, Inc. | OPTIMIZED ANTI-CD20 MONOCONAL ANTIBODIES HAVING Fc VARIANTS |
| WO2006122442A1 (en) | 2005-05-14 | 2006-11-23 | Fudan University | Piggybac as a tool for genetic manipulation and analysis in vertebrates |
| US7189705B2 (en) | 2000-04-20 | 2007-03-13 | The University Of British Columbia | Methods of enhancing SPLP-mediated transfection using endosomal membrane destabilizers |
| US7332582B2 (en) | 2002-05-23 | 2008-02-19 | Curetech Ltd. | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| US7338660B2 (en) | 2001-11-09 | 2008-03-04 | Abgenix, Inc. | Methods of treating cancer and enhancing immune responses with antibodies that bind CD40 |
| US7411057B2 (en) | 1998-12-23 | 2008-08-12 | Amgen Fremont Inc. | Nucleic acids encoding human monoclonal antibodies to CTLA-4 |
| US7488802B2 (en) | 2002-12-23 | 2009-02-10 | Wyeth | Antibodies against PD-1 |
| US7687070B2 (en) | 1994-02-11 | 2010-03-30 | Life Technologies Corporation | Reagents for intracellular delivery of macromolecules |
| US7695715B2 (en) | 1999-03-31 | 2010-04-13 | Mor Research Applications Ltd. | Monoclonal antibodies, antigens and diagnosis and therapy of malignant diseases |
| WO2010085699A2 (en) | 2009-01-23 | 2010-07-29 | The Johns Hopkins University | Mammalian piggybac transposon and methods of use |
| WO2010099296A1 (en) | 2009-02-26 | 2010-09-02 | Transposagen Biopharmaceuticals, Inc. | Hyperactive piggybac transposases |
| WO2010099301A2 (en) | 2009-02-25 | 2010-09-02 | The Johns Hopkins University | Piggybac transposon variants and methods of use |
| US20110201118A1 (en) | 2010-06-14 | 2011-08-18 | Iowa State University Research Foundation, Inc. | Nuclease activity of tal effector and foki fusion protein |
| US8168179B2 (en) | 2002-07-03 | 2012-05-01 | Ono Pharmaceutical Co., Ltd. | Treatment method using anti-PD-L1 antibody |
| WO2012065086A1 (en) | 2010-11-12 | 2012-05-18 | Nektar Therapeutics | Conjugates of an il-2 moiety and a polymer |
| US8217149B2 (en) | 2008-12-09 | 2012-07-10 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| WO2013059343A1 (en) | 2011-10-17 | 2013-04-25 | Massachusetts Institute Of Technology | Intracellular delivery |
| US20130117869A1 (en) | 2011-04-05 | 2013-05-09 | Cellectis S.A. | Method for the generation of compact tale-nucleases and uses thereof |
| US8460927B2 (en) | 1999-11-30 | 2013-06-11 | Mayo Foundation For Medical Education And Research | B7-H1 antibodies and method of use |
| US8541203B2 (en) | 2007-08-22 | 2013-09-24 | The Regents Of The University Of California | Activatable binding polypeptides and methods of identification and use thereof |
| US8552154B2 (en) | 2008-09-26 | 2013-10-08 | Emory University | Anti-PD-L1 antibodies and uses therefor |
| US8556882B2 (en) | 2009-04-30 | 2013-10-15 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Inducible interleukin-12 |
| US8580244B2 (en) | 2002-09-06 | 2013-11-12 | Cerulean Pharma Inc. | Cyclodextrin-based polymers for therapeutics delivery |
| US8586526B2 (en) | 2010-05-17 | 2013-11-19 | Sangamo Biosciences, Inc. | DNA-binding proteins and uses thereof |
| US20130315884A1 (en) | 2012-05-25 | 2013-11-28 | Roman Galetto | Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy |
| US8686119B2 (en) | 2011-07-24 | 2014-04-01 | Curetech Ltd. | Variants of humanized immunomodulatory monoclonal antibodies |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| US8735553B1 (en) | 2013-09-13 | 2014-05-27 | Beigene, Ltd. | Anti-PD1 antibodies and their use as therapeutics and diagnostics |
| US8779108B2 (en) | 2009-11-24 | 2014-07-15 | Medimmune, Limited | Targeted binding agents against B7-H1 |
| US8778345B2 (en) | 2011-04-29 | 2014-07-15 | Apexigen, Inc. | Anti-CD40 antibodies |
| US8795965B2 (en) | 2012-12-12 | 2014-08-05 | The Broad Institute, Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| US20140227237A1 (en) | 2011-09-16 | 2014-08-14 | The Trustees Of The University Of Pennsylvania | Rna engineered t cells for the treatment of cancer |
| US8841418B2 (en) | 2011-07-01 | 2014-09-23 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to TIM3 |
| US8865406B2 (en) | 2012-12-12 | 2014-10-21 | The Broad Institute Inc. | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US8871906B2 (en) | 2007-09-04 | 2014-10-28 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Deletions in domain II of pseudomonas exotoxin a that remove immunogenic epitopes |
| US8889356B2 (en) | 2012-12-12 | 2014-11-18 | The Broad Institute Inc. | CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes |
| US8906616B2 (en) | 2012-12-12 | 2014-12-09 | The Broad Institute Inc. | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
| US8927697B2 (en) | 2008-09-12 | 2015-01-06 | Isis Innovation Limited | PD-1 specific antibodies and uses thereof |
| WO2015006700A1 (en) | 2013-07-12 | 2015-01-15 | University Of South Alabama | Minimal piggybac vectors for genome integration |
| US8993233B2 (en) | 2012-12-12 | 2015-03-31 | The Broad Institute Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| US8993731B2 (en) | 2010-03-11 | 2015-03-31 | Ucb Biopharma Sprl | PD-1 antibody |
| US20150203871A1 (en) | 2012-06-05 | 2015-07-23 | Cellectis | Transcription Activator-Like Effector (TALE) Fusion Protein |
| US9163087B2 (en) | 2010-06-18 | 2015-10-20 | The Brigham And Women's Hospital, Inc. | Bi-specific antibodies against TIM-3 and PD-1 for immunotherapy in chronic immune conditions |
| US9175082B2 (en) | 2012-05-31 | 2015-11-03 | Sorrento Therapeutics, Inc. | Antigen binding proteins that bind PD-L1 |
| US9205148B2 (en) | 2011-04-20 | 2015-12-08 | Medimmune, Llc | Antibodies and other molecules that bind B7-H1 and PD-1 |
| US9228180B2 (en) | 2007-07-04 | 2016-01-05 | Max-Delbruck-Centrum Fur Molekulare Medizin | Polypeptide variants of sleeping beauty transposase |
| US9244059B2 (en) | 2007-04-30 | 2016-01-26 | Immutep Parc Club Orsay | Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| US9283184B2 (en) | 2008-11-24 | 2016-03-15 | Massachusetts Institute Of Technology | Methods and compositions for localized agent delivery |
| US20160102324A1 (en) | 2013-05-29 | 2016-04-14 | Cellectis | New compact scaffold of cas9 in the type ii crispr system |
| US20160120906A1 (en) | 2013-05-13 | 2016-05-05 | Cellectis | Methods for engineering highly active t cell for immunotheraphy |
| WO2016161270A1 (en) | 2015-04-01 | 2016-10-06 | Anaptysbio, Inc. | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) |
| US9505839B2 (en) | 2012-07-02 | 2016-11-29 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (LAG-3), and uses thereof |
| WO2017008063A1 (en) | 2015-07-09 | 2017-01-12 | Massachusetts Institute Of Technology | Delivery of materials to anucleate cells |
| US9603944B2 (en) | 2013-09-27 | 2017-03-28 | Massachusetts Institute Of Technology | Carrier-free biologically-active protein nanostructures |
| WO2017053297A1 (en) | 2015-09-21 | 2017-03-30 | Trilink Biotechnologies, Inc. | Compositions and methods for synthesizing 5'-capped rnas |
| WO2017123663A1 (en) | 2016-01-12 | 2017-07-20 | Sqz Biotechnologies Company | Intracellular delivery of complexes |
| US9790490B2 (en) | 2015-06-18 | 2017-10-17 | The Broad Institute Inc. | CRISPR enzymes and systems |
| US20170326259A1 (en) | 2016-03-07 | 2017-11-16 | Actinium Pharmaceuticals, Inc. | Stabilized radiolabeled anti-cd45 immunoglobulin compositions |
| WO2018081473A1 (en) | 2016-10-26 | 2018-05-03 | Iovance Biotherapeutics, Inc. | Restimulation of cryopreserved tumor infiltrating lymphocytes |
| US9982278B2 (en) | 2014-02-11 | 2018-05-29 | The Regents Of The University Of Colorado, A Body Corporate | CRISPR enabled multiplexed genome engineering |
| WO2018129332A1 (en) | 2017-01-06 | 2018-07-12 | Iovance Biotherapeutics, Inc. | Expansion of tumor infiltrating lymphocytes (tils) with tumor necrosis factor receptor superfamily (tnfrsf) agonists and therapeutic combinations of tils and tnfrsf agonists |
| WO2018132496A1 (en) | 2017-01-10 | 2018-07-19 | Nektar Therapeutics | Multi-arm polymer conjugates of tlr agonist compounds and related immunotherapeutic treatment methods |
| US10041077B2 (en) | 2014-04-09 | 2018-08-07 | Dna2.0, Inc. | DNA vectors, transposons and transposases for eukaryotic genome modification |
| US20180245089A1 (en) | 2015-09-04 | 2018-08-30 | Sqz Biotechnologies Company | Intracellular delivery of biomolecules to cells comprising a cell wall |
| WO2018182817A1 (en) | 2017-03-29 | 2018-10-04 | Iovance Biotherapeutics, Inc. | Processes for production of tumor infiltrating lymphocytes and uses of same in immunotherapy |
| US20190010514A1 (en) | 2014-03-11 | 2019-01-10 | Cellectis | Method for generating t-cells compatible for allogenic transplantation |
| US10183979B2 (en) | 2012-06-08 | 2019-01-22 | Alkermes, Inc. | Fusion polypeptides comprising mucin-domain polypeptide linkers |
| WO2019046815A1 (en) | 2017-08-31 | 2019-03-07 | Poseida Therapeutics, Inc. | TRANSPOSON SYSTEM AND METHODS OF USE |
| WO2019136459A1 (en) * | 2018-01-08 | 2019-07-11 | Iovance Biotherapeutics, Inc. | Processes for generating til products enriched for tumor antigen-specific t-cells |
| WO2019157130A1 (en) | 2018-02-09 | 2019-08-15 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Tethered interleukin-15 and interleukin-21 |
| US20190275133A1 (en) | 2016-11-10 | 2019-09-12 | Nektar Therapeutics | Immunotherapeutic tumor treatment method |
| WO2019210131A1 (en) * | 2018-04-27 | 2019-10-31 | Iovance Biotherapeutics, Inc. | Closed process for expansion and gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy |
| US20200131239A1 (en) | 2016-06-13 | 2020-04-30 | Torque Therapeutics, Inc. | Methods and Compositions for Promoting Immune Cell Function |
| US20200181220A1 (en) | 2017-08-03 | 2020-06-11 | Synthorx, Inc. | Cytokine conjugates for the treatment of proliferative and infectious diseases |
| WO2020131547A1 (en) * | 2018-12-19 | 2020-06-25 | Iovance Biotherapeutics, Inc. | Methods of expanding tumor infiltrating lymphocytes using engineered cytokine receptor pairs and uses thereof |
| US10703789B2 (en) | 2012-04-02 | 2020-07-07 | Modernatx, Inc. | Modified polynucleotides for the production of secreted proteins |
| US20200270334A1 (en) | 2017-05-24 | 2020-08-27 | Novartis Ag | Antibody-cytokine engrafted proteins and methods of use in the treatment of cancer |
| WO2020205808A1 (en) | 2019-03-29 | 2020-10-08 | Torque Therapeutics, Inc. | Immunotherapeutic compositions and use thereof |
| US20200330601A1 (en) | 2019-02-06 | 2020-10-22 | Synthorx, Inc. | IL-2 Conjugates and Methods of Use Thereof |
| US20200330514A1 (en) | 2017-07-03 | 2020-10-22 | Torque Therapeutics, Inc. | Immunostimulatory Fusion Molecules and Uses Thereof |
| US20210038684A1 (en) | 2019-06-11 | 2021-02-11 | Alkermes Pharma Ireland Limited | Compositions and Methods for Cancer Immunotherapy |
| WO2021081378A1 (en) * | 2019-10-25 | 2021-04-29 | Iovance Biotherapeutics, Inc. | Gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy |
| WO2021218000A1 (zh) | 2020-04-30 | 2021-11-04 | 深圳市深研生物科技有限公司 | 用于逆转录病毒载体的生产细胞和包装细胞及其制备方法 |
| WO2021232632A1 (zh) | 2020-05-22 | 2021-11-25 | 深圳市深研生物科技有限公司 | 基于四环素和Cumate的共调控序列 |
| WO2021232633A1 (zh) | 2020-05-22 | 2021-11-25 | 深圳市深研生物科技有限公司 | 启动元件及包含其的逆转录病毒基因组转录盒和载体 |
| WO2022094473A1 (en) | 2020-11-02 | 2022-05-05 | Simcha IL-18, Inc. | Interleukin-18 variants and methods of use |
-
2023
- 2023-01-27 EP EP23708111.2A patent/EP4469065A1/en active Pending
- 2023-01-27 US US18/832,493 patent/US20250099588A1/en active Pending
- 2023-01-27 CA CA3243419A patent/CA3243419A1/en active Pending
- 2023-01-27 JP JP2024544388A patent/JP2025504908A/ja active Pending
- 2023-01-27 WO PCT/US2023/061474 patent/WO2023147488A1/en not_active Ceased
- 2023-01-30 TW TW112103170A patent/TW202346573A/zh unknown
Patent Citations (189)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0154316A2 (en) | 1984-03-06 | 1985-09-11 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| US5206344A (en) | 1985-06-26 | 1993-04-27 | Cetus Oncology Corporation | Interleukin-2 muteins and polymer conjugation thereof |
| US4704692A (en) | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| WO1988007089A1 (en) | 1987-03-18 | 1988-09-22 | Medical Research Council | Altered antibodies |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5128257A (en) | 1987-08-31 | 1992-07-07 | Baer Bradford W | Electroporation apparatus and process |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5019034B1 (en) | 1988-01-21 | 1995-08-15 | Massachusetts Inst Technology | Control of transport of molecules across tissue using electroporation |
| US5019034A (en) | 1988-01-21 | 1991-05-28 | Massachusetts Institute Of Technology | Control of transport of molecules across tissue using electroporation |
| US5834250A (en) | 1988-10-28 | 1998-11-10 | Genentech, Inc. | Method for identifying active domains and amino acid residues in polypeptides and hormone variants |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US5824778A (en) | 1988-12-22 | 1998-10-20 | Kirin-Amgen, Inc. | Chemically-modified G-CSF |
| US4902502A (en) | 1989-01-23 | 1990-02-20 | Cetus Corporation | Preparation of a polymer/interleukin-2 conjugate |
| US5089261A (en) | 1989-01-23 | 1992-02-18 | Cetus Corporation | Preparation of a polymer/interleukin-2 conjugate |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| US5279833A (en) | 1990-04-04 | 1994-01-18 | Yale University | Liposomal transfection of nucleic acids into animal cells |
| US5232856A (en) | 1990-06-25 | 1993-08-03 | Firth Kevin L | Electroporation device |
| US5137817A (en) | 1990-10-05 | 1992-08-11 | Amoco Corporation | Apparatus and method for electroporation |
| US5173158A (en) | 1991-07-22 | 1992-12-22 | Schmukler Robert E | Apparatus and methods for electroporation and electrofusion |
| WO1993011161A1 (en) | 1991-11-25 | 1993-06-10 | Enzon, Inc. | Multivalent antigen-binding proteins |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| US6350861B1 (en) | 1992-03-09 | 2002-02-26 | Protein Design Labs, Inc. | Antibodies with increased binding affinity |
| US5304120A (en) | 1992-07-01 | 1994-04-19 | Btx Inc. | Electroporation method and apparatus for insertion of drugs and genes into endothelial cells |
| US5273525A (en) | 1992-08-13 | 1993-12-28 | Btx Inc. | Injection and electroporation apparatus for drug and gene delivery |
| US5318514A (en) | 1992-08-17 | 1994-06-07 | Btx, Inc. | Applicator for the electroporation of drugs and genes into surface cells |
| US5766902A (en) | 1993-08-20 | 1998-06-16 | Therexsys Limited | Transfection process |
| US7687070B2 (en) | 1994-02-11 | 2010-03-30 | Life Technologies Corporation | Reagents for intracellular delivery of macromolecules |
| US6410517B1 (en) | 1994-06-27 | 2002-06-25 | Johns Hopkins University | Targeted gene delivery system |
| US6025337A (en) | 1994-06-27 | 2000-02-15 | Johns Hopkins University | Solid microparticles for gene delivery |
| US5908635A (en) | 1994-08-05 | 1999-06-01 | The United States Of America As Represented By The Department Of Health And Human Services | Method for the liposomal delivery of nucleic acids |
| US6110490A (en) | 1994-08-05 | 2000-08-29 | The United States Of America As Represented By The Department Of Health And Human Services | Liposomal delivery system for biologically active agents |
| US5593875A (en) | 1994-09-08 | 1997-01-14 | Genentech, Inc. | Methods for calcium phosphate transfection |
| WO1996014339A1 (en) | 1994-11-05 | 1996-05-17 | The Wellcome Foundation Limited | Antibodies |
| US6056938A (en) | 1995-02-21 | 2000-05-02 | Imarx Pharaceutical Corp. | Cationic lipids and the use thereof |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6998253B1 (en) | 1995-04-14 | 2006-02-14 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6096871A (en) | 1995-04-14 | 2000-08-01 | Genentech, Inc. | Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life |
| US6534484B1 (en) | 1995-06-07 | 2003-03-18 | Inex Pharmaceuticals Corp. | Methods for encapsulating plasmids in lipid bilayers |
| US6010613A (en) | 1995-12-08 | 2000-01-04 | Cyto Pulse Sciences, Inc. | Method of treating materials with pulsed electrical fields |
| US6078490A (en) | 1995-12-08 | 2000-06-20 | Cyto Pulse Sciences, Inc. | Method of treating materials with pulsed electrical fields |
| WO1998005787A1 (en) | 1996-08-02 | 1998-02-12 | Bristol-Myers Squibb Company | A method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| US6821505B2 (en) | 1997-03-03 | 2004-11-23 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| WO1998040510A1 (en) | 1997-03-11 | 1998-09-17 | Regents Of The University Of Minnesota | Dna-based transposon system for the introduction of nucleic acid into dna of a cell |
| US6489458B2 (en) | 1997-03-11 | 2002-12-03 | Regents Of The University Of Minnesota | DNA-based transposon system for the introduction of nucleic acid into DNA of a cell |
| US6475994B2 (en) | 1998-01-07 | 2002-11-05 | Donald A. Tomalia | Method and articles for transfection of genetic material |
| US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
| US6242195B1 (en) | 1998-04-02 | 2001-06-05 | Genentech, Inc. | Methods for determining binding of an analyte to a receptor |
| US6538124B1 (en) | 1998-04-02 | 2003-03-25 | Genentech, Inc. | Polypeptide variants |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| WO2000032767A1 (en) | 1998-12-03 | 2000-06-08 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | RECOMBINANT SOLUBLE Fc RECEPTORS |
| US7411057B2 (en) | 1998-12-23 | 2008-08-12 | Amgen Fremont Inc. | Nucleic acids encoding human monoclonal antibodies to CTLA-4 |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7695715B2 (en) | 1999-03-31 | 2010-04-13 | Mor Research Applications Ltd. | Monoclonal antibodies, antigens and diagnosis and therapy of malignant diseases |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| US6843989B1 (en) | 1999-06-08 | 2005-01-18 | Seattle Genetics, Inc. | Methods for the treatment and prevention of cancer using anti-CD40 antibodies |
| US6838261B1 (en) | 1999-06-08 | 2005-01-04 | Seattle Genetics, Inc. | Nucleic acids encoding anti-CD40 proteins and methods of producing recombinant anti-CD40 proteins |
| US6984720B1 (en) | 1999-08-24 | 2006-01-10 | Medarex, Inc. | Human CTLA-4 antibodies |
| US8460927B2 (en) | 1999-11-30 | 2013-06-11 | Mayo Foundation For Medical Education And Research | B7-H1 antibodies and method of use |
| US7189705B2 (en) | 2000-04-20 | 2007-03-13 | The University Of British Columbia | Methods of enhancing SPLP-mediated transfection using endosomal membrane destabilizers |
| WO2001081565A2 (de) | 2000-04-27 | 2001-11-01 | Max-Delbrück-Centrum für Molekulare Medizin | Sleeping beauty, ein transposonvektor mit breitem wirtsbereich für die genetische transformation bei wirbeltieren |
| US6627442B1 (en) | 2000-08-31 | 2003-09-30 | Virxsys Corporation | Methods for stable transduction of cells with hiv-derived viral vectors |
| US6706289B2 (en) | 2000-10-31 | 2004-03-16 | Pr Pharmaceuticals, Inc. | Methods and compositions for enhanced delivery of bioactive molecules |
| WO2002044215A2 (en) | 2000-12-01 | 2002-06-06 | Cockbain, Julian | Hybrid antibodies |
| US7083784B2 (en) | 2000-12-12 | 2006-08-01 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| WO2002060919A2 (en) | 2000-12-12 | 2002-08-08 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US7338660B2 (en) | 2001-11-09 | 2008-03-04 | Abgenix, Inc. | Methods of treating cancer and enhancing immune responses with antibodies that bind CD40 |
| WO2003074569A2 (en) | 2002-03-01 | 2003-09-12 | Immunomedics, Inc. | Bispecific antibody point mutations for enhancing rate of clearance |
| US20040110704A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells of which genome is modified |
| US7332582B2 (en) | 2002-05-23 | 2008-02-19 | Curetech Ltd. | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| US8168179B2 (en) | 2002-07-03 | 2012-05-01 | Ono Pharmaceutical Co., Ltd. | Treatment method using anti-PD-L1 antibody |
| US20060074008A1 (en) | 2002-07-31 | 2006-04-06 | Senter Peter D | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| WO2004016750A2 (en) | 2002-08-14 | 2004-02-26 | Macrogenics, Inc. | FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| US8580244B2 (en) | 2002-09-06 | 2013-11-12 | Cerulean Pharma Inc. | Cyclodextrin-based polymers for therapeutics delivery |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| WO2004035752A2 (en) | 2002-10-15 | 2004-04-29 | Protein Design Labs, Inc. | ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS |
| US7488802B2 (en) | 2002-12-23 | 2009-02-10 | Wyeth | Antibodies against PD-1 |
| WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
| WO2004074455A2 (en) | 2003-02-20 | 2004-09-02 | Applied Molecular Evolution | Fc REGION VARIANTS |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| WO2005040217A2 (en) | 2003-10-17 | 2005-05-06 | Cambridge University Technical Services Limited | Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions |
| US20050238649A1 (en) | 2003-11-06 | 2005-10-27 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| WO2005077981A2 (en) | 2003-12-22 | 2005-08-25 | Xencor, Inc. | Fc POLYPEPTIDES WITH NOVEL Fc LIGAND BINDING SITES |
| WO2005070963A1 (en) | 2004-01-12 | 2005-08-04 | Applied Molecular Evolution, Inc | Fc region variants |
| WO2005092925A2 (en) | 2004-03-24 | 2005-10-06 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
| WO2005123780A2 (en) | 2004-04-09 | 2005-12-29 | Protein Design Labs, Inc. | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| US20060024317A1 (en) | 2004-05-19 | 2006-02-02 | Medarex, Inc | Chemical linkers and conjugates thereof |
| WO2006085967A2 (en) | 2004-07-09 | 2006-08-17 | Xencor, Inc. | OPTIMIZED ANTI-CD20 MONOCONAL ANTIBODIES HAVING Fc VARIANTS |
| WO2006019447A1 (en) | 2004-07-15 | 2006-02-23 | Xencor, Inc. | Optimized fc variants |
| WO2006047350A2 (en) | 2004-10-21 | 2006-05-04 | Xencor, Inc. | IgG IMMUNOGLOBULIN VARIANTS WITH OPTIMIZED EFFECTOR FUNCTION |
| WO2006122442A1 (en) | 2005-05-14 | 2006-11-23 | Fudan University | Piggybac as a tool for genetic manipulation and analysis in vertebrates |
| US9244059B2 (en) | 2007-04-30 | 2016-01-26 | Immutep Parc Club Orsay | Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| US9228180B2 (en) | 2007-07-04 | 2016-01-05 | Max-Delbruck-Centrum Fur Molekulare Medizin | Polypeptide variants of sleeping beauty transposase |
| US8541203B2 (en) | 2007-08-22 | 2013-09-24 | The Regents Of The University Of California | Activatable binding polypeptides and methods of identification and use thereof |
| US8871906B2 (en) | 2007-09-04 | 2014-10-28 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Deletions in domain II of pseudomonas exotoxin a that remove immunogenic epitopes |
| US8927697B2 (en) | 2008-09-12 | 2015-01-06 | Isis Innovation Limited | PD-1 specific antibodies and uses thereof |
| US8552154B2 (en) | 2008-09-26 | 2013-10-08 | Emory University | Anti-PD-L1 antibodies and uses therefor |
| US9102727B2 (en) | 2008-09-26 | 2015-08-11 | Emory University | Human anti-PD-1 antibodies and uses therefor |
| US9283184B2 (en) | 2008-11-24 | 2016-03-15 | Massachusetts Institute Of Technology | Methods and compositions for localized agent delivery |
| US8217149B2 (en) | 2008-12-09 | 2012-07-10 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| WO2010085699A2 (en) | 2009-01-23 | 2010-07-29 | The Johns Hopkins University | Mammalian piggybac transposon and methods of use |
| WO2010099301A2 (en) | 2009-02-25 | 2010-09-02 | The Johns Hopkins University | Piggybac transposon variants and methods of use |
| WO2010099296A1 (en) | 2009-02-26 | 2010-09-02 | Transposagen Biopharmaceuticals, Inc. | Hyperactive piggybac transposases |
| US8556882B2 (en) | 2009-04-30 | 2013-10-15 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Inducible interleukin-12 |
| US8779108B2 (en) | 2009-11-24 | 2014-07-15 | Medimmune, Limited | Targeted binding agents against B7-H1 |
| US8993731B2 (en) | 2010-03-11 | 2015-03-31 | Ucb Biopharma Sprl | PD-1 antibody |
| US8586526B2 (en) | 2010-05-17 | 2013-11-19 | Sangamo Biosciences, Inc. | DNA-binding proteins and uses thereof |
| US20110201118A1 (en) | 2010-06-14 | 2011-08-18 | Iowa State University Research Foundation, Inc. | Nuclease activity of tal effector and foki fusion protein |
| US9163087B2 (en) | 2010-06-18 | 2015-10-20 | The Brigham And Women's Hospital, Inc. | Bi-specific antibodies against TIM-3 and PD-1 for immunotherapy in chronic immune conditions |
| US20140328791A1 (en) | 2010-11-12 | 2014-11-06 | Nektar Therapeutics | Conjugates of an IL-2 Moiety and a Polymer |
| WO2012065086A1 (en) | 2010-11-12 | 2012-05-18 | Nektar Therapeutics | Conjugates of an il-2 moiety and a polymer |
| US20130117869A1 (en) | 2011-04-05 | 2013-05-09 | Cellectis S.A. | Method for the generation of compact tale-nucleases and uses thereof |
| US9205148B2 (en) | 2011-04-20 | 2015-12-08 | Medimmune, Llc | Antibodies and other molecules that bind B7-H1 and PD-1 |
| US8778345B2 (en) | 2011-04-29 | 2014-07-15 | Apexigen, Inc. | Anti-CD40 antibodies |
| US8841418B2 (en) | 2011-07-01 | 2014-09-23 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to TIM3 |
| US8686119B2 (en) | 2011-07-24 | 2014-04-01 | Curetech Ltd. | Variants of humanized immunomodulatory monoclonal antibodies |
| US20140227237A1 (en) | 2011-09-16 | 2014-08-14 | The Trustees Of The University Of Pennsylvania | Rna engineered t cells for the treatment of cancer |
| WO2013059343A1 (en) | 2011-10-17 | 2013-04-25 | Massachusetts Institute Of Technology | Intracellular delivery |
| US20140287509A1 (en) | 2011-10-17 | 2014-09-25 | Massachusetts Institute Of Technology | Intracellular Delivery |
| US10703789B2 (en) | 2012-04-02 | 2020-07-07 | Modernatx, Inc. | Modified polynucleotides for the production of secreted proteins |
| US20180021379A1 (en) | 2012-05-25 | 2018-01-25 | Cellectis | Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy |
| US20130315884A1 (en) | 2012-05-25 | 2013-11-28 | Roman Galetto | Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy |
| US9175082B2 (en) | 2012-05-31 | 2015-11-03 | Sorrento Therapeutics, Inc. | Antigen binding proteins that bind PD-L1 |
| US20150203871A1 (en) | 2012-06-05 | 2015-07-23 | Cellectis | Transcription Activator-Like Effector (TALE) Fusion Protein |
| US10183979B2 (en) | 2012-06-08 | 2019-01-22 | Alkermes, Inc. | Fusion polypeptides comprising mucin-domain polypeptide linkers |
| US9505839B2 (en) | 2012-07-02 | 2016-11-29 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (LAG-3), and uses thereof |
| US8945839B2 (en) | 2012-12-12 | 2015-02-03 | The Broad Institute Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| US8993233B2 (en) | 2012-12-12 | 2015-03-31 | The Broad Institute Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| US8999641B2 (en) | 2012-12-12 | 2015-04-07 | The Broad Institute Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| US8932814B2 (en) | 2012-12-12 | 2015-01-13 | The Broad Institute Inc. | CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes |
| US8906616B2 (en) | 2012-12-12 | 2014-12-09 | The Broad Institute Inc. | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
| US8895308B1 (en) | 2012-12-12 | 2014-11-25 | The Broad Institute Inc. | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US8889356B2 (en) | 2012-12-12 | 2014-11-18 | The Broad Institute Inc. | CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes |
| US8871445B2 (en) | 2012-12-12 | 2014-10-28 | The Broad Institute Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| US8865406B2 (en) | 2012-12-12 | 2014-10-21 | The Broad Institute Inc. | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US8771945B1 (en) | 2012-12-12 | 2014-07-08 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| US8795965B2 (en) | 2012-12-12 | 2014-08-05 | The Broad Institute, Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| US20160120906A1 (en) | 2013-05-13 | 2016-05-05 | Cellectis | Methods for engineering highly active t cell for immunotheraphy |
| US20160102324A1 (en) | 2013-05-29 | 2016-04-14 | Cellectis | New compact scaffold of cas9 in the type ii crispr system |
| WO2015006700A1 (en) | 2013-07-12 | 2015-01-15 | University Of South Alabama | Minimal piggybac vectors for genome integration |
| US8735553B1 (en) | 2013-09-13 | 2014-05-27 | Beigene, Ltd. | Anti-PD1 antibodies and their use as therapeutics and diagnostics |
| US9603944B2 (en) | 2013-09-27 | 2017-03-28 | Massachusetts Institute Of Technology | Carrier-free biologically-active protein nanostructures |
| US9982278B2 (en) | 2014-02-11 | 2018-05-29 | The Regents Of The University Of Colorado, A Body Corporate | CRISPR enabled multiplexed genome engineering |
| US20190010514A1 (en) | 2014-03-11 | 2019-01-10 | Cellectis | Method for generating t-cells compatible for allogenic transplantation |
| US10041077B2 (en) | 2014-04-09 | 2018-08-07 | Dna2.0, Inc. | DNA vectors, transposons and transposases for eukaryotic genome modification |
| WO2016161270A1 (en) | 2015-04-01 | 2016-10-06 | Anaptysbio, Inc. | Antibodies directed against t cell immunoglobulin and mucin protein 3 (tim-3) |
| US9790490B2 (en) | 2015-06-18 | 2017-10-17 | The Broad Institute Inc. | CRISPR enzymes and systems |
| WO2017008063A1 (en) | 2015-07-09 | 2017-01-12 | Massachusetts Institute Of Technology | Delivery of materials to anucleate cells |
| US20180201889A1 (en) | 2015-07-09 | 2018-07-19 | Massachusetts Institute Of Technology | Delivery of materials to anucleate cells |
| US20180245089A1 (en) | 2015-09-04 | 2018-08-30 | Sqz Biotechnologies Company | Intracellular delivery of biomolecules to cells comprising a cell wall |
| WO2017053297A1 (en) | 2015-09-21 | 2017-03-30 | Trilink Biotechnologies, Inc. | Compositions and methods for synthesizing 5'-capped rnas |
| WO2017123663A1 (en) | 2016-01-12 | 2017-07-20 | Sqz Biotechnologies Company | Intracellular delivery of complexes |
| US20170326259A1 (en) | 2016-03-07 | 2017-11-16 | Actinium Pharmaceuticals, Inc. | Stabilized radiolabeled anti-cd45 immunoglobulin compositions |
| US20200131239A1 (en) | 2016-06-13 | 2020-04-30 | Torque Therapeutics, Inc. | Methods and Compositions for Promoting Immune Cell Function |
| WO2018081473A1 (en) | 2016-10-26 | 2018-05-03 | Iovance Biotherapeutics, Inc. | Restimulation of cryopreserved tumor infiltrating lymphocytes |
| US10517894B2 (en) | 2016-10-26 | 2019-12-31 | Iovance Biotherapeutics, Inc. | Restimulation of cryopreserved tumor infiltrating lymphocytes |
| US20190275133A1 (en) | 2016-11-10 | 2019-09-12 | Nektar Therapeutics | Immunotherapeutic tumor treatment method |
| WO2018129332A1 (en) | 2017-01-06 | 2018-07-12 | Iovance Biotherapeutics, Inc. | Expansion of tumor infiltrating lymphocytes (tils) with tumor necrosis factor receptor superfamily (tnfrsf) agonists and therapeutic combinations of tils and tnfrsf agonists |
| US20200121719A1 (en) | 2017-01-06 | 2020-04-23 | Iovance Biotherapeutics, Inc. | Expansion of tumor infiltrating lymphocytes (tils) with tumor necrosis factor receptor superfamily (tnfrsf) agonists and therapeutic combinations of tils and tnfrsf agonists |
| WO2018132496A1 (en) | 2017-01-10 | 2018-07-19 | Nektar Therapeutics | Multi-arm polymer conjugates of tlr agonist compounds and related immunotherapeutic treatment methods |
| WO2018182817A1 (en) | 2017-03-29 | 2018-10-04 | Iovance Biotherapeutics, Inc. | Processes for production of tumor infiltrating lymphocytes and uses of same in immunotherapy |
| US10894063B2 (en) | 2017-03-29 | 2021-01-19 | Iovance Biotherapeutics, Inc. | Processes for production of tumor infiltrating lymphocytes and uses of same in immunotherapy |
| US20200270334A1 (en) | 2017-05-24 | 2020-08-27 | Novartis Ag | Antibody-cytokine engrafted proteins and methods of use in the treatment of cancer |
| US20200330514A1 (en) | 2017-07-03 | 2020-10-22 | Torque Therapeutics, Inc. | Immunostimulatory Fusion Molecules and Uses Thereof |
| US20200181220A1 (en) | 2017-08-03 | 2020-06-11 | Synthorx, Inc. | Cytokine conjugates for the treatment of proliferative and infectious diseases |
| WO2019046815A1 (en) | 2017-08-31 | 2019-03-07 | Poseida Therapeutics, Inc. | TRANSPOSON SYSTEM AND METHODS OF USE |
| WO2019136459A1 (en) * | 2018-01-08 | 2019-07-11 | Iovance Biotherapeutics, Inc. | Processes for generating til products enriched for tumor antigen-specific t-cells |
| WO2019157130A1 (en) | 2018-02-09 | 2019-08-15 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Tethered interleukin-15 and interleukin-21 |
| WO2019210131A1 (en) * | 2018-04-27 | 2019-10-31 | Iovance Biotherapeutics, Inc. | Closed process for expansion and gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy |
| WO2020131547A1 (en) * | 2018-12-19 | 2020-06-25 | Iovance Biotherapeutics, Inc. | Methods of expanding tumor infiltrating lymphocytes using engineered cytokine receptor pairs and uses thereof |
| US20200330601A1 (en) | 2019-02-06 | 2020-10-22 | Synthorx, Inc. | IL-2 Conjugates and Methods of Use Thereof |
| WO2020205808A1 (en) | 2019-03-29 | 2020-10-08 | Torque Therapeutics, Inc. | Immunotherapeutic compositions and use thereof |
| US20210038684A1 (en) | 2019-06-11 | 2021-02-11 | Alkermes Pharma Ireland Limited | Compositions and Methods for Cancer Immunotherapy |
| WO2021081378A1 (en) * | 2019-10-25 | 2021-04-29 | Iovance Biotherapeutics, Inc. | Gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy |
| WO2021218000A1 (zh) | 2020-04-30 | 2021-11-04 | 深圳市深研生物科技有限公司 | 用于逆转录病毒载体的生产细胞和包装细胞及其制备方法 |
| WO2021232632A1 (zh) | 2020-05-22 | 2021-11-25 | 深圳市深研生物科技有限公司 | 基于四环素和Cumate的共调控序列 |
| WO2021232633A1 (zh) | 2020-05-22 | 2021-11-25 | 深圳市深研生物科技有限公司 | 启动元件及包含其的逆转录病毒基因组转录盒和载体 |
| WO2022094473A1 (en) | 2020-11-02 | 2022-05-05 | Simcha IL-18, Inc. | Interleukin-18 variants and methods of use |
Non-Patent Citations (73)
| Title |
|---|
| "Genbank Accession", Database accession no. NM 00000585 |
| "Genbank", Database accession no. NM_0001291041 |
| ALFEI ET AL., NATURE, vol. 571, 2019, pages 265 - 269 |
| BACHMAIER ET AL., NATURE, vol. 403, 2000, pages 211 - 216 |
| BESSARD ET AL., MOLECULAR CANCER THERAPEUTICS, vol. 8, 2009, pages 2736 - 45 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BLOOM ET AL., , J. IMMUNOTHER., 2018 |
| BOETTCHERMCMANUS, MOL. CELL REVIEW, vol. 58, 2015, pages 575 - 585 |
| BOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| BUZZI ET AL., CANCER RESEARCH, vol. 52, 1992, pages 4027 - 4035 |
| CEPKOPEAR, CUR. PROT. MOL. BIOL., 1996, pages 1 - 9,16 |
| CHEN AND OKAY, CELL. BIOL., vol. 7, 1987, pages 2745 - 2752 |
| CHENOKAY, MOL. CELL. BIOL., vol. 7, 1987, pages 2745 - 2752 |
| COX ET AL., NATURE MEDICINE, vol. 21, no. 2, 2015 |
| DING ET AL., CADINANOS AND BRADLEY, 2005 |
| DOYLE ET AL., NUCLEIC ACIDS RESEARCH, vol. 40, 2012, pages W117 - W122 |
| DUCKERT ET AL., PROTEIN ENGINEERING, DESIGN & SELECTION, vol. 17, no. 1, 2004, pages 107 - 112 |
| DULL ET AL., J. VIROLOGY, vol. 72, 1998, pages 8463 - 71 |
| FEHNIGERCALIGIURI, BLOOD, vol. 97, 2001, pages 14 - 32 |
| FELGNER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 84, 1987, pages 7413 - 7417 |
| FORGET ET AL., FRONTIERS IMMUNOLOGY, vol. 8, 2017, pages 908 |
| FRYMACKALL, BLOOD, vol. 99, 2002, pages 3892 - 904 |
| GAUTRON ET AL., MOLECULAR THERAPY: NUCLEIC ACIDS, vol. 9, 2017, pages 312 - 321 |
| GRAHAMVAN DER EB, VIROLOGY, vol. 52, 1973, pages 456 - 467 |
| GREISBECK ET AL., J. IMMUNOLOGY, vol. 195, 2015 |
| HACKETT ET AL., MOL. THERAPY, vol. 18, 2010, pages 674 - 83 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| JUILLERAT ET AL., SCIENTIFIC REPORTS, vol. 5, no. 8150, 2015 |
| KHALIL ET AL., ADVANCES IN CANCER RESEARCH, vol. 128, 2015, pages 1 - 68 |
| KLEINSTIVER BP ET AL., NATURE, 6 January 2016 (2016-01-06) |
| KURTULUS ET AL., THE JOURNAL OF CLINICAL INVESTIGATION, vol. 125, no. 11, 2015, pages 4053 - 4062 |
| LEVINE ET AL., PROC. NAT'LACAD. SCI., vol. 103, 2006, pages 17372 - 77 |
| LIESCHKE ET AL., NATURE BIOTECHNOLOGY, vol. 15, 1997, pages 35 - 40 |
| LIU ET AL., SCI. REP., vol. 7, no. 1, 2017, pages 2193 |
| MALEK, ANNU. REV. IMMUNOL., vol. 26, 2008, pages 453 - 79 |
| MARIN-ACEVEDO ET AL., JOURNAL OF HEMATOLOGY & ONCOLOGY, vol. 11, 2018, pages 39 |
| MARIN-ACEVEDO ET AL., OURNAL OF HEMATOLOGY & ONCOLOGY, vol. 11, 2018, pages 39 |
| NELSON, J. IMMUNOL., vol. 172, 2004, pages 3983 - 88 |
| NEUZILLET ET AL., PHARMACOLOGY & THERAPEUTICS, vol. 147, 2015, pages 22 - 31 |
| PALMER ET AL., JOURNAL OFEXPERIMENTAL MEDICINE, vol. 212, no. 12, 2015, pages 2095 |
| PENG ET AL., CLIN. CANCER RES., vol. 16, 2010, pages 5458 |
| PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596 |
| QIN ET AL., MOLECULAR CANCER, vol. 18, 2019, pages 155 |
| R. E. BIRDB. W. WALKER: "Single Chain Antibody Variable Regions", TIBTECH, vol. 9, 1991, pages 132 - 137 |
| R. RAAGM. WHITLOW: "Single Chain Fvs", FASEB, vol. 9, 1995, pages 73 - 80 |
| RAN ET AL., NAT PROTOC., vol. 8, no. 11, November 2013 (2013-11-01), pages 2281 - 2308 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329 |
| ROSE ET AL., BIOTECHNIQUES, vol. 10, 1991, pages 520 - 525 |
| ROSENBERG ET AL., NEW ENG. J. OFMED., vol. 319, 1988, pages 1676 |
| RUBINSTEIN ET AL., PROC NATL ACAD SCI U.S.A., vol. 103, 2006, pages 9166 - 71 |
| SAPIO ET AL., EXCLI JOURNAL, vol. 13, 2014, pages 843 - 855 |
| SHAREI ET AL., PLOS ONE, 2015 |
| SHAREI ET AL., PNAS, 2013 |
| SHIELDS ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 26733 - 26740 |
| SLAYMAKER IM ET AL., SCIENCE, 1 December 2015 (2015-12-01) |
| SPERTINI ET AL., IMMUNOLOGY, vol. 113, no. 4, 2004, pages 441 - 452 |
| SPOLSKILEONARD, NAT. REV. DRUG. DISC., vol. 13, 2014, pages 379 - 95 |
| STEINKEBORISH, RESPIR. RES., vol. 2, 2001, pages 66 - 70 |
| SWARTZ ET AL., CANCER RES., vol. 72, 2012, pages 2473 |
| TARENTINO ET AL., BIOCHEM., vol. 14, 1975, pages 5516 - 5523 |
| TSONG, BIOPHYS. J., vol. 60, 1991, pages 297 - 306 |
| UMANA ET AL., NAT. BIOTECH., vol. 17, 1999, pages 176 - 180 |
| VALTON ET AL., METHODS, vol. 69, 2014, pages 151 - 170 |
| WALLNER ET AL., CLIN. DEV. IMMUNOL., 2012, pages 692639 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WEI ET AL., J OF IMMUNOL., vol. 167, pages 277 - 282 |
| WIGLER ET AL., PROC. NATL. ACAD. SCI., vol. 76, 1979, pages 1373 - 1376 |
| XUE ET AL., CELL & GENE THERAPY INSIGHTS, vol. 8, no. 2, 2022, pages 199 - 209 |
| YAMANE-OHNUKI ET AL., BIOTECHNOL. BIOENG., vol. 87, 2004, pages 614 - 622 |
| YU ET AL., NATURE IMMUNOLOGY, vol. 10, no. 1, 2009, pages 48 - 57 |
| ZHU ET AL., JOURNAL OF IMMUNOLOGY, vol. 183, 2009, pages 3598 - 6007 |
| ZUFFEREY ET AL., NAT. BIOTECHNOL., vol. 15, 1997, pages 871 - 75 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025054540A1 (en) * | 2023-09-08 | 2025-03-13 | Iovance Biotherapeutics, Inc. | Methods of gene-editing using programmable nucleases |
| WO2025113643A1 (en) | 2023-12-01 | 2025-06-05 | Gilead Sciences Inc. | Anti-fap-light fusion protein and use thereof |
| WO2025259871A1 (en) | 2024-06-14 | 2025-12-18 | Gilead Sciences, Inc. | Anti-ccr8 antibodies and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2025504908A (ja) | 2025-02-19 |
| TW202346573A (zh) | 2023-12-01 |
| EP4469065A1 (en) | 2024-12-04 |
| US20250099588A1 (en) | 2025-03-27 |
| CA3243419A1 (en) | 2023-08-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2022165260A1 (en) | Methods of making modified tumor infiltrating lymphocytes and their use in adoptive cell therapy | |
| WO2022125941A1 (en) | Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with braf inhibitors and/or mek inhibitors | |
| WO2023009716A1 (en) | Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with kras inhibitors | |
| US20250099588A1 (en) | Cytokine associated tumor infiltrating lymphocytes compositions and methods | |
| WO2022133140A1 (en) | Treatment with tumor infiltrating lymphocyte therapies in combination with ctla-4 and pd-1 inhibitors | |
| JP2024519029A (ja) | Pd-1遺伝子編集された腫瘍浸潤リンパ球及び免疫療法におけるその使用 | |
| WO2022133149A1 (en) | Treatment of cancers with tumor infiltrating lymphocytes | |
| WO2023196877A1 (en) | Treatment of nsclc patients with tumor infiltrating lymphocyte therapies | |
| KR20240109615A (ko) | Pd-1 talen 녹다운을 사용한 til 생성물의 생성 방법 | |
| WO2022187741A2 (en) | Tumor storage and cell culture compositions | |
| WO2023147486A1 (en) | Tumor infiltrating lymphocytes engineered to express payloads | |
| EP4522202A1 (en) | Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with an il-15r agonist | |
| WO2025101484A1 (en) | Treatment of endometrial cancers with tumor infiltrating lymphocyte therapies | |
| AU2024375198A1 (en) | Treatment of endometrial cancers with tumor infiltrating lymphocyte therapies | |
| WO2023004074A2 (en) | Method for cryopreservation of solid tumor fragments | |
| WO2024098027A1 (en) | Methods for tumor infiltrating lymphocyte (til) expansion related to cd39/cd103 selection | |
| WO2023086803A1 (en) | Methods of expansion treatment utilizing cd8 tumor infiltrating lymphocytes | |
| WO2023049862A1 (en) | Expansion processes and agents for tumor infiltrating lymphocytes |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23708111 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024544388 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2023708111 Country of ref document: EP Effective date: 20240828 |
|
| WWP | Wipo information: published in national office |
Ref document number: 18832493 Country of ref document: US |