WO2023132333A1 - がんを処置するための医薬組成物 - Google Patents
がんを処置するための医薬組成物 Download PDFInfo
- Publication number
- WO2023132333A1 WO2023132333A1 PCT/JP2023/000019 JP2023000019W WO2023132333A1 WO 2023132333 A1 WO2023132333 A1 WO 2023132333A1 JP 2023000019 W JP2023000019 W JP 2023000019W WO 2023132333 A1 WO2023132333 A1 WO 2023132333A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- cells
- amino acid
- acid sequence
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68031—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being an auristatin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6869—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from a cell of the reproductive system: ovaria, uterus, testes, prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5011—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing antineoplastic activity
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5044—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
- G01N33/5759—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
Definitions
- This disclosure relates to the field of medicine. More specifically, this disclosure relates to pharmaceutical compositions for treating cancer.
- the present disclosure relates to methods of analyzing cancer recurrence, metastasis or resistance.
- the present disclosure relates to methods of identifying substances that damage cancer cells expressing leavelin.
- the present disclosure relates to methods of identifying factors that affect cancer recurrence, metastasis or resistance.
- the present disclosure relates to the use of Liebelin as a biomarker for cancer stem cells.
- CTCs Circulating tumor cells
- Cancer stem cells have attracted attention as cancer cells involved in cancer recurrence and/or metastasis. Cancer stem cells exist within tumors and can exist in a quiescent phase (G0 phase) out of the self-proliferating phase. In addition, cancer stem cells have the ability to self-proliferate and can divide into cancer stem cells identical to self and differentiated cancer cells. Such splitting is called asymmetric splitting. Cancer stem cells can be refractory to conventional cancer therapies such as chemotherapy due to these characteristics.
- Fujiwara H, et. al. "Promoting Roles of Embryonic Signals in Embryo Implantation and Placentation in Cooperation with Endocrine and Immune Systems. Int J Mol Sci. 2020 Mar 10;21(5):1885. doi: 10.3390/ijms2105 1885. Horie A, et. al., Laeverin/aminopeptidase Q induces trophoblast invasion during human early placentation. Hum Reprod. 2012 May;27(5):1267-76. doi: 10.1093/humrep/des068. Fujiwara H, et. al., Human extravillous trophoblasts express laeverin, a novel protein that belongs to membrane-bound gluzincin metallopeptidases.
- One object of the present disclosure is to provide a novel pharmaceutical composition for treating cancer.
- One object of the present disclosure is to provide a novel method for analyzing cancer recurrence, metastasis or resistance.
- One object of the present disclosure is to provide a novel method for identifying a substance that damages cancer cells expressing leavelin.
- One object of the present disclosure is to provide a novel method of identifying factors that affect cancer recurrence, metastasis or resistance.
- One object of the present disclosure is to provide a novel biomarker for cancer stem cells.
- CTCs circulating tumor cells
- Liebelin is not expressed in cancer cells cultured in an anchorage-dependent manner by adhesion culture, but becomes expressed in cancer cells cultured in an anchorage-independent manner by suspension culture, and It was found to be expressed in CTCs derived from biological samples.
- the present inventors have found that cancer cells expressing leavelin are involved in lymph node metastasis.
- the present inventors found that cancer cells expressing leavelin express indoleamine 2,3-dioxygenase-1 (IDO1), which is involved in suppressing T cell function and inducing differentiation of regulatory T cells. I found out more. In addition, the present inventors have found that contact with cells expressing leavelin induces the differentiation of monocytes into dendritic cells expressing IDO1. These findings indicate that cancer cells expressing leavelin form a tumor microenvironment (TME) that can evade attack from the immune system. Based on these findings, the present inventors have found that cancer cells expressing leavelin play an important role in recurrence, metastasis, or resistance, and completed the present invention.
- TAE tumor microenvironment
- the present inventor found that surviving cancer cells surrounded by necrotic cancer cells inside the primary tumor tissue express turns tolin.
- cancer cells expressing leavelin can evade attack from the immune system and metastasize within lymphatic vessels, lymph nodes, and blood vessels. Based on these findings, the present inventors have found that cancer cells expressing Liebelin can be cancer stem cells, and completed the present invention.
- a pharmaceutical composition for treating cancer comprising a substance that binds to leavelin.
- the pharmaceutical composition according to Item 1, wherein the substance that binds to leavelin comprises an anti- Kunststofferin antibody.
- the anti-leavelin antibody is (A) CDR-H1 with amino acid sequence: GYSFTDYI (SEQ ID NO: 1); CDR-H2 with amino acid sequence: INPYHAGI (SEQ ID NO: 2); and CDR-H3 with amino acid sequence: ARGSNYVYYYAMD (SEQ ID NO: 3).
- CDR-L1 comprising amino acid sequence: SSVSY (SEQ ID NO:4); CDR-L2 comprising amino acid sequence: ATS; and CDR-L3 comprising amino acid sequence: QQWSSNPPT (SEQ ID NO:5) Light Chain Variable Region (B) Amino acid sequence: CDR-H1 containing GYTFTSYW (SEQ ID NO: 11); CDR-H2 containing amino acid sequence: IDPYDSET (SEQ ID NO: 12); and CDR containing amino acid sequence: ARDYGSRYYAMD (SEQ ID NO: 13).
- CDR-L1 Heavy chain variable region comprising H3, and/or CDR-L1 comprising amino acid sequence: ENVVTY (SEQ ID NO: 14); CDR-L2 comprising amino acid sequence: GAS; and CDR comprising amino acid sequence: GQGYSYP (SEQ ID NO: 15) - a light chain variable region comprising L3, (C) CDR-H1 with amino acid sequence: GYTFTSYW (SEQ ID NO: 11); CDR-H2 with amino acid sequence: IDPYDSET (SEQ ID NO: 12); and CDR-H3 with amino acid sequence: ARDYGSRYYAMD (SEQ ID NO: 13).
- CDR-L1 comprising the amino acid sequence: STISY (SEQ ID NO: 16); CDR-L2 comprising the amino acid sequence: DTS; and CDR-L3 comprising the amino acid sequence: QQWSSNPP (SEQ ID NO: 17).
- a heavy chain variable region comprising CDR-H1 comprising the amino acid sequence: GYTFTDYY (SEQ ID NO: 18); and CDR-H2 comprising the amino acid sequence: IYPRSGHS (SEQ ID NO: 19), and/or amino acids Item 2, comprising a light chain variable region comprising CDR-L1 comprising sequence: QSLLYSNIQKNY (SEQ ID NO: 20); CDR-L2 comprising amino acid sequence: WAS; and CDR-L3 comprising amino acid sequence: QQYYSYP (SEQ ID NO: 21).
- the pharmaceutical composition according to .
- [Item 4] The pharmaceutical composition according to item 2 or item 3, wherein the anti-leavelin antibody has ADCC activity or CDC activity.
- [Item 5] The pharmaceutical composition according to any one of items 1 to 4, wherein the substance that binds to leavelin comprises a cytotoxic agent.
- the cytotoxic agent contains at least one selected from the group consisting of radioactive isotopes, chemotherapeutic agents, toxins, and enzymes.
- the cancer is recurrent cancer, metastatic cancer, or resistant cancer, or choriocarcinoma, placental trophoblastic tumor, ovarian cancer, fallopian tube cancer, or uterine cancer , cervical cancer, breast cancer, mammary adenocarcinoma, glioblastoma, colon cancer, prostate cancer, or leukemia.
- the pharmaceutical composition according to any one of items 1 to 6, which is for preventing cancer recurrence, metastasis or resistance.
- [Claim 8] A method for analyzing cancer recurrence, metastasis or resistance, comprising: detecting cancer cells expressing leverin in a biological sample from a subject in need thereof using a substance that binds leverin; and based on the detection results, cancer recurrence, metastasis or resistance
- a method comprising analyzing the [Claim 9] culturing cancer cells expressing cupboardin under conditions that allow contact with a test substance;
- a method for identifying a substance that damages leverin-expressing cancer cells comprising identifying a substance that damages leverin-expressing cancer cells.
- Figures 1a-1c are Liebelin (LVRN) staining images ( Figure 1a), nuclear staining images ( Figure 1b), and superimposed images of phase-contrast and Liebelin staining images in adherently cultured MCF7 cells ( Figure 1c). ).
- FIGS. 1d-1f are images of Liebelin staining (FIG. 1d), nuclear staining image (FIG. 1e), and superimposed images of phase-contrast and Liebelin staining images of Swan71 cells overexpressing Liebelin in adherent culture. (Fig. 1f).
- Figures 2a and 2b are respectively images of Lieberin staining and nuclear staining using 5-23 antibody, a monoclonal anti-Liebelin antibody, in MCF7 cell spheroids cultured in suspension.
- Figures 2c and 2d are Liebelin-stained and nuclear-stained images of MCF7 cell spheroids cultured in suspension using an anti-LVRN antibody, respectively.
- the bottom right bar in Figures 2a-2d is the scale bar indicating 50 ⁇ m.
- Figures 3a-3d are phase-contrast images of adherent cultured A375 cells (Fig. 3a), Liebelin-stained images (Fig. 3b), nuclear-stained images (Fig. 3c), and overlays of said images (Fig. 3d). .
- Figures 3e-3h are phase-contrast images of A375 cell spheroids cultured in suspension (Figure 3e), Liebelin-stained images (Figure 3f), nuclear-stained images ( Figure 3g), and overlays of the Liebelin-stained and nuclear-stained images.
- a merged image FIG. 3h.
- Figures 3i-l are phase-contrast images of adherent cultured A2780 cells (Fig. 3i), Liebelin-stained images (Fig. 3j), nuclear-stained images (Fig. 3k), and superimposed images of said images (Fig. 3l). .
- Figures 3m-3p are phase-contrast images of A2780 cell spheroids cultured in suspension (Figure 3m), Liebelin-stained images (Figure 3n), nuclear-stained images ( Figure 3o), and overlays of the Liebelin-stained and nuclear-stained images.
- a merged image Fig. 3p).
- the bottom right bar in FIGS. 3a-3p is the scale bar indicating 50 ⁇ m.
- FIG. 4a is a bar graph showing the relative amount of Liebelin mRNA transcripts (normalized to 1) in A375 cell line cultured in suspension (Spheroid) relative to transcript levels in A375 cell line cultured in adherence (monolayer). is.
- FIG. 4b is a bar graph showing the relative abundance of Liebelin mRNA transcripts in the A2780 cell line.
- Figure 4c is a bar graph showing the relative abundance of Liebelin mRNA transcripts in CaSki cell lines.
- Figure 4d is a bar graph showing the relative abundance of Liebelin mRNA transcripts in the SiHa cell line.
- FIG. 5a is a fluorescence image showing spheroids positive for leavelin (white arrows).
- FIG. 5a is a fluorescence image showing spheroids positive for leavelin (white arrows).
- FIG. 5b is a fluorescence image showing that the spheroids (white arrows) in FIG. 5a are EpCAM-positive.
- Figure 5c is a fluorescence image showing that the spheroids (white arrows) in Figure 5a are CD45 negative.
- FIG. 5d is a superimposed image of the fluorescence images of FIGS. 5a-5c. The images enclosed by white squares in FIGS. 5a-5d are enlarged images of the spheroids indicated by the white arrows.
- the bottom right bar in Figures 5a-5d is the scale bar indicating 20 ⁇ m.
- FIG. 6 is a bar graph showing relative transcription levels of Lieberin (LVRN) and IDO1, respectively, in cancer cell spheroids.
- FIG. 7a is a bar graph showing the relative expression levels of four genes (OAS2, IFIT1, IFIT3 and ISG15) in THP-1 cells cultured under conditions that allowed direct contact with Swan71 cells.
- FIG. 7b is a bar graph showing the relative expression levels of the genes in THP-1 cells cultured under conditions that do not allow direct contact with Swan71 cells.
- FIG. 8a is a bar graph showing the relative expression levels of four genes (OAS2, IFIT1, IFIT3 and ISG15) in THP-1 cells cultured in the presence of varying concentrations of recombinant Lieberin (rLVRN).
- FIG. 8b is a bar graph showing the relative expression levels of the genes in THP-1 cells cultured in the presence of rLVRN-immobilized beads ( ⁇ : rLVRN+beads) or free rLVRN ( ⁇ : rLVRN).
- Figures 9a-9c show the relative expression levels of ISG15 in THP-1 cells cultured in the presence of INF- ⁇ ( Figure 9a), INF- ⁇ ( Figure 9b), and rLVRN ( Figure 9c), respectively. is a bar graph showing.
- FIG. 8a is a bar graph showing the relative expression levels of four genes (OAS2, IFIT1, IFIT3 and ISG15) in THP-1 cells cultured in the presence of varying concentrations of recombinant Lieberin (rLVRN).
- FIGS. 11a-11c are bar graphs showing gene expression in CD14-positive cells (FIG. 11a), PBMCs (FIG. 11b) and THP-1 (FIG. 11c) cultured in the presence of rLVRN.
- Figure 12a is a CD14 and HLA-DR scattergram for PBMCs cultured in the presence of rLVRN.
- Figure 12b is a CD83 scattergram for the Q1 fraction of Figure 12a.
- FIG. 13a is a staining image showing Liebelin expression in melanoma cells A375 (1,000 cells/20 ⁇ L medium drop) cultured by the Hanging Drop method.
- FIG. 13b is a staining image showing intracellular uptake of anti-LVRN antibody in melanoma cell A375 (10 cells/20 ⁇ L medium drop) cultured by the Hanging Drop method in the presence of pHrodo-conjugated anti-LVRN antibody.
- FIG. 13a is a staining image showing Liebelin expression in melanoma cells A375 (1,000 cells/20 ⁇ L medium drop) cultured by the Hanging Drop method.
- FIG. 13b is a staining image showing intracellular uptake of anti-LVRN antibody in melanoma cell A375 (10 cells/20 ⁇ L medium drop
- FIG. 14a is a propidium iodide (PI) staining image of ovarian cancer cell SKOV3 spheroids cultured in the presence of monomethylauristatin E (MMAE)-conjugated 5-23 antibody.
- FIG. 14b is a PI-stained image of SKOV3 spheroids cultured in the presence of 5-23 antibody.
- FIG. 14c is a PI-stained image of SKOV3 spheroids.
- Figure 14d is an image of SKOV3 spheroids without PI staining.
- FIG. 15a is a stained image of the initial site of lymph node metastasis.
- FIG. 15b is an enlarged image of the area enclosed by the solid line marked with * in FIG. 15a.
- FIG. 15c is an enlarged image of the area enclosed by the solid line with ** in FIG. 15a.
- FIG. 15d is a stained image of a site where lymph node metastasis was established.
- FIG. 15e is an enlarged image of the area circled in solid lines in FIG. 15d.
- FIG. 16a is a lymphatic endothelial staining image of a lymph node near the efferent lymphatic vessel. Lymphatic endothelium was stained with Podoplanin.
- FIG. 16b is a HE-stained image of a lymph node near the efferent lymphatic vessel.
- FIG. 16c is a stained image of a lymph node near the efferent lymphatic vessel.
- FIG. 16d is an enlarged image of the area enclosed by the solid line marked with * in FIG. 16c.
- FIG. 16e is an enlarged image of the area enclosed by the solid line marked with ** in FIG. 16c.
- FIG. 17a is a stained image of a necrotic area in the primary tumor.
- FIG. 17a is a stained image of a necrotic area in the primary tumor.
- FIG. 17b is an enlarged image of the area enclosed by the solid line marked with * in FIG. 17a.
- FIG. 17b is an enlarged image of the area enclosed by the solid line marked with ** in FIG. 17a.
- FIG. 17d is an HE-stained image of a site other than the necrotic area in the primary tumor.
- FIG. 17e is a stained image of a site other than the necrotic area in the primary tumor.
- FIG. 18a is a HE-stained image of an ovarian cancer section after application of chemotherapy (TC therapy).
- FIG. 18b is an immunostaining image using an anti-Liebelin antibody of an ovarian cancer section after application of said chemotherapy.
- FIG. 18c is a HE-stained image of an ovarian cancer section after application of chemotherapy (DC therapy).
- FIG. 18d is an immunostaining image using an anti-Liebelin antibody of an ovarian cancer section after application of said chemotherapy.
- FIG. 19 is a line graph showing tumor sizes in cancer cell-implanted mice.
- FIG. 20 is a series of bar graphs showing expression levels of Liebelin in spheroids formed in cancer cell lines.
- compositions for treating cancer comprising agents that bind to leavelin.
- scherin or "LVRN” means a glycoprotein identified as a cell surface antigen of extravillous trophoblast cells (EVT) of the placenta.
- the amino acid sequence of Liebelin can be obtained from the site of Debank, which is provided by a public institution. Liebelin is, for example, 80% or more, 85% or more, 90% or more, 95% or more with the amino acid sequence described in SEQ ID NO: 10 when calculated using default parameters in homology search software (e.g., BLAST, FASTA) % or greater, 96% or greater, 97% or greater, 98% or greater, or 99% or greater sequence identity.
- Lieberin includes variants in which natural mutations have been introduced and which are functional. Mutations may be deletions, substitutions or additions or combinations thereof in a given amino acid sequence.
- Human Lieberin for example, consists essentially of 990 amino acids (SEQ ID NO: 10). Lieberin consisting essentially of the amino acid sequence set forth in SEQ ID NO: 10 may include post-translational modifications such as glycosylation.
- Liebelin has a mutation in the amino acid sequence of SEQ ID NO: 10 as long as it has its function, and is at least 85% (preferably 90% or more, more preferably 95%) the amino acid sequence of SEQ ID NO: 10. % or greater, 97% or greater, 98% or greater, or 99% or greater) sequence identity.
- sequence identity means the percentage of identical amino acids or nucleotides between two optimally aligned polynucleotide sequences or between two amino acid sequences. Sequence identity can be calculated using commercially or publicly available software such as BLAST+. "Deletion” of an amino acid means that an amino acid residue at any position in a given amino acid sequence is missing. "Addition” of an amino acid means that an amino acid residue is added or inserted at any position in a given amino acid sequence. An amino acid “substitution” means that an amino acid residue at any position in a given amino acid sequence is replaced with another amino acid residue. Amino acid substitutions may be, for example, conservative substitutions.
- a "substance that binds to leevelin” includes any substance that binds to leevelin with a predetermined binding capacity. ⁇ 10 ⁇ (MGPPSSSGFYVSHAVALLLAGLVAALLLALAVLAALYGHCERVPPSELPGLRDSEAESSPPLRQKPTPTPKPSSARELAVTTTPSNWRPPGPWDQLRLPPWLVPLHYDLELWPQLRPDELPAGSLPFTGRVNITVRCTVATSRLLLHSLFQDCERAEVRGPLSPGTGNATVGRVPVDDVWFALDTEYMVLELSEPLKPGSSYELQLSFSGLVKEDLREGLFLNVYTDQGERRALLASQLEPTFARYVFPCFDEPALKATFNITMIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFSTTPHMPTYLVAFVICDYDHVNRTERGKEIRIWARKDAIANGSADFALNITGPIFSFLEDLFNISYSLPKTDIIALSSFDNHAMENWGLMIFDESGLLLEPKDQLTE
- a substance that binds to leavelin for example, binds to leavelin with a predetermined binding ability, but does not substantially bind to substances other than leavelin.
- Substances that "substantially do not bind" to substances other than herein include substances that bind to substances other than notedlin with a dissociation constant of 10 -4 M or greater.
- Substances that do not substantially bind to substances other than herein are, for example, substances that bind to substances other than herein with a dissociation constant of 10 ⁇ 3 M or more or 10 ⁇ 2 M or more.
- a substance that binds to riebelin has a molecular weight of, for example, 10 kDa or more, 20 kDa or more, 30 kDa or more, 50 kDa or more, 75 kDa or more, 100 kDa or more, 125 kDa or more, 150 kDa or more, 175 kDa or more, or 200 kDa or more.
- a substance that binds to Liebelin has, for example, a molecular weight of less than 500 kDa, less than 450 kDa, less than 400 kDa, less than 350 kDa, less than 300 kDa, less than 250 kDa, or less than 200 kDa.
- Substances that bind to rieberin are, for example, low-molecular compounds, proteins (eg, antibodies), DNA, RNA, small interfering RNA, or antisense oligonucleotides.
- the substance that binds to herein is, for example, an anti-leverin antibody or a receptor to which whenlin binds, or a fragment thereof.
- a substance that binds to Lieberin is, for example, a monoclonal anti-Lieberin antibody or a polyclonal anti-Lieberin antibody.
- Anti-Liebelin antibodies are, for example, human or humanized antibodies.
- a substance that binds to Lieberin is, for example, any antigen-binding portion, or a fusion protein containing an antigen-binding portion, that competes with an anti-Lieberin antibody.
- antibody refers to a substance capable of binding a target through at least one antigen recognition site located in the variable region of an immunoglobulin molecule.
- Antibodies are, for example, intact polyclonal or monoclonal antibodies, or chimeric antibodies, or antigen-binding portions thereof. Antigen-binding portions are, for example, Fab, Fab', F(ab') 2 , Fv, fragments containing complementarity determining regions (CDRs), single chain antibodies (scFv), diabodies, triabodies, or tetrabodies. be.
- Antibodies are antibodies or antigen-binding fragments thereof of any class including, for example, IgG, IgA or IgM.
- variable region of an antibody refers to the variable region of the antibody light chain (V L ) or the variable region of the antibody heavy chain (V H ).
- the variable region of an antibody heavy or light chain comprises three complementarity determining regions (CDR) and four framework regions (FR).
- CDRs can be identified using, for example, IgBLAST of the National Center for Biotechnology Information (NCBI).
- the heavy chain variable region of an antibody includes CDR-H1, CDR-H2 and CDR-H3.
- the light chain variable region of an antibody includes CDR-L1, CDR-L2 and CDR-L3.
- monoclonal antibody means an antibody obtained from a population of substantially homogeneous antibodies.
- a substantially homologous antibody does not exclude an antibody containing natural mutations.
- Monoclonal antibodies can be prepared according to known methods.
- humanized antibody is of wholly or partly non-human origin and amino acids within the framework regions of its heavy and light chains of non-human origin are modified to avoid or minimize an immune response in humans.
- a humanized antibody for example, comprises or consists essentially of human C H and C L domains in the constant domains.
- Humanized antibodies for example, contain constant domains of human origin.
- human antibody means an antibody in which both the variable region consisting of the framework and CDR regions and the constant region are of human origin.
- chimeric antibody refers to an antibody in which amino acids in a constant region or portion thereof originating from a particular species have been replaced with amino acids originating from another species. Chimeric antibodies are, for example, antibodies whose variable regions are of murine origin and whose constant regions are of human origin.
- Antibodies can be prepared, for example, by isolating from natural sources (eg, vertebrates). Antibodies can be prepared, for example, from mammals such as humans, monkeys, pigs, horses, rabbits, dogs, cats and mice; birds such as chickens; fish such as sharks; or camelids such as llamas. Antibodies can be produced artificially, for example, according to techniques such as genetic engineering techniques. Antibodies can be prepared, for example, by selecting from an antibody library based on their ability to bind to Liebelin. Antibodies can be prepared, for example, using phage display methods.
- a pharmaceutical composition for treating cancer preferably comprises an anti-liebelin antibody that exhibits antibody-dependent cytotoxicity (ACDD activity) or complement-dependent cytotoxicity (CDC activity).
- a pharmaceutical composition for treating cancer preferably comprises a substance that binds to Lieberin, including a cytotoxic agent.
- ACDD activity means the activity of immune cells of the immune system to damage target cells.
- ACDD activity is a function of immune cells (e.g., microphages and natural killer cells) that have Fc receptors that bind to the Fc region of antibodies to target cells (e.g., cancers that express Lieberin) bound by antibodies that have an Fc region. It is played by killing cells).
- target cells e.g., cancers that express Lieberin
- CDC activity refers to activity that damages target cells by binding complement system proteins. CDC activity is mediated by complement components that bind to the Fc region of antibodies that lyse target cells bound by antibodies having the Fc region (for example, cancer cells expressing dutyin).
- Fc region means a region corresponding to a fragment obtained by partial digestion of an intact antibody with the protease papain.
- a substance that binds to Lieberin is, for example, an anti-Lieberin antibody that has ACDD activity or CDC activity.
- Said anti-leavelin antibody comprises, for example, an Fc region.
- the anti-leavelin antibody is, for example, a monoclonal antibody or a polyclonal antibody, preferably a monoclonal antibody.
- Substances that bind to Lieberin, including cytotoxic agents include, for example, anti-Lieberin antibodies having ACDD activity or CDC activity, and cytotoxic agents described below.
- the substance that binds to Lieberin, including a cytotoxic agent is at least selected from the group consisting of, for example, an anti-Lieberin antibody having ACDD activity or CDC activity, a radioisotope, a chemotherapeutic agent, an enzyme or fragment thereof, and a toxin. 1 type.
- Substances that bind to Lieberin are, for example, Amino acid sequence: CDR-H1 comprising or consisting of GYSFTDYI (SEQ ID NO: 1); A heavy chain variable region comprising CDR-H3 comprising or consisting of: Amino acid sequence: INPYHAGI (SEQ ID NO:2); and A heavy chain variable region comprising CDR-H3 comprising or consisting of: ARGSNYVYYYAMD (SEQ ID NO:3), and/or Amino acid sequence: SSVSY CDR-L1 comprising or consisting of (SEQ ID NO: 4); Amino acid sequence: CDR-L2 comprising or consisting of ATS; and Amino acid sequence: QQWSSNPPT (SEQ ID NO: 5). , or human antibodies).
- Substances that bind to Lieberin are, for example, Amino acid sequence: MSSPQPLKTLTLTMGGSWIFLFLLSGTAGAHSEIQLQQTGPELVKPGASVKISCKASGYSFTDYIMLWVKQSHGKSLEWIGNINPYHAGISYNLKFKGKATLTVDTSSSSTAYMQLNSLTSEDSAVYYCARGSNYVYYYAM DYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVT CVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFP
- the amino acid sequence set forth in SEQ ID NO:6 (also referred to as 5-23 antibody HC) includes the amino acid sequence set forth in SEQ ID NO:1, the amino acid sequence set forth in SEQ ID NO:2, and the amino acid sequence set forth in SEQ ID NO:3.
- the amino acid sequence set forth in SEQ ID NO:7 (also referred to as 5-23 antibody LC) comprises the amino acid sequence set forth in SEQ ID NO:4 and the amino acid sequence set forth in SEQ ID NO:5.
- Substances that bind to Lieberin are, for example, amino acid sequence: CDR-H1 comprising or consisting of GYTFTSYW (SEQ ID NO: 11); A heavy chain variable region comprising CDR-H3 comprising or consisting of: Amino acid sequence: IDPYDSET (SEQ ID NO: 12); and A heavy chain variable region comprising CDR-H3 comprising or consisting of: ARDYGSRYYAMD (SEQ ID NO: 13), and/or Amino acid sequence: ENVVTY.
- CDR-L1 comprising or consisting of (SEQ ID NO: 14); Amino acid sequence: CDR-L2 comprising or consisting of GAS; and Amino acid sequence: GQGYSYP (SEQ ID NO: 15). , or human antibodies).
- Substances that bind to Lieberin are, for example, amino acid sequence: CDR-H1 comprising or consisting of GYTFTSYW (SEQ ID NO: 11); A heavy chain variable region comprising CDR-H3 comprising or consisting of: Amino acid sequence: IDPYDSET (SEQ ID NO: 12); and A heavy chain variable region comprising CDR-H3 comprising or consisting of: ARDYGSRYYAMD (SEQ ID NO: 13), and/or Amino acid sequence: STISY CDR-L1 comprising or consisting of (SEQ ID NO: 16); Amino acid sequence: CDR-L2 comprising or consisting of DTS; and Amino acid sequence: QQWSSNPP (SEQ ID NO: 17). , or human antibodies).
- Substances that bind to Lieberin are, for example, A heavy chain variable region comprising a CDR-H2 comprising or consisting of: Amino acid sequence: GYTFTDYY (SEQ ID NO: 18); and A heavy chain variable region comprising CDR-H2 comprising or consisting of: IYPRSGHS (SEQ ID NO: 19); and/or Amino acid sequence: QSLLYSNIQKNY.
- CDR-L1 comprising or consisting of (SEQ ID NO: 20); Amino acid sequence: CDR-L2 comprising or consisting of WAS; and Amino acid sequence: QQYYSYP (SEQ ID NO: 21). , or human antibodies).
- Substances that bind to Lieberin are, for example, Amino acid sequence: MGWSYIILFLLATATCVHSQVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVRQRPEQGLEWIGRIDPYDSETHYNQKFKDKAILTVDKSSSTVHMQLSSLTSEDSAVYHCARDYGSRYYAMDYWGQGTSVTVS SAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSSGVHTFPAVLQSDLYTLSSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIEPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTTPDIKVTCVVVSKDDPEV QFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQ
- the amino acid sequence set forth in SEQ ID NO: 22 (also referred to as 94-2/129-5 antibody HC) includes the amino acid sequence set forth in SEQ ID NO: 11, the amino acid sequence set forth in SEQ ID NO: 12, and the amino acid sequence set forth in SEQ ID NO: 13. including.
- the amino acid sequence set forth in SEQ ID NO:23 (also referred to as 94-2 antibody LC) contains the amino acid sequence set forth in SEQ ID NO:14 and the amino acid sequence set forth in SEQ ID NO:15.
- Substances that bind to Lieberin are, for example, Amino acid sequence: MGWSYIILFLLATATCVHSQVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVRQRPEQGLEWIGRIDPYDSETHYNQKFKDKAILTVDKSSSTVHMQLSSLTSEDSAVYHCARDYGSRYYAMDYWGQGTSVTVS SAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSSGVHTFPAVLQSDLYTLSSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIEPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTTPDIKVTCVVVSKDDPEV QFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQ
- Substances that bind to Lieberin are, for example, Amino acid sequence: MEWIWIFLFILSGTAGVHSQVQLQQSGAELAGPGTSVRLSCKASGYTFTDYYIDWVKQRTGQGLEWIGEIYPRSGHSKYNEKFEGKATLTADKSSSTAYMHLSSLTSEDSAVYFCALYYGSSHWFAYWGQGTLVTVSAA KTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTTVDKKLEPSGPISTINPCPPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVS EDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVG
- amino acid sequence set forth in SEQ ID NO:25 (also referred to as 5-23J antibody HC) contains the amino acid sequence set forth in SEQ ID NO:18 and the amino acid sequence set forth in SEQ ID NO:19.
- amino acid sequence set forth in SEQ ID NO:26 (also referred to as 5-23J antibody LC) contains the amino acid sequence set forth in SEQ ID NO:20 and the amino acid sequence set forth in SEQ ID NO:21.
- Substances that bind to Liebelin are, for example, heavy chain CDR-H1 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 1), CDR-H2 (comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 2). (consisting essentially of) and CDR-H3 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 3).
- Substances that bind to Liebelin are, for example, the light chain CDR-L1 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 4), CDR-L2 (comprising or consisting essentially of the amino acid sequence ATS).
- Substances that bind to Liebelin are, for example, heavy chain CDR-H1 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 1), CDR-H2 (comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 2). and CDR-H3 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO:3), and CDR-L1 of the light chain (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO:4).
- a mouse antibody comprising CDR-L2 (comprising or consisting essentially of the amino acid sequence ATS) and CDR-L3 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 5), a humanized antibody or a human antibody (eg, an antigen-binding portion, or Fab, Fab', F(ab') 2 , or Fv).
- CDR-L2 comprising or consisting essentially of the amino acid sequence ATS
- CDR-L3 comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 5
- a humanized antibody or a human antibody eg, an antigen-binding portion, or Fab, Fab', F(ab') 2 , or Fv).
- Substances that bind to Liebelin are, for example, heavy chain CDR-H1 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 11), CDR-H2 (comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 12). (consisting essentially of) and CDR-H3 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 13). be.
- a substance that binds to Liebelin is, for example, a light chain CDR-L1 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 14 or 16), CDR-L2 (comprising or consisting essentially of the amino acid sequence ATS or WAS).
- a murine, humanized or human antibody e.g., an antigen-binding portion or light chain variable region
- a CDR-L3 comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 15 or 17
- Substances that bind to Liebelin are, for example, heavy chain CDR-H1 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 11), CDR-H2 (comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 12). and CDR-H3 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 13), and CDR-L1 of the light chain (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 14).
- a mouse antibody comprising CDR-L2 (comprising or consisting essentially of the amino acid sequence ATS) and CDR-L3 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 15), a humanized antibody or a human antibody (eg, an antigen-binding portion, or Fab, Fab', F(ab') 2 , or Fv).
- Substances that bind to Liebelin are, for example, heavy chain CDR-H1 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 11), CDR-H2 (comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 12).
- CDR-H3 comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 13
- CDR-L1 of the light chain comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 16
- a mouse antibody comprising CDR-L2 (comprising or consisting essentially of the amino acid sequence DTS) and CDR-L3 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 17)
- a humanized antibody or a human antibody eg, an antigen-binding portion, or Fab, Fab', F(ab') 2 , or Fv).
- a substance that binds to Liebelin is, for example, heavy chain CDR-H1 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 18) and CDR-H2 (comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 19).
- murine, humanized, or human antibodies eg, antigen-binding portions or heavy chain variable regions, including those consisting essentially of antibodies.
- a substance that binds to Liebelin is, for example, a light chain CDR-L1 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 20), CDR-L2 (comprising or consisting essentially of the amino acid sequence WAS) and CDR-L3 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO:21).
- a substance that binds to Liebelin is, for example, heavy chain CDR-H1 (comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO: 18) and CDR-H2 (comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 19).
- CDR-L1 comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO:20
- CDR-L2 comprising or consisting essentially of the amino acid sequence WAS
- CDRs of the light chain - a murine, humanized or human antibody e.g., an antigen-binding portion, or Fab, Fab', F(ab') 2
- L3 comprising or consisting essentially of the amino acid sequence set forth in SEQ ID NO:21) , or Fv.
- the substance that binds to Lieberin is, for example, at least 70% (e.g., 75% or more, 80% or more, 85% or more, preferably 90% or more, more preferably 95% or more of the amino acid sequence set forth in SEQ ID NO: 6) ), and/or at least 70% (e.g., 75% or more, 80% or more, 85% or more) to the amino acid sequence set forth in SEQ ID NO:7 a light chain comprising or consisting essentially of an amino acid sequence having a sequence identity of greater than or equal to 90%, more preferably greater than or equal to 95%), said heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 1 or consisting of a CDR-H1 comprising or consisting of the amino acid sequence set forth in SEQ ID NO:2, a CDR-H2 comprising or consisting of the amino acid sequence set forth in SEQ ID NO:2 and the light chain comprising or consisting of the amino acid sequence set forth in SEQ ID NO:4 an anti-Liebelin antibody (
- Substances that bind to Lieberin are, for example, Nucleotide sequence: heavy chain variable region encoded in (SEQ ID NO:8), and/or anti-Liebelin antibody (e.g., antigen binding portion, or Fab) comprising nucleotide sequence: light chain variable region encoded in (SEQ ID NO:9) , Fab′, F(ab′) 2 , or Fv).
- the nucleotide sequence set forth in SEQ ID NO:8 encodes the amino acid sequence set forth in SEQ ID NO:6.
- the nucleotide sequence set forth in SEQ ID NO:9 encodes the amino acid sequence set forth in SEQ ID NO:7.
- Substances that bind to Lieberin are, for example, Nucleotide sequence: heavy chain variable region encoded in (SEQ ID NO:27), and/or anti-Liebelin antibody (e.g., antigen binding portion, or Fab) comprising nucleotide sequence: light chain variable region encoded in (SEQ ID NO:28) , Fab′, F(ab′) 2 , or Fv).
- the nucleotide sequence set forth in SEQ ID NO:27 encodes the amino acid sequence set forth in SEQ ID NO:22.
- the nucleotide sequence set forth in SEQ ID NO:28 encodes the amino acid sequence set forth in SEQ ID NO:23.
- Substances that bind to Lieberin are, for example, Nucleotide sequence: heavy chain variable region encoded in (SEQ ID NO:27), and/or anti-Liebelin antibody (e.g., antigen binding portion, or Fab) comprising nucleotide sequence: light chain variable region encoded in (SEQ ID NO:29) , Fab′, F(ab′) 2 , or Fv).
- the nucleotide sequence set forth in SEQ ID NO:29 encodes the amino acid sequence set forth in SEQ ID NO:24.
- Substances that bind to Lieberin are, for example, Nucleotide sequence: heavy chain variable region encoded in (SEQ ID NO:30), and/or anti-Liebelin antibody (e.g., antigen binding portion, or Fab) comprising nucleotide sequence: light chain variable region encoded in (SEQ ID NO:31) , Fab′, F(ab′) 2 , or Fv).
- the nucleotide sequence set forth in SEQ ID NO:30 encodes the amino acid sequence set forth in SEQ ID NO:25.
- the nucleotide sequence set forth in SEQ ID NO:31 encodes the amino acid sequence set forth in SEQ ID NO:26.
- Cytotoxic agent includes substances that can inhibit or arrest the proliferation of, or kill or destroy cells.
- Cytotoxic agents are, for example, radioactive isotopes (e.g. radioisotopes of At211 , I131 , I125 , Y90, Re186 , Re188 , Sm153 , Bi212 , P32 , Pb212 or Lu);
- Chemotherapeutic agents e.g., monomethylauristatin E (MMAE), methotrexate, gemcitabine, adriamycin, vinca alkaloids, cisplatin, ifomide, dacarbazine, carboplatin, bleomycin, paclitaxel, carboplatin, vinorelbine, irinotecan (CPT-11), doxorubicin, mel faran, mitomycin C, chlorambucil, daunorubicin, erlotinib or other intercalating agents or growth inhibitors); enzymes such as nuclea
- a "substance that binds to Lieberin and contains a cytotoxic agent" can be produced, for example, by binding a substance that binds to Lieberin and a cytotoxic agent. Said binding may be, for example, a direct binding or an indirect binding.
- a direct bond is, for example, a covalent bond.
- Direct linkages are formed by, for example, the periodate method, the glutaraldehyde method, the maleimide method, and the N-hydroxysuccinimide method.
- the direct binding of the substance that binds to leavelin and the cytotoxic agent includes, for example, covalent binding of the substance that binds to leavelin and the cytotoxic agent via a linker.
- Indirect binding is, for example, non-covalent binding. Indirect binding is formed, for example, through biotin-streptavidin binding.
- the substance that binds to Lieberin, including a cytotoxic agent is, for example, at least one anti-Lieberin antibody, and at least one selected from the group consisting of radioisotopes and chemotherapeutic agents, enzymes or fragments thereof, and toxins ( For example, 1, 2 or 3 or more) cytotoxic agents.
- the substance that binds to Lieberin containing a cytotoxic agent is, for example, one kind of substance that binds to Lieberin and one kind selected from the group consisting of a radioisotope, a chemotherapeutic agent, an enzyme or a fragment thereof, and a toxin. including cytotoxic agents.
- Substances that bind to Lieberin, including cytotoxic agents include, for example, anti-Lieberin antibodies and chemotherapeutic agents or radioisotopes or combinations thereof. Substances that bind to Lieberin, including cytotoxic agents, include, for example, anti-Lieberin antibodies and chemotherapeutic agents.
- a substance that binds to Lieberin containing a cytotoxic agent includes, for example, one substance that binds to Lieberin and at least one (for example, one, two, or three or more) cytotoxic agents.
- the substance that binds to Lieberin, including a cytotoxic agent is, for example, an anti-Lieberin antibody and one kind of cytotoxic agent selected from the group consisting of a radioisotope, a chemotherapeutic agent, an enzyme or fragment thereof, and a toxin.
- a plurality of agents include, for example, an anti-Lieberin antibody and multiple chemotherapeutic agents or radioisotopes or combinations thereof.
- Substances that bind to Lieberin, including cytotoxic agents include, for example, an anti-Lieberin antibody and multiple or one chemotherapeutic agents.
- cancer cell means a cell that exhibits uncontrolled cell proliferation and/or invasive properties. Cancer cells, for example, grow in an anchorage-dependent or anchorage-independent manner. Cancer cells can form floating cell masses in which multiple cells are gathered. Cancer cells are, for example, circulating tumor cells (CTCs).
- CTCs circulating tumor cells
- circulating tumor cells or “CTCs” refers to cancer cells that have separated from primary or metastatic tumor tissue and circulate in the bloodstream. Cancer cells are, for example, cancer cells that express shutt present in blood vessels or lymph vessels.
- IDO1 or "indoleamine 2,3-dioxygenase-1" means the rate-limiting enzyme of the kynurenine pathway that metabolizes tryptophan to kynurenine (Folia Pharmacol. Jpn.) 142, 85-88 ( 2013)).
- IDO1 is highly expressed in tumor cells, the proliferation of T cells and NK cells around the tumor cells is suppressed or undergoes apoptosis (Folia Pharmacol. Jpn.) 142, 85-88 (2013). ). IDO1 induces the differentiation of regulatory T cells (Treg).
- Tregs in the surrounding environment of cancer cells expressing IDO1 promotes the survival of said cancer cells (Liu et al., Targeting the IDO1 pathway in cancer: from bench to bedside. Journal of Hematology & Oncology (2016) 11:100).
- the subject group in which mRNA encoding IDO1 was detected from CTCs in the blood had a longer overall survival compared to the subject group in which the mRNA was not detected.
- IDO1 can be measured, for example, by detecting or quantifying mRNA encoding IDO1.
- the mRNA can be detected or quantified, for example, by quantitative PCR (RT-qPCR) using reverse transcriptase.
- Examples of the present disclosure show that CTCs expressing Liebelin were present in blood samples from patients with recurrent and/or metastatic cancer.
- the disclosure also shows that the CTCs expressed indoleamine 2,3-dioxygenase-1 (IDO1).
- Cancers that can be treated by the pharmaceutical compositions of the present disclosure are, for example, cancers in subjects in which cancer cells (eg, CTCs) expressing leavelin are detected.
- Cancers that can be treated by the pharmaceutical compositions of the present disclosure are, for example, cancers in subjects in which cancer cells expressing Liebelin and IDO1 (eg, CTCs and floating cancer cells in lymphatics) have been detected.
- Cancers treated by the pharmaceutical compositions of the present disclosure are, for example, cancers after treatment with chemotherapy and/or radiotherapy.
- Examples of the present disclosure show that cancer cells expressing tolin are immune by IDO1 expressed by themselves and IDO1 expressed by dendritic cells that can be induced to differentiate from monocytes around the cancer cells. It is suggested that it forms a tumor microenvironment (TME) that can evade attack from the system.
- TME tumor microenvironment
- Examples of the present disclosure show that a substance that binds to Liebelin inhibits the expression of IDO1 in said cancer cells, and the conversion of monocytes to dendritic cells expressing IDO1 by contact with said cancer cells. suggesting that differentiation can be blocked.
- tumors include, for example, lung cancer, prostate cancer, breast cancer, breast cancer, pancreatic cancer, stomach cancer, rectal cancer, colon cancer, colorectal cancer, cancer of the thyroid, liver cancer, gallbladder cancer, neurological glioma, glioblastoma, uterine cancer, cervical cancer, renal cancer, ovarian cancer, fallopian tube cancer, esophageal cancer, melanoma, sarcoma, blood cancer, basal cell carcinoma, squamous cell Including cancer.
- Embodiments of the present disclosure show that cancer cells expressing or capable of expressing leavelin (e.g., under hostile conditions such as floating in lymphatics or in the presence of chemotherapeutic agents) , play an important role in cancer metastasis (eg, systemic metastasis) and/or recurrence (eg, local recurrence).
- cancers that are prevented or treated by the pharmaceutical compositions of the present disclosure are, for example, recurrent, metastatic, or resistant cancers.
- Examples of the present disclosure show that placental trophoblastic tumors express Liebelin. Examples of the present disclosure also demonstrate that B cells and monocytes among peripheral blood mononuclear cells express Liebelin.
- Cancers to be prevented or treated by the pharmaceutical composition according to the present disclosure include, for example, choriocarcinoma, placental trophoblastic tumor, ovarian cancer, fallopian tube cancer, uterine cancer, cervical cancer, glioblastoma cancer, colorectal cancer, prostate cancer, or leukemia.
- the cancer is, for example, choriocarcinoma, placental trophoblastic tumor, ovarian cancer, fallopian tube cancer, uterine cancer, cervical cancer, or leukemia.
- Said cancer is, for example, choriocarcinoma, placental trophoblastic tumor, ovarian cancer, fallopian tube cancer, uterine cancer, or cervical cancer.
- Said cancer is, for example, choriocarcinoma or placental trophoblastic tumor.
- a pharmaceutical composition according to the present disclosure includes, for example, a substance that binds to Lieberin (eg, an MMAE-conjugated anti-Lieberin antibody) that may be conjugated with a cytotoxic agent.
- Examples of the present disclosure show that the anti-Lieberin antibody itself (without a cytotoxic agent) induces cell death in ovarian cancer cells.
- the examples of the present disclosure also show that anti-Liebelin antibodies (without a cytotoxic agent) do not induce cell death in breast cancer cell lines and melanomas.
- Cancers that are prevented or treated by pharmaceutical compositions containing a substance that binds to Lieberin without a cytotoxic agent include, for example, choriocarcinoma, placental trophoblastic tumor, ovarian cancer, fallopian tube cancer, and uterine cancer. cancer, cervical cancer, glioblastoma, colorectal cancer, prostate cancer, or leukemia.
- Said cancer is, for example, choriocarcinoma, placental trophoblastic tumor, ovarian cancer, fallopian tube cancer, uterine cancer, or cervical cancer.
- Said cancer is, for example, ovarian cancer, fallopian tube cancer, uterine cancer or cervical cancer.
- Cancer recurrence or “recurrent cancer” is the growth of cancer cells at either or both the primary site and distant sites after the cancer has responded to treatment, including chemotherapy and/or surgery means that there is, or is likely to occur.
- Locally recurrent cancer means that cancer cells grow or are likely to grow at the primary site after responding to the treatment.
- Metalastasis of cancer or “metastatic cancer” refers to the spread or potential for cancer cells to spread from one part of the body (eg the uterus) to another part of the body (eg the lungs). means.
- a recurrent cancer, or metastatic cancer is a cancer that has been identified as at risk of recurring or metastasizing, or that has recurred or metastasizing, eg, according to known criteria.
- Metastatic cancer may be cancer after treatment, including surgery, or untreated cancer.
- Resistant cancer refers to cancer cells proliferating in a subject despite application of cancer therapy, including biologic therapy such as chemotherapy or immunotherapy, or the potential for such It means that there is a gender.
- Cancer therapy includes therapeutic agents (e.g., radioisotopes and chemotherapeutic agents (including immunotherapeutic agents)), radiation therapy, and surgical treatments, such as surgery, used in the treatment of cancer in mammals. Including intervention.
- a “pharmaceutical composition” is a mixture containing at least one active ingredient for preventing or treating cancer and a pharmaceutically acceptable carrier.
- a pharmaceutical composition according to the present disclosure comprises, for example, a substance that binds to Lieberin according to the present disclosure, and a pharmaceutically acceptable carrier.
- the pharmaceutical composition may be used in combination with other active ingredients (eg, chemotherapeutic agents) for preventing or treating cancer within the range that does not impair the effect of the substance that binds to Lieberin according to the present disclosure.
- Concomitant use includes administration of said other active ingredients before, after, or at the same time as administration of the agent that binds to leavelin according to the present disclosure. If the cancer is a resistant cancer, the pharmaceutical compositions of the present disclosure may be administered after or during cancer therapy, such as chemotherapy.
- the pharmaceutical composition may be in solid or liquid form, for example.
- Pharmaceutical compositions can be, for example, capsules, tablets, powders, solutions, suspensions, injections, or suppositories.
- Pharmaceutical compositions can be prepared according to known methods.
- a pharmaceutical composition can be prepared, for example, by mixing a substance that binds to Lieberin according to the present disclosure and a pharmaceutically acceptable carrier.
- a pharmaceutical composition according to the present disclosure can be administered to a subject by a known administration method.
- Known methods of administration include, for example, oral administration and parenteral administration.
- Parenteral administration includes, for example, intramuscular, intraperitoneal, intravenous, and subcutaneous administration.
- Treating means eliminating, reducing or ameliorating at least one symptom in a subject, prolonging overall survival, prolonging the duration of response, slowing disease progression, or Including preventing or delaying the onset of symptoms.
- Treatment of cancer includes, for example, alleviation of symptoms or complete eradication of cancer.
- Treatment of cancer includes, for example, prevention or treatment of recurrent, metastatic, or resistant cancer.
- One embodiment of this aspect provides a pharmaceutical composition for treating recurrent cancer, metastatic cancer, and resistant cancer.
- cancer in the subject can be treated.
- One aspect of the present disclosure provides a method of treating cancer comprising administering a pharmaceutical composition of the present disclosure to a subject in need thereof.
- subjects in need thereof include subjects in need of treating or preventing recurrent, metastatic, or resistant cancer.
- a subject in need thereof may be, for example, a cancer patient after receiving cancer therapy or a cancer patient before receiving cancer therapy.
- Another aspect of the present disclosure provides a method of preventing cancer recurrence and/or metastasis comprising administering a pharmaceutical composition of the present disclosure to a subject in need thereof.
- a pharmaceutical composition according to this aspect comprises a substance that binds to Lieberin according to the present disclosure, preferably the substance that binds to Lieberin comprises a cytotoxic agent according to the present disclosure.
- pharmaceutically acceptable carrier means any ingredient other than the therapeutic agent according to the present disclosure, which is highly safe and less allergic to subjects.
- Pharmaceutically acceptable carriers include, for example, aqueous or non-aqueous solvents, solutions (e.g. physiological saline), cryoprotectants (e.g. glycerol), water-soluble polymers (e.g. dextran), or buffers (e.g. phosphate buffer).
- a "subject” is, for example, a human or a non-human mammal.
- Non-human mammals include, for example, rodents such as mice, rats, guinea pigs and hamsters; non-human primates such as chimpanzees; artiodactyls such as cattle, goats and sheep; perissodactyla such as horses; rabbits and dogs , cats and other pets.
- Subjects are, for example, humans or non-human primates (eg, chimpanzees, monkeys, gorillas, gibbons and orangutans). The subject is preferably human.
- One aspect of the present disclosure is to detect cancer cells expressing leverin in a biological sample derived from a subject in need thereof using a substance that binds to leverin, and based on the detection results, Methods are provided comprising analyzing cancer recurrence, metastasis or resistance.
- a "subject in need thereof” is, for example, a subject identified as suffering from cancer by a specialist based on specific diagnostic criteria.
- a subject in need thereof has, for example, stage I, II, III, or IV cancer according to the cancer staging classification (e.g., the TNM classification presented by the Union for International Cancer Control (UICC)). It can be a target.
- a subject in need thereof is, for example, a subject afflicted with stage II, stage III or stage IV cancer.
- a subject in need thereof is, for example, a subject afflicted with stage III or stage IV cancer.
- Bio sample includes any tissue, tissue piece or body fluid collected from a subject.
- a biological sample is, for example, a tissue, tissue piece or body fluid expected to contain cancer cells expressing leavelin.
- a biological sample may be, for example, a tissue, tissue piece, or body fluid itself collected from a subject, or may be a sample that has been subjected to preservation treatment or impurity removal treatment.
- Biological samples include, for example, a portion of primary tumor tissue, a portion of metastatic tumor tissue, lymphatic tissue containing lymph nodes, tissue homogenates, body fluids (e.g., blood, fractions containing blood cell components, lymph, pancreatic juice, bile, ascites).
- a biological sample is, for example, lymph or lymph tissue.
- a biological sample is, for example, whole blood or a fraction containing peripheral blood mononuclear cells.
- a fraction containing peripheral blood mononuclear cells can be prepared, for example, by subjecting whole blood to density gradient centrifugation and specific gravity centrifugation (eg, Ficoll-Paque (registered trademark), Lymphoprep (registered trademark)).
- the biological sample is preferably a blood sample or lymph, more preferably a blood sample.
- cancer cells expressing leebelin means cancer cells expressing membrane-bound leebelin.
- the cancer cell expressing leavelin may be in the state of a single cancer cell, or in the state of a cell cluster (also referred to as "spheroid") containing multiple cancer cells expressing leavelin. There may be.
- the spheroids may contain, for example, cancer cells that express Lieberin and cancer cells that do not express Lieberin. Said spheroids, for example, consist essentially of cancer cells expressing Liebelin. The spheroids, for example, consist only of cancer cells expressing leavelin.
- Cancer cells that express Liebelin can proliferate in an anchorage-independent manner.
- Cancer cells expressing leavelin for example, are viable in the blood. Cancer cells expressing leavelin can survive, for example, in lymphatic vessels or lymph nodes. Cancer cells expressing leavelin can survive in an environment surrounded by dead cells, eg, within tumor tissue. Cancer cells expressing Liebelin can, for example, grow anchorage-independently and anchorage-dependently. Cancer cells expressing leavelin preferably express IDO1. Cancer cells expressing leavelin are, for example, CTCs.
- Gene expression patterns can be analyzed, for example, using DNA microarrays.
- the substance that binds to leverin in this embodiment preferably includes a label substance.
- label substance means a substance that gives a capturable or detectable signal. Labeling agents can be, for example, fluorescent dyes, magnetic particles, or a combination thereof.
- a capturable signal may be, for example, a magnetic signal.
- a detectable signal may be, for example, a light signal.
- fluorescent substance means a substance that absorbs excitation light and emits light (fluorescence) with a wavelength longer than the wavelength of the excitation light.
- Fluorescent substances can be, for example, fluorescein, rhodamine, Texas Red, tetramethylrhodamine, carboxyrhodamine, phycoerythrin, 6-FAMTM, Alexa Fluor®.
- magnetic particles includes particles composed of materials that do not have a magnetic field but form a magnetic dipole when exposed to a magnetic field. Magnetic particles have a particle size of, for example, about 1 nm to about 1 ⁇ m, about 1 nm to about 100 nm, about 1 nm to about 10 nm.
- the magnetic particles consist, for example, of iron hydroxide, iron oxide hydrate, iron oxide, mixed iron oxide, or iron.
- the magnetic particles are, for example, magnetic particles with a particle size of 2-3 nm.
- Detection includes qualitatively or quantitatively finding specific substances (eg, proteins, nucleic acids, cells) and/or continuously monitoring already found substances.
- Detection of cancer cells expressing leverin in a biological sample includes, for example, mixing the biological sample with a substance that binds to leverin, and counting cancer cells to which the substance that binds to leverin is bound.
- Detection of cancer cells expressing totallin in a biological sample is performed, for example, by mixing the biological sample with a substance that binds to herein to which a label substance that emits a fluorescent signal is bound, subjecting the mixture to FACS, It includes counting cancer cells to which the substance that binds to the leavelin is bound.
- the detection of cancer cells expressing leavelin in the assay method is performed in vitro.
- Analysis of recurrence, metastasis or resistance for example, if the detection result indicates the presence of cancer cells expressing Liebelin in the biological sample, the risk of cancer recurrence, metastasis or resistance is analyzed. including doing Analysis of cancer recurrence, metastasis or resistance, for example, when the number of cancer cells expressing leavelin in the biological sample indicated by the detection result is greater than a threshold value, cancer recurrence and / or analyzed as being at risk of metastasis.
- the threshold is predetermined based on various factors including, for example, cancer type, subject's age, weight, genetic background, and gender.
- the analysis method according to the present disclosure can be automatically or semi-automatically performed based on the threshold value and the results of detection or measurement of cancer cells expressing Liebelin. Therefore, medical professionals other than physicians (eg, medical information engineers, clinical engineers, or clinical laboratory technologists) can implement the analysis method according to the present disclosure.
- the analysis method according to the present disclosure does not include, for example, a diagnostic act on humans by a doctor.
- the analysis method according to the present disclosure which does not include medical treatment by a doctor on humans, is a method of providing information for medical professionals other than doctors to diagnose recurrent cancer, metastatic cancer, or resistant cancer. corresponds to
- One aspect of the present disclosure provides a method of presenting information for diagnosing a subject with recurrent, metastatic, or resistant cancer.
- the method according to the above aspect includes detecting cancer cells expressing leverin in a biological sample derived from a subject in need thereof using a substance that binds to leverin, and based on the detection result, detecting cancer cells. including presenting information to diagnose or identify recurrence, metastasis or resistance of
- a subject analyzed as having a resistant cancer according to this aspect may include administration of a pharmaceutical composition according to the present disclosure after or during the application of cancer therapy such as chemotherapy.
- a subject analyzed for cancer recurrence and/or metastasis according to this embodiment may be diagnosed or identified as having recurrent and/or metastatic cancer.
- one aspect of the present disclosure provides methods of diagnosing or identifying whether a subject is suffering from recurrent and/or metastatic cancer.
- the method according to the aspect includes detecting cancer cells expressing leverin in a biological sample derived from a subject in need thereof using a substance that binds leverin, and based on the detection results, has recurrent and/or metastatic cancer.
- the detection of cancer cells expressing leavelin in the diagnostic method or identification method is performed in vitro.
- the cancer cells expressing leavelin are circulating tumor cells (CTCs).
- CTCs circulating tumor cells
- one aspect of the present disclosure provides a method of diagnosing or identifying whether a subject has CTCs.
- a method according to the above aspect comprises treating circulating tumor cells expressing leverin in a blood sample (e.g., whole blood sample, plasma sample or serum sample) from a subject in need thereof with a substance that binds leverin. and diagnosing or identifying whether said subject has CTCs based on the results of the detection.
- One aspect of the present disclosure provides a method of identifying the presence of cancer stem cells.
- the method according to the above aspect includes detecting cancer cells expressing leverin in a biological sample derived from a subject in need thereof using a substance that binds to leverin, and based on the detection result, detecting cancer cells. Including identifying if stem cells are present.
- a subject analyzed as having recurrent cancer, metastatic cancer, or resistant cancer may be subjected to a method for preventing or treating recurrent cancer, metastatic cancer, or resistant cancer. Therefore, one aspect of the present disclosure is to detect cancer cells expressing leverin in a biological sample derived from a subject in need thereof using a substance that binds leverin; analyzing or identifying recurrence, metastasis or resistance in said subject; and treating the subject analyzed or identified as having recurrence, metastasis or resistance of cancer with a pharmaceutical composition according to the present disclosure or cancer
- a method for preventing or treating cancer recurrence, metastasis or resistance comprising administering a pharmaceutical composition for cancer.
- the pharmaceutical composition for treating cancer may contain, for example, a known anti-cancer agent, or a known immunotherapeutic agent, or a combination thereof.
- the pharmaceutical composition for treating cancer may comprise a substance that binds to Lieberin.
- One aspect of the present disclosure is to culture cancer cells expressing forlin under conditions that allow contact with a test substance, and based on the culture results, the test substance is expressed untillin. Methods for identifying a substance that damages cancer cells expressing leavelin, including identifying the substance that damages cancer cells, are provided.
- test substance is, for example, a low-molecular compound, protein (eg, antibody), DNA, RNA, small interfering RNA, or antisense oligonucleotide.
- the test substance binds, for example, to Liebelin.
- the test substance preferably binds to Lieberin with a predetermined binding capacity and has cytotoxic properties.
- the test substance is, for example, a substance that binds to the lyverin containing cytotoxic agent.
- a substance that binds to leverin, including a cytotoxic agent, for example, the cytotoxic agent is directly bound to a substance that binds to leverin.
- Cancer cells expressing Lieberin can be prepared, for example, from cancer cell lines or biological samples.
- a biological sample is, for example, a body fluid such as blood or lymph from a cancer patient or a tumor tissue or part thereof.
- Cancer cell lines can be prepared, for example, from biological samples according to known methods. Cancer cell lines, for example, are commercially available.
- a biological sample can be obtained from a subject using known methods.
- Cancer cells expressing vacationin can be prepared by, for example, using a substance that binds totownin containing a labeling substance (hereinafter also referred to as a "licherin detection reagent") to detect cancer cells expressing vacationin from a biological sample. including aliquoting.
- a biological sample and a contextin detection reagent are mixed to form a complex between the cancer cell and the hasslein detection reagent, and a signal derived from the downsidein detection reagent in the complex is used.
- aliquoting the complex using a Sorting of the complex can be performed using, for example, a single cell/tissue picking device, FACS, or MACS, or a combination thereof.
- a method for preparing cancer cells expressing leverin includes, for example, removing at least one impurity in a biological sample to enrich cancer cells expressing leverin of interest.
- a cancer cell expressing leavelin can be, for example, a CTC.
- CTCs can be obtained from a blood sample (e.g., a whole blood sample, a plasma sample, or a serum sample) collected from a subject by the method for preparing leverin-expressing cancer cells from a biological sample described above or as described in the Examples of the present disclosure. It can be prepared according to the preparation method.
- Cancer cells expressing Lieberin can be prepared, for example, by floating culture of cancer cell lines.
- Suspension culture includes, for example, culturing cancer cell lines in low-adsorption culture plates with shaking.
- Suspension culture involves, for example, culturing a cancer cell line in a low-adsorption tube while rotating.
- Suspension culture includes, for example, culture by the hanging drop method.
- Suspension culture of cancer cell lines can be performed under known cell culture conditions.
- Culturing by the hanging drop method includes culturing for 1 to 3 days, 1 to 2 days, or 1 day under known culture conditions.
- Known cell culture conditions include, for example, maintaining at 37° C. under 5% CO 2 .
- the culture temperature is, for example, 37°C.
- the CO2 concentration is for example 5%.
- Suspension culture uses, for example, a basal medium or a medium supplemented with additives.
- a "basal medium” can be prepared according to known protocols or is commercially available.
- the basal medium is, for example, Dulbecco's Modified Eagle Medium (DMEM), Minimum Essential Medium (MEM), or Basic Medium Eagle (BME).
- Additives include, for example, serum, growth factors or nutrients or combinations thereof.
- Cultivation of cancer cells expressing Liebelin under conditions that allow contact with the test substance includes, for example, culturing in a medium supplemented with the test substance in a basal medium.
- the culture is, for example, adherent culture or suspension culture.
- the culture is, for example, adherent culture.
- the culture is, for example, suspension culture.
- Identifying a test substance as a substance that damages cancer cells expressing leavelin means that if the culture results show, for example, the following, the test substance inhibits or halts the growth of cancer cells, or including identifying substances that kill or destroy If the number of cancer cells expressing leaverin is the same before and after culture, the test substance is identified as a substance that can stop the growth of cancer cells expressing leavelin be able to. If the number of cancer cells expressing leaverin is reduced after culturing compared to before culturing, the test substance is identified as a substance capable of killing or destroying cancer cells expressing leavelin can do.
- the test substance can be identified as a substance that inhibits the growth of cancer cells expressing Lieberin.
- the proliferation rate is the ratio of the number of cells after culture to the number of cells before culture.
- One aspect of the present disclosure is to compare a cancer cell that expresses Lieberin with a cancer cell that does not express Lieberin but is of the same origin as said cancer cell, and a genetic or proteinaceous factor Methods of identifying factors that affect cancer recurrence, metastasis or resistance are provided, including identifying differences in .
- Cancer cells expressing Lieberin can be prepared, for example, from cancer cell lines or biological samples. Lieberin-expressing cancer cells can be prepared, for example, by isolating subsectionin-expressing cancer cells from a biological sample (tumor tissue or tumor tissue fragment) using a currentlylin detection reagent. . Cancer cells expressing leavelin can be prepared, for example, by suspension culture of cancer cell lines.
- cancer cells that do not express Lieberin means cancer cells that express less than twice the Lieberin expression level in adherent cultured cancer cell lines.
- Expression level of Lieberin in this context is the amount of mRNA encoding Lieberin.
- the amount of mRNA encoding Lieberin is measured by RT-qPCR.
- the amount of mRNA encoding rivelin is a value normalized to mRNA encoding actin, for example.
- Cancer cells that do not express leavelin are, for example, cancer cells that express an expression level of leavelin that is less than twice the expression level of extravillous trophoblast (EVT)-derived Swan71 cells.
- Cancer cells that do not express leavelin may be in the form of, for example, single cells, or may be in the form of cell clusters (eg, spheroids).
- Cancer cells that do not express Lieberin can be prepared, for example, from cancer cell lines or biological samples.
- the preparation method for example, cancer cell lines can be adherently cultured.
- the preparation method includes, for example, mixing a biological sample and a living tissue and a living tissue, and a signal derived from the living tissue. Sorting the cancer cells based on non-detection.
- the preparation method may further comprise fractionating the complex based on detection of a signal from the Liebelin detection reagent in the complex.
- the fractionation of the complex and the fractionation of cancer cells to which the herein detection reagent is not bound, i.e., cancer cells that do not express thyroid, are each performed by, for example, a single cell/tissue picking device, FACS, or MACS or Combinations thereof can be used.
- cancer cells that do not express tolin are cancer cells that have the same origin as cancer cells that express tolin.
- the term "same origin” means that the cancer cells expressing leavelin and the cancer cells not expressing leavelin are derived from the same animal species and from the same primary tumor tissue. means that The same animal species can be, for example, the same individual or different individuals.
- Cancer cells derived from the same primary tumor tissue for example, both cancer cells that do not express thyroid and cancer cells that express male may be derived from the same primary tumor tissue, or One may be derived from primary tumor tissue and the other from metastatic tumor tissue.
- Genetic factors include, for example, mutations in gene sequences, the presence or absence or degree of transcription, and chemical modifications such as methylation to DNA.
- Proteinaceous factors include, for example, chemical modifications to histones such as methylation and ubiquitination, presence or absence or degree of expression, and post-translational modifications such as glycosylation.
- the identification of genetic or proteinaceous factor differences does not exclude the identification of both genetic and proteinaceous factor differences.
- Differences in genetic or proteinaceous factors can be identified, for example, by comparing genetic or proteinaceous factor measurements.
- the measurement results may be electronic data, for example.
- One aspect of the present disclosure provides measurement results for genetic or protein factors in cancer cells expressing leavelin and cancer cells not expressing leavelin but having the same origin as said cancer cells methods of identifying factors that affect cancer recurrence, metastasis, or resistance, comprising comparing the results of measurements for said factors in , and identifying differences in genetic or proteinaceous factors.
- Liebelin as a biomarker for cancer stem cells
- One aspect of the present disclosure provides the use of Liebelin as a biomarker for cancer stem cells.
- Another aspect of the present disclosure provides a cancer stem cell biomarker consisting of Liebelin.
- Examples of the present disclosure show that surviving cancer cells surrounded by necrotic cancer cells inside the primary tumor tissue express tolin. It is suggested that these leverin-expressing cancer cells may be able to survive in an environment in which surrounding cancer cells die by, for example, suppressing their own cell growth rate.
- the embodiments of the present disclosure show that cancer cells expressing leavelin enter lymphatic vessels and blood vessels, circulate in the body while avoiding attack from the immune system, and separate from the primary tumor tissue. Indicates that it can metastasize to organs (eg lymph nodes).
- the examples of the present disclosure show that cancer cells in metastatic tissue do not express or weakly express colors aslin, and cancer cells separated from metastatic tissue strongly express tolin.
- examples of the present disclosure demonstrate that cancer cells resistant to chemotherapeutic agents express leavelin. These features are similar to those possessed by cancer stem cells that are thought to cause cancer recurrence and/or metastasis. Liebelin can therefore be used as a biomarker for cancer stem cells.
- the examples of the present disclosure show that cancer cells expressing leavelin can enter lymphatics or blood vessels and metastasize to organs other than the primary tumor tissue. This feature corresponds to a mechanism of cancer recurrence and/or metastasis. Liebelin can therefore be used as a biomarker for cancer recurrence and/or metastasis.
- One aspect of the present disclosure provides the use of Liebelin as a biomarker of cancer recurrence and/or metastasis.
- Another aspect of the present disclosure provides a biomarker of cancer recurrence and/or metastasis consisting of leavelin.
- cancer stem cell means a cancer cell with quiescence.
- the term “stationary phase” refers to a period of time during which the viable cell density is approximately constant (ie within measurement error). Cancer stem cells in quiescent phase have, for example, a substantially constant viable cell density for at least 24 hours (eg, 36 hours or longer). Cancer stem cells can divide asymmetrically when they exit the quiescent phase and are in the proliferative phase.
- the term “asymmetric division” refers to cell division that produces daughter cells that are distinct from each other. Asymmetric division of cancer stem cells can give rise to cancer stem cells and cancer cells differentiated from cancer stem cells.
- proliferative phase refers to the period during which viable cell density increases. The growth phase can be divided into a DNA synthesis phase (S phase), a division phase (M phase), and a gap phase (G1 phase and G2 phase) between these phases by morphological or biochemical measurements. .
- biomarker consists of biosubstances such as peptides (including proteins) or nucleic acids (including genes or their transcripts) present in cells, tissues, or body fluids, and the amount and concentration of these biomarkers can indicate disease. It means a substance in a state that can be indicative of its presence, change, progress, degree of therapeutic effect.
- a biomarker in the present disclosure is Lieberin. Liebelin is used, for example, as a biomarker for metastatic, recurrent or resistant cancer. Liebelin is used, for example, as a biomarker for cancer stem cells.
- Liebelin as a biomarker is, for example, detecting the presence of specificallylin-expressing cancer cells in a biological sample from a subject in need thereof to identify the presence of cancer stem cells.
- the use of Lieberin as a biomarker involves detecting the presence of Lieberin-expressing cancer cells in a biological sample from a subject to identify cancer recurrence, metastasis, or resistance to the subject.
- Cancer cells expressing leavelin can be detected and/or measured according to known immunological methods, particularly the methods described in the present disclosure (eg, the methods described in the Examples).
- MCF7 cell line MCF7 cell line
- SKBR3 cell line and BT20 cell line were used as breast adenocarcinoma cells.
- A375 and SK-MEL28 cell lines were used as melanoma cells.
- HEC6 and HEC108 cell lines were used as endometrial cancer cells.
- SKOV3 cell line was used as ovarian cancer cells.
- Cancer cells were precultured at 37° C. in a culture dish for adherent cells. Cultures were harvested when they reached 90-100% confluence. The collected cultured cells were seeded at 1 ⁇ 10 5 cells per well and statically cultured at 37° C. for 24 hours.
- Pre-cultured cancer cells were seeded at 1-2 ⁇ 10 6 cells per well in a suspension cell culture dish or ultra-low adhesion culture plate, and cultured at 37° C. to form spheroids. . Cultured cells were harvested and transferred to flasks. The flask was incubated at 37° C. for 24-72 hours on a wave shaker.
- Example 1 shows that cancer cells do not express male and female fetase, but express malelin when they are grown in an anchorage-independent manner by suspension culture.
- Example 1 shows that cancer cell spheroids express Liebelin.
- Example 2-1 Expression level of Lieberin in cancer cell spheroid was examined for expression levels (Fig. 3). Liebelin expression was not observed in the A375 (Fig. 3a-d) and A2780 (Fig. 3i-l) cell lines cultured in an anchorage-dependent manner by adherent culture (Figs. 3b and 3j). Liebelin expression was observed in cancer cell spheroids cultured in an anchorage-independent manner in suspension (FIGS. 3e-h and mp) (FIGS. 3f and 3n). These results were the same as those in Example 1.
- RT-qPCR The A375 and A2780 cell lines were adherently cultured, respectively. Cultured cells were harvested and total RNA was harvested respectively. Similarly, each of the cells was cultured in suspension using a wave shaker to form spheroids. The spheroids were collected and total RNA was collected respectively. Using each total RNA collected, the amount of mRNA encoding Liebelin was measured by RT-qPCR. The amount of said mRNA reflects the expression level of Liebelin. RT-qPCR used a primer set and reverse transcriptase that amplifies the rieberin sequence. In A375 cells, the amount of Liebelin expressed was about 14 times higher in the suspension culture than in the adherent culture (Fig. 4a). Similarly, in the case of A2780 cells, the expression level of Liebelin was about 8 times higher in the suspension culture (Fig. 4b).
- the CaSki and SiHa cell lines are cervical cancer cell lines infected with human papillomavirus 16 (HPV16), respectively.
- the cells were adherently cultured, and the cultured cells were collected. Each of the cells was subjected to suspension culture (shaking culture for 24 hours in an ultra-low adhesion culture plate) to form spheroids.
- the spheroids were harvested. Total RNA was collected from each of the collected adherent cultured cells and suspension cultured cells (spheroids). Total RNA was used to examine the expression level of Liebelin. As a result, the expression level of Liebelin in the cell spheroids was about 3.5 times higher than that in the same cells cultured in adherence (Figs. 4c and 4d).
- Examples 1 and 2 demonstrate that even cancer cells that do not express ketones, ketones, and others can express ketones, and others expression can be enhanced when grown in a suspension culture in an anchorage-independent manner. show.
- Example 2-2 (material) A375 cell line was used as melanoma cells.
- the HCT116 cell line was used as colon cancer cells.
- HCC38 cell line was used as breast cancer cells.
- LNCap cell line, DU145 cell line and PC-3 cell line were used as prostate cancer cells.
- Pre-cultured cancer cells were seeded in an ultra-low adhesion culture plate at 1 ⁇ 10 5 cells per well, and cultured at 37° C. for 3 to 4 days to form spheroids. Cultured cells were harvested and transferred to flasks. The flask was cultured at 37° C. for 7 days on a wave shaker.
- Example 2-2 shows that spheroid-forming melanoma cells (A375), colon cancer cells (HCT116), breast cancer cells (HCC38) and prostate cancer cells (LNCap, DU145 and PC-3) express Lieberin. I showed that. These results are summarized in the table below.
- RT-qPCR The expression level of Liebelin in the cancer cells in the suspension-cultured spheroids was measured by RT-qPCR in the same manner as in Example 2. In addition, the expression level of Lieberin in the cancer cells in the adherent cultured monolayer was measured by RT-qPCR. Each expression level was normalized to the expression level of Hprt1 (Fig. 20).
- FIG. 20 shows that the cancer cells used in Example 2-1 express Lieberin by forming spheroids.
- the melanoma cell line A375 had approximately 79-fold higher levels of Lieberin expression in spheroids than in monolayers.
- the colon cancer cell line HCT116 had approximately 33-fold higher expression levels in spheroids.
- Breast cancer cell line HCC38 had approximately 37-fold higher expression levels in spheroids.
- the prostate cancer cell lines LNCap, DU145 and PC-3 had ⁇ 7-fold, ⁇ 11-fold and ⁇ 13-fold higher expression levels in spheroids, respectively.
- Examples 1 and 2-2 demonstrate that cells of various cancers (eg, breast cancer, melanoma, endometrial cancer, ovarian cancer, colon cancer, breast cancer and prostate cancer) form spheroids. This indicates that Lieberin is highly expressed.
- various cancers eg, breast cancer, melanoma, endometrial cancer, ovarian cancer, colon cancer, breast cancer and prostate cancer
- CTCs Circulating Tumor Cells
- peripheral blood mononuclear cells PBMCs
- the peripheral blood mononuclear cells were mixed with mouse monoclonal anti-LVRN antibody (10 ⁇ g/ml) and rabbit polyclonal anti-EpCAM antibody (10 ⁇ g/ml), and the resulting mixture was incubated at room temperature for 30 minutes.
- the mixture was mixed with Alexa488-conjugated goat anti-mouse IgG antibody (1:500 dilution) and CF555-conjugated goat anti-rabbit IgG antibody (1:500), and the mixture was incubated at room temperature for 30 minutes. .
- the mixture was mixed with anti-CD45 antibody-immobilized magnetic beads, and the resulting mixture was incubated at 4° C. for 15 minutes. After incubation, the mixture was mixed with the BV421-conjugated anti-CD45 antibody and the resulting mixture was incubated at 4° C. for an additional 30 minutes.
- the mixture after incubation was subjected to a magnetic cell separator (MACS) to exclude CD45-positive cells, thereby concentrating CD45-negative cells.
- the enriched cells were dispensed into each well of a 96-well cell imaging plate and observed under a fluorescence microscope. Among the observed cells, cells meeting CTC criteria were identified as circulating tumor cells (CTCs).
- CTC criteria used were LVRN positive and/or EpCAM positive and CD45 negative.
- the culture medium containing CTCs was collected from the wells showing the presence of CTCs, and droplets of the culture medium were made on 35 mm culture dishes. Cells satisfying CTC criteria were isolated and recovered from the cell population in the droplet using a Unipick (registered trademark) single cell/tissue picking device.
- Examples A and B Patient A had stage IIIB cervical cancer and multiple lymph node metastases. Patient A had cancer recurrence after receiving concurrent chemoradiation therapy (CCRT). After cancer recurrence, receive therapy using a combination of paclitaxel and carboplatin anticancer agents (TC therapy), then receive therapy using a combination of cisplatin and vinorelbine anticancer agents (NP therapy), and , received therapy with irinotecan (CPT-11). A peripheral blood sample (specimen A) was obtained from patient A after discontinuation of CPT-11 therapy.
- TC therapy carboplatin anticancer agents
- NP therapy cisplatin and vinorelbine anticancer agents
- CPT-11 irinotecan
- Patient B had stage IIIC endometrial cancer with multiple brain, skin and lymph node metastases.
- Patient B underwent total abdominal hysterectomy (ATH), bilateral salpingectomy (BSO), omentectomy (OMT), pelvic lymphadenectomy (PLAN) and para-aortic lymphadenectomy (PAN).
- the cancer recurred and received TC therapy, followed by therapy with a combination of anticancer drugs, doxorubicin and cisplatin (AP therapy).
- AP therapy a combination of anticancer drugs, doxorubicin and cisplatin
- a peripheral blood sample was obtained from patient B while receiving best supportive care (BSC) after AP therapy.
- CTCs in specimen A and specimen B were identified according to the method for identifying circulating tumor cells in the blood described above.
- cell clusters indicated by white arrows express Lieberin (FIG. 5a), express EpCAM (FIG. 5b), and do not express CD45 (FIG. 5c).
- FIG. 5 shows that the cell clusters are CTCs expressing leavelin.
- CTCs were identified according to the CTC criteria described above. As a result, 8 CTCs were identified in sample A, and 15 CTCs were identified in sample B. Of the 8 CTCs identified in Specimen A, 2 formed cell clusters and 6 were present as single cells. Of the 8 CTCs identified in Specimen A, 1 CTC was EpCAM-only positive, 1 LVRN-only CTC, and both EpCAM and LVRN positive. was six. Of the 15 CTCs identified in Specimen B, 2 formed cell clusters and 13 were present as single cells. Of the 15 CTCs identified in specimen B, 4 were EpCAM-only positive, 2 were LVRN-only positive, and both EpCAM and LVRN were positive. was nine. In specimen B, CTC cell masses containing CD45-positive leukocytes were observed. These results are summarized in the table below.
- Example 4 Lieberin Expression on CTCs in Additional Biological Samples (Specimen C) Patient C had stage IIIB cervical cancer with liver and multiple lymph node metastases. A peripheral blood sample (specimen C) was obtained from patient C after the stage of cervical cancer reached stage IIIB. (Improved method for CTC recovery) CTCs were isolated from Specimen C using a modification of the CTC preparation method of Example 3. In the CTC isolation method of Example 3, CTCs were enriched by excluding PBMCs expressing CD45, but in the improved method, CTCs are enriched by collecting cancer cells expressing EpCAM. .
- CTC from sample C in the improved method was performed by the following procedure.
- Peripheral blood was collected from a subject, and peripheral blood mononuclear cells were recovered from the collected peripheral blood.
- the recovered peripheral blood mononuclear cells were fixed using 2% paraformaldehyde.
- a sample containing fixed cells was mixed with mouse monoclonal anti-LVRN antibody (10 ⁇ g/ml), Alexa488-conjugated anti-mouse IgG antibody (1:500 dilution) and BV421-conjugated anti-CD45 antibody, resulting in a mixture. was incubated for 30 minutes at 4°C. The mixture was mixed with anti-EpCAM antibody bound to magnetic beads, and the resulting mixture was incubated at 4° C.
- CTC circulating tumor cells
- CTCs Five CTCs (lingerin-positive and CD45-negative) were isolated from specimen C. 3 out of 5 CTCs were isolated and recovered. Three CTCs were mixed and total genomic DNA was amplified using the Single Cell Whole Genome Amplification Kit. A DNA fragment was amplified from the amplified genomic DNA using a primer set that amplifies HPV16 (E6/E7). Using the same primer set, the chain length (131 bp) of the DNA amplification product amplified from the peripheral blood sample before CTC isolation matched the chain length (131 bp) of the DNA amplification product amplified from the CTC after isolation. This result indicates that CTCs expressing leavelin are cancer cells infected with HPV16, and that the intended CTCs could be isolated by the improved CTC isolation method.
- Example D Patient D had stage IVB cervical cancer with multiple lymph node metastases (bone marrow, para-aortic, and supraclavicular lymph nodes), left lower extremity DVT, external maxillary vein thrombosis, left pancreatopathy (ureteral stent placement). ).
- a cancer tissue piece taken from patient D showed HPV type 16-positive squamous cell carcinoma.
- Patient D received therapy with a combination of anticancer drugs, cisplatin and paclitaxel (TP therapy), followed by KEYTRUDA® (pembrolizumab).
- TP therapy a combination of anticancer drugs, cisplatin and paclitaxel
- KEYTRUDA® pembrolizumab
- Another improved method was performed using sample D, and from 1 ml of sample D, 56 CD45-negative CTCs were identified. This result indicates that sample D was highly CTC-rich. Three of the 56 CTCs were expressing Liebelin. LVRN-positive CTCs were mixed. Total genomic DNA was amplified from the resulting mixture using the Single Cell Whole Genome Amplification Kit (genomic DNA-p). Five Liebelin-negative CTCs were mixed to prepare an LVRN-negative CTC mixture. Two more LVRN-negative CTC mixtures were prepared. Total genomic DNA was amplified from each of the three LVRN-negative CTC mixtures (genomic DNA-n1, -n2, and -n3) in the same manner as above. A DNA fragment was amplified using a primer set for amplifying HPV16 (E6/E7) from the amplified genomic DNA (genomic DNA-p, -n1, -n2, and -n3).
- E6/E7 amplifying HPV16
- CTCs were enriched by excluding PBMCs expressing CD45.
- 1 CTC (12.5%) expressed only EpCAM.
- sample B 4 out of 15 CTCs (about 27%) expressed only EpCAM.
- sample 53 4 out of 56 CTCs, 53 (about 95%) expressed only EpCAM.
- CTCs were enriched by harvesting cells expressing EpCAM.
- Examples 3 and 4 demonstrate that single cancer cells or clumps of cancer cells circulating in the blood express Lieberin.
- sample A 1 out of 8 CTCs (12.5%) did not express Lieberin, and in sample B, 4 out of 15 (approximately 27%).
- Specimen D had 53 out of 56 (approximately 95%).
- Subject A, Subject B, and Subject D all had metastatic cancer, subject A had stage IIIB cervical cancer, subject B had stage IIIC endometrial cancer, and subject D had IVB. had staged cervical cancer.
- Example 5 Effect of Liebelin on immune cell system
- the CaSki cell line was subjected to shaking culture for 24 hours in an ultra-low adhesion culture plate in the same manner as in Example 1 to form cancer cell spheroids in suspension.
- the amount of mRNA encoding leverin and indoleamine 2,3-dioxygenase-1 (IDO1) in CaSki cell spheroids was examined by RT-qPCR, respectively (Fig. 6).
- the expression level of Liebelin (LVRN) was approximately four times higher in suspension culture than in adherent culture of CaSki cells (LVRN, left side of FIG. 6). The results were similar to those of Example 2 (Fig. 4c).
- the expression level of IDO1 was about 23 times higher in suspension culture than in adherent culture of CaSki cells (IDO1 on the right side of FIG. 6). This result indicates that the expression of IDO1 is enhanced in cancer cell spheroids expressing leavelin.
- IDO1 expression in tumor cells can induce differentiation of regulatory T cells (Treg) in the peritumoral environment and promote cancer cell survival (Liu et al., Targeting the IDO1 pathway in cancer: from bench to bedside. Journal of Hematology & Oncology (2016) 11:100).
- IDO1 degrades tryptophan. Tryptophan is essential for T cell function and survival.
- Tumor cells that highly express IDO1 degrade tryptophan present in their surroundings, so that the activity of T cells is suppressed in the vicinity of said tumor cells. Based on these, Example 5 shows that cancer cells expressing therapeutically or spheroids containing the cancer cells highly express IDO1, thereby inducing Treg differentiation and avoiding attacks from the immune system. suggest that it is possible.
- Examples 3-5 show that cancer cells expressing onlin can avoid attack from the immune system in the blood due to the expression of IDO1, thereby circulating in the blood and circulating in the primary tumor tissue. suggests that it can grow at different sites. This indicates that cancer cells expressing leavelin play an important role in cancer recurrence and/or metastasis.
- Example 6 Effect of Lieberin-Expressing Cells on Monocyte-Derived Cells
- a transformant of Swan71 cells overexpressing Lieberin (Swan71_LVRN) was co-cultured with human monocyte-derived cell line THP-1. Co-culture was performed under conditions that allowed contact between Swan71_LVRN cells and THP-1 cells. Cultured THP-1 cells were harvested and mRNA was extracted. Microarray analysis was performed using the mRNA. Swan71 cells (control) and THP-1 were co-cultured in the same manner as described above, and the cultured THP-1 was subjected to microarray analysis. Expression of multiple genes was increased in THP-1 cells co-cultured with Swan71_LVRN than in THP-1 cells co-cultured with Control.
- the expression levels of 4 of the above-mentioned multiple genes were examined using RT-qPCR (Fig. 7).
- the four genes are 2'-5'-Oligoadenylate Synthetase 2 (OAS2), Interferon Induced Protein With Tetratricpeptide Repeats 1 (IFIT1), IFIT3, and the interferon stimulated gene, 15 kDa (ISG15 ) was.
- Swan71_LVRN cells and THP-1 cells were co-cultured under conditions that allowed contact.
- Cultured THP-1 cells were harvested and mRNA was extracted.
- the extracted mRNA was subjected to RT-qPCR to examine the expression level of each gene.
- the expression levels of the four genes investigated were significantly increased (Fig. 7a).
- the expression level of each gene was examined in the same manner as described above, except that the Swan71_LVRN cells and THP-1 cells were cultured under conditions that prevented contact between them. In this culture, humoral components, including exosomes, were able to move between compartments containing individual cells. There was no significant difference in the expression levels of the four genes examined (Fig. 7b).
- Example 6 shows that contact with cells expressing Liebelin increases the expression of specific genes in monocytic cells.
- THP-1 cells were cultured in the presence of fluorescent dye-labeled rLVRN and observed under a microscope. As a result, rLVRN present in THP-1 cells was observed. This result indicates that Liebelin is taken up by monocytes.
- rLVRN and beads that bind to the His tag were mixed to prepare rLVRN-immobilized beads.
- THP-1 cells were cultured in the presence of rLVRN-immobilized beads or free rLVRN.
- the expression levels of the above four genes in cultured THP-1 cells were measured.
- the expression levels of the four genes induced by the rLVRN immobilized on the beads ( ⁇ ) were remarkably suppressed compared to the expression levels of the four genes induced by the free rLVRN ( ⁇ ). (Fig. 8b).
- This result suggests that the induction of expression of the gene in monocyte cells by tolin is not sufficient only by contacting placelin with monocyte cells, but that researchlin needs to be incorporated into the cells.
- PBMCs Human peripheral blood mononuclear cells
- IFIT1, IFIT3 and ISG15 were cultured in the presence of rLVRN to detect OAS2, IFIT1, IFIT3 and ISG15.
- Expression levels of four genes were measured. Expression of the four genes was induced, similar to the results in THP-1 cells.
- PBMCs were prepared by treating 3 ml of EDTA blood with Ficoll. After culturing the PBMCs in 2 ml of RPMI medium in a dish for floating cells for 24 hours, rLVRN 1.5 ⁇ g/ml, INF- ⁇ 1000 IU/ml or PBS (negative control) was added to the medium. After an additional 24 hours of culture, ISG15 was stained with phycoerythrin (PE). PE-stained PBMCs were subjected to a BD FACS AriaTM Fusion cell sorter and separated into monocyte and lymphocyte fractions.
- PE phycoerythrin
- PBMCs were prepared by treating 3 ml of EDTA blood with Ficoll. After culturing the PBMCs in a dish for floating cells using 2 ml of RPMI medium for 12 hours, 1.5 ⁇ g/ml of rLVRN or PBS (negative control) was added to the medium. After further culture for 24 hours, ISG15 was stained with PE, CD14 monocytes were stained with FITC, CD19 as a B cell marker was stained with allophycocyanin (APC), and CD3 was stained with Brilliant Violet 421TM (T cell marker). BV421TM). Stained PBMCs were subjected to a BD FACS AriaTM Fusion cell sorter and separated into CD14-positive monocyte, CD19-positive B-cell and CD3-positive T-cell fractions (CD4 and CD8), respectively.
- the average fluorescence intensity in the cultured cells supplemented with PBS was 1,622, whereas the average fluorescence intensity in the cultured cells supplemented with rLVRN was 42,287.
- the mean fluorescence intensity in PBS-supplemented cultures was 478, while the rLVRN-supplemented cultures had a mean fluorescence intensity of 3,031.
- the mean fluorescence intensity in PBS-supplemented cultures was 372, while the rLVRN-supplemented cultures had a mean fluorescence intensity of 3,678.
- PBMCs were prepared by treating 3 ml of EDTA blood with Ficoll. The PBMCs were cultured in a suspension cell dish using 2 ml of RPMI medium supplemented with 1.5 ⁇ g/ml of rLVRN. After 24 hours of culture, the cells were harvested and fixed by treatment with 4% paraformaldehyde for 10 minutes. Fixed cells were permeabilized with PBS containing 0.1% Triton for 10 minutes. ISG15 was stained with PE. Mouse or rabbit antibodies against the following markers were used as primary antibodies, and Alexa488-labeled anti-mouse or anti-rabbit antibodies were used as secondary antibodies. CD14 was used as a monocyte lineage marker. CD19 was used as a B cell marker. CD4 was used as a T cell marker. CD8 was used as a T cell marker. Furthermore, cell nuclei were stained with Hoechst.
- PBMCs were prepared by treating 3 ml of EDTA blood with Ficoll. After the PBMCs were cultured in a floating cell dish using 2 ml of RPMI medium for 24 hours, 1.5 ⁇ g/ml of FITC-labeled rLVRN was added to the medium and cultured for an additional 4 or 24 hours. Cultured cells were harvested and subjected to a BD FACS AriaTM Fusion cell sorter to separate PBMCs into monocyte and lymphocyte fractions.
- Example 8 suggests that Liebelin induces specific genes such as ISG15 in monocytes and lymphocytes after being taken up by monocytes.
- PBMCs were prepared by treating 3 ml of EDTA blood with Ficoll.
- the PBMCs were cultured in a floating cell dish using 10 ml of RPMI medium.
- the cultured cells were collected, and the obtained cell suspension was mixed with CD14 MicroBeads.
- the mixture was subjected to Magnetic Activated Cell Sorting (MACS) to sort CD14-positive cells.
- the sorted CD14-positive cells were dispensed into culture wells in duplicate, and rLVRN 1.5 ⁇ g/ml or PBS was added to each well. After 24 hours of culture, the cultured cells were observed under a microscope.
- RNA was extracted from cultured cells and subjected to RT-qPCR to examine the expression levels of four genes, IFIT1, IFIT3, ISG15 and OAS2.
- the table below shows the relative expression levels of the four genes in CD14-positive cells cultured in the presence of rLVRN with respect to the expression levels of the four genes in CD14-positive cells cultured in the presence of PBS.
- the table below shows that Liebelin induces the expression of said genes in CD14 positive cells.
- Dendritic cells are divided into dendritic cells (XCR1 + DC) that present foreign antigens in an MHC class I-dependent manner and dendritic cells (XCR1 + DC) that present antigens in an MHC class II-dependent manner, depending on the mode of antigen presentation.
- CD11b + DC plasmacytoid dendritic cells (pDC) that produce large amounts of type I IFN during viral infection, and dendritic cells (moDC) differentiated from peripheral blood monocytes during inflammation. obtain.
- pDC plasmacytoid dendritic cells
- miDC dendritic cells differentiated from peripheral blood monocytes during inflammation.
- CD14-positive cells showed decreased CD14 expression levels, increased CD123, CD80 and CD86 expression levels, and no change in CD11c expression levels (Fig. 11a).
- Peripheral blood mononuclear cells (PBMCs) showed an expression pattern of the specific gene similar to that of CD14-positive cells, but changes in the expression levels of the gene were more pronounced in CD14-positive cells (Fig. 11a and 11b).
- THP-1 showed changes in the expression levels of said specific genes with a different trend than PBMCs and CD14 positive cells (FIGS. 11a-11c).
- Example 9 shows that Liebelin differentiates PBMCs-derived CD14-positive cells into dendritic cells, and the dendritic cells have a decreased expression level of CD14 ( ⁇ ) and an increased expression level compared to CD14-positive cells.
- CD123 ( ⁇ ), CD80 ( ⁇ ) and CD86 ( ⁇ ), and CD11c ( ⁇ ) with unchanged expression levels can be differentiated into dendritic cells. Focusing on CD11c and CD123, the dendritic cells differentiated by Liebelin were CD11c(+)CD123(+).
- XCR1 + DC, CD11b + DC and moDC are CD11c(+)CD123( ⁇ ), so the dendritic cells induced to differentiate by Liebelin are different from these dendritic cell subsets. considered different. Since pDC is DC11c( ⁇ )CD123(+), dendritic cells differentiated by Liebelin are considered to be different from the pDC subset.
- PBMCs peripheral blood mononuclear cells
- PBMCs peripheral blood mononuclear cells
- PBMCs peripheral blood mononuclear cells
- PBMCs peripheral blood mononuclear cells
- the PBMCs were cultured in a floating cell dish using 2 ml of RPMI medium for 24 hours. 1.5 ⁇ g/ml rLVRN or PBS (control) was added to the culture medium and cultured for an additional 24 hours. Cultured cells were harvested and stained with BV421-labeled anti-CD14 antibody, PE-labeled anti-HLA-DR antibody, and APC-labeled anti-CD83 antibody.
- CD14 was utilized as a monocyte lineage marker, HLA-DR as an antigen presenting cell (APC) marker and CD83 as a mature dendritic cell marker. Stained cultured cells were subjected to a BD FACS AriaTM Fusion cell sorter.
- HLA-DR (+) CD14 (-) (Q1 fraction) cell population increased from 12.2% to 19.3% by replacing the additive component PBS with rLVRN.
- PBMCs from adult male b the same cell population decreased from 15.1% to 6.5%.
- PBMCs were cultured as above and the cultured cells were subjected to a BD FACS AriaTM Fusion cell sorter. Cultured cells were stained with FITC-labeled anti-CD14 antibody, PE-labeled anti-HLA-DR antibody, APC-labeled anti-CD11c antibody, and BV421-labeled anti-CD123 antibody.
- CD14 was utilized as a monocyte lineage marker, HLA-DR as an antigen presenting cell (APC) marker, CD11c as a dendritic cell marker (primarily moDC) and CD123 as a dendritic cell marker (primarily pDC).
- the HLA-DR (+) CD14 (-) (Q1 fraction) cell population increased from 15.2% to 17.3% by replacing the additive component PBS with rLVRN.
- the CD11c(+)CD123(+) cell population in the Q1 fraction increased significantly from 3.2% to 50.7%.
- Example 10 shows that PBMCs cultured in the presence of leavelin show an increase in CD83(+) dendritic cells in the CD14(-) cell population.
- Example 10 shows an increase in CD11c(+)CD123(+) dendritic cells in the monocyte fraction, whether CD14 positive or negative. Focusing on CD123 and CD11c, dendritic cells induced to differentiate from PBMCs cultured in the presence of Liebelin were CD123(+)CD11c(+). As shown in Table 4, XCR1+ DCs, CD11b+ DCs and moDCs are CD11c(+)CD123(-), so dendritic cells induced to differentiate by Liebelin are different from these dendritic cell subsets. Conceivable. Since pDC is DC11c( ⁇ )CD123(+), dendritic cells differentiated by Liebelin are considered to be different from the pDC subset. This result is the same as in Example 9.
- Example 12 Action of anti-risonerin antibody on cancer cells expressing rieberin An anti-rieberin antibody was applied to cancer cells expressing rieberin. Intracellular uptake of cell surface Lieberin was observed upon application of a monoclonal anti-Lieberin antibody.
- Melanoma cells A375 1,000 cells in 20 ⁇ L of culture solution drop) were cultured for 1 day by the hanging drop method. Cultured A375 cells formed cell clusters. A375 cells expressing Liebelin were observed in the A375 cell cluster (Fig. 13a).
- Melanoma cells A375 (10 cells in 20 ⁇ L culture drop) were cultured for 1 day by the hanging drop method in the presence of pHrodo-conjugated anti-LVRN antibody.
- the cultured A375 cells formed 2 to 3 cell clusters, and A375 cells expressing leavelin were observed.
- Intracellular uptake of the pHrodo-conjugated anti-LVRN antibody was observed in A375 cells that expressed leavelin (Fig. 13b).
- Intracellular uptake of cell membrane Lieberin by anti-Lieberin antibody was observed with all three types of antibodies (including 5-23 antibody) used in this example.
- Decreased cell surface Liebelin suggests that the differentiation of monocytes into IDO1-expressing dendritic cells may not be sufficiently induced, thereby exposing the cancer cells to attack from the immune system. This result suggests that anti- Kunststofferin antibodies can effectively treat recurrent and/or metastatic cancers identified for the presence of cancer cells expressing deficitin.
- the ovarian cancer cell line SKOV3 was cultured in suspension to form spheroids (Fig. 14a upper).
- An MMAE conjugated 5-23 antibody was prepared in which the cytotoxic agent monomethylauristatin E (MMAE) was conjugated to the monoclonal anti-leavelin antibody 5-23 antibody.
- the cancer cell spheroids were cultured for 7 days in the presence of MMAE-conjugated 5-23 antibody. Subsequently, the cancer cell spheroids were stained with propidium iodide (PI). Propidium iodide (PI)-stained cells (ie cell death) were observed (Fig. 14a middle panel). This result suggests that anti-Lieberin antibodies containing cytotoxic agents can effectively treat recurrent and/or metastatic cancers in which the presence of Lieberin-expressing cancer cells has been identified.
- PI propidium iodide
- cancer cell spheroids were formed and cultured in the presence of the MMAE conjugated 5-23 antibody in the same manner as for SKOV3.
- PI-stained cells ie cell death
- the middle panel of Figure 14b shows that there were PI-stained cells (ie cell death) in ovarian cancer cell spheroids cultured in the presence of MMAE unconjugated 5-23 antibody alone.
- This result suggests that the anti-leavelin antibody itself (without a cytotoxic agent conjugate) can treat recurrent and/or metastatic cancer.
- Cell death-inducing action by the anti-leavelin antibody itself was not observed in breast cancer cell line SKBR3 and melanoma SK-MEL28.
- FIG. 15 shows an immunostaining image of a lymph node near the afferent lymphatic vessel.
- FIG. 16 shows an immunostaining image of a lymph node near the efferent lymphatic vessel.
- Figure 15b shows the presence of floating cancer cell masses within the afferent lymphatics.
- FIG. 15c shows that cancer cells composing the cell mass express Lieberin.
- Figures 15d and 15e show the presence of low expression levels of leavelin-expressing cancer cells at tumor sites within metastatic lymph nodes.
- Figures 16a and 16b show the presence of cancer cell masses in the efferent lymphatics that have dislodged from the tumor site in the metastatic lymph nodes.
- Figures 16c to 16e show that cancer cells forming cancer cell clusters present in efferent lymphatic vessels express colors.
- FIG. 16c shows that cancer cells present in metastatic foci within lymph nodes do not express Liebelin.
- Example 13 shows that cancer cells expressing spiritualin that have escaped from the primary tumor site of ovarian cancer can reach lymph nodes through afferent lymphatic vessels, and that cancer cells expressing fatein that have reached lymph nodes proliferates in lymph nodes to form metastatic tumor tissue (including cancer cells with low levels of designlin and cancer cells that do not express metrolin), and elsewherein-expressing cancers that have left the metastatic tumor tissue We show that the cells can further metastasize through the efferent lymphatics.
- Example 13 shows that cancer cells involved in lymph node metastasis strongly express Liebelin under severe conditions for cell survival such as floating in lymph vessels, and adhere like metastatic foci. It shows weak or no expression of Liebelin under viable conditions.
- Immune cells are concentrated in lymphatic vessels and lymph nodes, and their immune function is high. Examples of the present specification show that cancer cells expressing tolin can avoid attack from the immune system by expressing IDO1 themselves, and monocytes that come into contact with tolin are transformed into dendritic cells expressing IDO1. It was shown that the induction of differentiation into cells makes it possible to avoid attacks from the immune system. These findings indicate that cancer cells expressing or capable of expressing leebelin may play an important role in cancer metastasis and/or recurrence, including lymph node metastasis, particularly in systemic metastasis.
- Example 14 Surviving cancer cells surrounded by necrotic cells inside the primary tumor tissue
- the primary tumor tissue of an ovarian cancer patient with metastatic cancer contained extensive necrotic areas (Fig. 17a). ). Residual tumor was found in areas surrounded by necrotic areas within the primary tumor tissue. The residual tumor expressed leavelin (Fig. 17b). No Liebelin expression was observed in necrotic areas (Fig. 17c). No Liebelin expression was observed in areas containing cancer cells surviving outside the necrotic area (Figs. 17d and 17e).
- Example 14 shows that cancer cells expressing leavelin can survive even under severe conditions such as necrosis of cancer cells, or that cancer cells expressing leavelin can survive under such severe conditions. , indicating that cancer cells capable of expressing Lieberin express Lieberin and remain viable.
- the results of Examples 13 and 14 suggest that cancer cells capable of expressing Lieberin express Lieberin and remain viable when subjected to conditions that are hostile to cell survival.
- blood vessels were present around the cancer cells expressing leavelin. This result suggests that cancer cells expressing leavelin, which may play an important role in cancer recurrence and/or metastasis, can be treated by anticancer agents infused into the blood.
- necrotic tumor tissue and residual small tumor tissue were observed (Fig. 18a). Most of the remaining tumor tissue is surrounded by necrotic tumor tissue. The remaining tumor tissue consisted of cancer cells expressing leavelin (Fig. 18b).
- Example F Patients with stage IIIC ovarian cancer received doxetaxel and carboplatin combination therapy (DC therapy) as NAC followed by ATH, BSO, OMT and low anterior rectal resection as IDS. The patient received DC therapy after IDS. The patient relapsed with peritoneal seeding one year after the DC therapy. Specimen F was an ovary removed by IDS. Sections of excised ovaries were prepared and immunostained with HE staining and anti-Liebelin antibody.
- DC therapy carboplatin combination therapy
- Fig. 18c In the ovarian cancer after DC therapy, some cancer cells were observed separately in the necrotic major tissue (Fig. 18c). The cancer cells are surrounded by necrotic tumor tissue. The cancer cells expressed leavelin (Fig. 18d).
- Example 15 shows that chemotherapy-resistant cancer cells express Liebelin. This result suggests that cancer cells expressing or capable of expressing leavelin are resistant to cancer therapies, including chemotherapy, and are susceptible to cancer recurrence and/or metastasis, particularly local recurrence. Show that it can play an important role.
- Ovarian cancer cell line A2780 was transformed to express Lieberin to generate A2780 LVRN.
- A2780 was transfected with an empty vector CAG to generate A2780 CAG (control).
- Female Balb/c nu/nu mice (6-8 weeks old) were injected with 5 ⁇ 10 6 cells/100 ⁇ LA2780 LVRN in two sites on the right side.
- Cancer cell-transplanted mice were prepared by injecting LA2780 CAG at 5 ⁇ 10 6 cells/100 ⁇ per site into two sites on the left side of the mouse. Ten cancer cell-transplanted mice were produced.
- MMAE-conjugated 5-23 antibody (10 mg/kg) was intra-tail injected into 5 cancer cell-implanted mice, and tumor size was measured.
- Two days and eight days after A2780 injection the remaining 5 cancer cell-implanted mice were injected with PBS via the tail, and the tumor size was measured.
- Fifteen days after A2780 injection the tumor size of 10 cancer cell-implanted mice was measured.
- FIG. 19 shows that administration of PBS to A2780 LVRN-implanted mice resulted in a tumor size of approximately 300 mm 3 15 days after A2780 LVRN injection. 15 shows that when A2780 LVRN-implanted mice were administered MMAE-conjugated 5-23 antibody, no tumors were visually observed 15 days after A2780 LVRN injection.
- Example 16 shows that tumors formed in vivo by cancer cells that express Lieberin are treated with anti-Lieberin antibodies containing chemotherapeutic agents.
- Example 17 Cancers Expressing Liebelin PSTT tissue was collected from each of three patients with placental trophoblastic tumors (PSTT). Frozen sections were prepared from the PSTT tissue. The frozen sections were immunostained with 5-23 antibody. The immunostaining revealed that Liebelin was expressed throughout the tumor tissue.
- Example 17 demonstrates that pharmaceutical compositions comprising anti- Kunststofferin antibodies can treat tumors that express wealthin (eg, PSTT).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- Cell Biology (AREA)
- Urology & Nephrology (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Biochemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pathology (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Tropical Medicine & Parasitology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Oncology (AREA)
- Reproductive Health (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP23737284.2A EP4461313A4 (en) | 2022-01-04 | 2023-01-04 | PHARMACEUTICAL COMPOSITION INTENDED FOR THE TREATMENT OF CANCER |
| JP2023572475A JPWO2023132333A1 (https=) | 2022-01-04 | 2023-01-04 | |
| CN202380015930.1A CN118510542A (zh) | 2022-01-04 | 2023-01-04 | 用于处置癌的药物组合物 |
| US18/725,450 US20250136679A1 (en) | 2022-01-04 | 2023-01-04 | Pharmaceutical composition for treating cancer |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2022-000160 | 2022-01-04 | ||
| JP2022000160 | 2022-01-04 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023132333A1 true WO2023132333A1 (ja) | 2023-07-13 |
Family
ID=87073669
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/JP2023/000019 Ceased WO2023132333A1 (ja) | 2022-01-04 | 2023-01-04 | がんを処置するための医薬組成物 |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US20250136679A1 (https=) |
| EP (1) | EP4461313A4 (https=) |
| JP (1) | JPWO2023132333A1 (https=) |
| CN (1) | CN118510542A (https=) |
| WO (1) | WO2023132333A1 (https=) |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2005160473A (ja) | 2003-11-10 | 2005-06-23 | Kyoto Univ | 絨毛外栄養膜細胞特異的蛋白質 |
| JP2019158613A (ja) * | 2018-03-13 | 2019-09-19 | 国立大学法人金沢大学 | laeverinを用いたPSTT(胎盤部トロホブラスト腫瘍)の検出 |
-
2023
- 2023-01-04 US US18/725,450 patent/US20250136679A1/en active Pending
- 2023-01-04 JP JP2023572475A patent/JPWO2023132333A1/ja active Pending
- 2023-01-04 CN CN202380015930.1A patent/CN118510542A/zh active Pending
- 2023-01-04 WO PCT/JP2023/000019 patent/WO2023132333A1/ja not_active Ceased
- 2023-01-04 EP EP23737284.2A patent/EP4461313A4/en active Pending
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2005160473A (ja) | 2003-11-10 | 2005-06-23 | Kyoto Univ | 絨毛外栄養膜細胞特異的蛋白質 |
| JP2019158613A (ja) * | 2018-03-13 | 2019-09-19 | 国立大学法人金沢大学 | laeverinを用いたPSTT(胎盤部トロホブラスト腫瘍)の検出 |
Non-Patent Citations (14)
| Title |
|---|
| ECONOMOPOULOU P: "Prognostic impact of indoleamine 2,3-dioxygenase 1 <i>(IDO1)</i> mRNA expression on circulating tumour cells of patients with head and neck squamous cell carcinoma.", ESMO OPEN., vol. 5, no. 3, May 2020 (2020-05-01), pages e000646 |
| FENG XUAN, WEI ZHI, ZHANG SAI, DU YAN, ZHAO HONGBO: "A Review on the Pathogenesis and Clinical Management of Placental Site Trophoblastic Tumors", FRONTIERS IN ONCOLOGY, vol. 9, 28 November 2019 (2019-11-28), pages 937, XP093077530, DOI: 10.3389/fonc.2019.00937 * |
| FOLIA PHARMACOL. JPN., vol. 142, 2013, pages 85 - 88 |
| FUJIWARA H: "Human extravillous trophoblasts express laeverin, a novel protein that belongs to membrane-bound gluzincin metallopeptidases.", BIOCHEM BIOPHYS RES COMMUN., vol. 313, no. 4, 23 January 2004 (2004-01-23), pages 962 - 8, XP004482923, DOI: 10.1016/j.bbrc.2003.12.024 |
| FUJIWARA H: "Promoting Roles of Embryonic Signals in Embryo Implantation and Placentation in Cooperation with Endocrine and Immune Systems.", INT J MOL SCI., vol. 21, no. 5, 10 March 2020 (2020-03-10), pages 1885, XP093128449, DOI: 10.3390/ijms21051885 |
| HORIE A., FUJIWARA H., SATO Y., SUGINAMI K., MATSUMOTO H., MARUYAMA M., KONISHI I., HATTORI A.: "Laeverin/aminopeptidase Q induces trophoblast invasion during human early placentation", HUMAN REPRODUCTION, OXFORD JOURNALS, GB, vol. 27, no. 5, 1 May 2012 (2012-05-01), GB , pages 1267 - 1276, XP093077527, ISSN: 0268-1161, DOI: 10.1093/humrep/des068 * |
| HORIE A: "Laeverin/aminopeptidase Q induces trophoblast invasion during human early placentation.", HUM REPROD., vol. 27, no. 5, May 2012 (2012-05-01), pages 1267 - 76, XP093077527, DOI: 10.1093/humrep/des068 |
| IMAKAWA K: "Interferon-like sequence of ovine trophoblast protein secreted by embryonic trophectoderm.", NATURE., vol. 330, no. 6146, 26 November 1987 (1987-11-26), pages 377 - 9, XP002010876, DOI: 10.1038/330377a0 |
| LIU ET AL.: "Targeting the IDO1 pathway in cancer: from bench to bedside.", JOURNAL OF HEMATOLOGY & ONCOLOGY, vol. 11, 2018, pages 100 |
| LIU ET AL.: "Targeting the IDOl pathway in cancer: from bench to bedside", JOURNAL OF HEMATOLOGY & ONCOLOGY, vol. 11, 2018, pages 100 |
| MARUYAMA M: "Histidine 379 of human laeverin/aminopeptidase Q, a nonconserved residue within the exopeptidase motif, defines its distinctive enzymatic properties.", J BIOL CHEM., vol. 284, no. 50, 11 December 2009 (2009-12-11), pages 34692 - 702 |
| MARUYAMA M: "Laeverin/aminopeptidase Q, a novel bestatin-sensitive leucine aminopeptidase belonging to the M1 family of aminopeptidases.", J BIOL CHEM., vol. 282, no. 28, 13 July 2007 (2007-07-13), pages 20088 - 96, XP009113810, DOI: 10.1074/jbc.M702650200 |
| See also references of EP4461313A4 |
| SONG GUO-QING, ZHAO YI: "Kisspeptin-10 inhibits the migration of breast cancer cells by regulating epithelial-mesenchymal transition", ONCOLOGY REPORTS, SPANDIDOS PUBL., vol. 33, no. 2, 1 February 2015 (2015-02-01), pages 669 - 674, XP093077531, ISSN: 1021-335X, DOI: 10.3892/or.2014.3619 * |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4461313A1 (en) | 2024-11-13 |
| CN118510542A (zh) | 2024-08-16 |
| EP4461313A4 (en) | 2026-04-01 |
| US20250136679A1 (en) | 2025-05-01 |
| JPWO2023132333A1 (https=) | 2023-07-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Ebert et al. | Endothelial, pericyte and tumor cell expression in glioblastoma identifies fibroblast activation protein (FAP) as an excellent target for immunotherapy | |
| JP6247253B2 (ja) | 白血病幹細胞マーカー | |
| US9512401B2 (en) | B and T lymphocyte attenuator marker for use in adoptive T-cell therapy | |
| EP3634584B1 (en) | Tumor-infiltrating t-cells for use in the treatment of cancer | |
| JP2008546387A (ja) | 癌を処置および診断するための組成物および方法 | |
| JP7849306B2 (ja) | 免疫抑制線維芽細胞集団のバイオマーカーとしてのantxr1及び免疫療法に対する応答を予測するためのその使用 | |
| US20180050091A1 (en) | Modulation of Cancer Immunity with Type 2 Innate Lymphoid Cells, Interleukin 33, and/or Interferon Induced Protein 44 | |
| AU2020342787A1 (en) | SSEA-4 binding members | |
| Morrison et al. | Proteomic comparison of mcf-7 tumoursphere and monolayer cultures | |
| JP2025172732A (ja) | 腫瘍微小環境の組成を測定するための方法及び組成物 | |
| Puglisi et al. | Isolation and characterization of CD133+ cell population within human primary and metastatic colon cancer | |
| Mihalcioiu et al. | Improved platform for breast cancer circulating tumor cell enrichment and characterization with next-generation sequencing technology | |
| JP7396578B2 (ja) | 病変組織内への薬剤到達を予測する方法 | |
| US12098193B2 (en) | Netrin G1 as a biomarker for enhancing tumor treatment efficacy | |
| WO2023132333A1 (ja) | がんを処置するための医薬組成物 | |
| Dror et al. | Tumour-derived extracellular vesicle and particle reprogramming of interstitial macrophages in the lung pre-metastatic niche enhances vascular permeability and metastatic potential | |
| JP2022513082A (ja) | 免疫応答を調節するためのIRE1α-XBP1シグナル伝達経路バイオマーカーの使用 | |
| US20220372145A1 (en) | Methods of treating cancer | |
| Tuerxun et al. | MICA/B-driven NK cell dysfunction promotes cervical cancer via Toll signaling | |
| Scardellato | DISSECTING RESISTANCE TO IMMUNOTHERAPY IN MSS COLORECTAL CANCER | |
| EP4057005A1 (en) | Biomarker for use in cancer therapy | |
| Li | Distinct T Cell Dynamics During Neoadjuvant Immunotherapy And Differential Impact Of TIM-3 Ligands On Natural Killer Cell Function In Patients With Head And Neck Squamous Cell Carcinoma | |
| Sharma et al. | Reprogramming BCMA-Targeted CAR-T Cells through γ-Secretase Modulation Blocks Antigen Shedding and Extends CAR-T Longevity | |
| c Response | Multicellular tumor-stromal interactions recapitulate aspects of therapeutic response and human oncogenic signaling in a 3D disease model for H3K27M-altered DIPG | |
| Khazamipour | Oncofetal chondroitin sulfate as a target in solid tumors |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23737284 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202380015930.1 Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 2023572475 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023737284 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2023737284 Country of ref document: EP Effective date: 20240805 |
|
| WWP | Wipo information: published in national office |
Ref document number: 18725450 Country of ref document: US |