WO2023131657A1 - Anti-cd84 antibodies and chimeric antigen receptors - Google Patents

Anti-cd84 antibodies and chimeric antigen receptors Download PDF

Info

Publication number
WO2023131657A1
WO2023131657A1 PCT/EP2023/050194 EP2023050194W WO2023131657A1 WO 2023131657 A1 WO2023131657 A1 WO 2023131657A1 EP 2023050194 W EP2023050194 W EP 2023050194W WO 2023131657 A1 WO2023131657 A1 WO 2023131657A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
sequences
variants
cdrs
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2023/050194
Other languages
English (en)
French (fr)
Inventor
Nela KLEIN GONZÁLEZ
Manuel Juan Otero
Ramon VILELLA PUIG
Lorena PÉREZ AMILL
Claudio Joao RIBEIRO DOS SANTOS
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Gyala Therapeutics Ltda Soc
Hospital Clinic de Barcelona
Institut d'Investigacions Biomèdiques August Pi i Sunyer
Original Assignee
Gyala Therapeutics Ltda Soc
Hospital Clinic de Barcelona
Institut d'Investigacions Biomèdiques August Pi i Sunyer
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from EP22382003.6A external-priority patent/EP4209511A1/en
Priority to IL313971A priority Critical patent/IL313971A/en
Priority to CA3242498A priority patent/CA3242498A1/en
Priority to MX2024008495A priority patent/MX2024008495A/es
Priority to AU2023205629A priority patent/AU2023205629A1/en
Priority to US18/724,147 priority patent/US20250064853A1/en
Application filed by Gyala Therapeutics Ltda Soc, Hospital Clinic de Barcelona, Institut d'Investigacions Biomèdiques August Pi i Sunyer filed Critical Gyala Therapeutics Ltda Soc
Priority to KR1020247025889A priority patent/KR20240130128A/ko
Priority to CN202380016448.XA priority patent/CN118660908A/zh
Priority to EP23700455.1A priority patent/EP4460519B1/en
Priority to JP2024540878A priority patent/JP2025500618A/ja
Publication of WO2023131657A1 publication Critical patent/WO2023131657A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4214Receptors for cytokines
    • A61K40/4217Receptors for interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4224Molecules with a "CD" designation not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70517CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/11Antigen recognition domain
    • A61K2239/13Antibody-based
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/21Transmembrane domain
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15041Use of virus, viral particle or viral elements as a vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15041Use of virus, viral particle or viral elements as a vector
    • C12N2740/15043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • the present invention relates to anti-CD84 antibodies and chimeric antigen receptors (CARs), and their use in therapy, in particular cancer therapy.
  • the invention also relates to methods for determining CD84 levels in a sample and for identifying a subject suitable for treatment with an anti-CD84 antibody or CAR.
  • the human CD84 protein is a “cluster of differentiation” first identified in 1993. Sequencing of CD84 has identified it as a member of the Slam (Signaling Lymphocyte Activation Molecule) family.
  • the extracellular part of the CD84 receptor contains a non-canonical IgV distal domain and an lgC2g proximal domain, a structure common to all members of the SLAM family and similar to CD2.
  • CD84 functions as an homophilic adhesion molecule; the receptor: ligand interaction involves the IgV domain and is independent of the cytoplastic domain and there are specific differences in the homophilic interfaces that prevent the binding of CD84 to other molecules of the SLAM family.
  • CD84 Human CD84 is expressed in various types of immune cells. Expression levels are heterogeneous depending on the cell type and its state of differentiation or activation. CD84 appears very early during haematopoietic differentiation in bone marrow progenitor cells and is expressed in mostT and B cells, but with higher expression in memory T and B lymphocytes, follicular helper cells and germinal centre B cells. Myeloid antigen-presenting cells, such as monocytes and monocyte-derived dendritic cells (DCs) are also positive for CD84. Granulocytes also express significant levels of CD84 with the highest expression on basophils and mast cells.
  • CD84 natural killer cells
  • CD84 signalling can activate or inhibit leukocyte function depending on the cell type and its stage of activation or differentiation.
  • CD84-mediated signalling regulates diverse immunological processes, including T-cell cytokine secretion, natural killer-cell cytotoxicity, monocyte activation, autophagy, cognate T:B interactions and B-cell tolerance at the level of germinal centres.
  • CD84 has been related to autoimmune disorders.
  • specific allelic variations in CD84 are associated with autoimmune diseases such as systemic lupus erythematosus and rheumatoid arthritis (RA).
  • RA systemic lupus erythematosus and rheumatoid arthritis
  • Typical treatment for such autoimmune diseases often involves disease-modifying anti-rheumatic drugs (DMARDS), which are not curative but stop or slow down symptoms and/or disease progression.
  • DARDS disease-modifying anti-rheumatic drugs
  • CD84 is expressed in certain cancers, in particular haematological malignancies, such as chronic lymphocytic leukaemia (CLL).
  • CLL chronic lymphocytic leukaemia
  • Haematological malignancies are often treated by chemotherapy or radiotherapy, which have known adverse side effects. Accordingly, there remains a significant need for improved treatments for haematological malignancies.
  • CD84 is overexpressed in a range of cancer cell lines derived from malignant haematological diseases, including Burkitt’s lymphoma, acute myeloid leukaemia (AML), chronic myeloid leukaemia (CML), B-cell acute lymphoblastic leukaemia (B- ALL), T-cell acute lymphoblastic leukaemia (T-ALL) and histiocytic lymphoma.
  • AML acute myeloid leukaemia
  • CML chronic myeloid leukaemia
  • B- ALL B-cell acute lymphoblastic leukaemia
  • T-ALL T-cell acute lymphoblastic leukaemia
  • histiocytic lymphoma histiocytic lymphoma.
  • the inventors have studied and developed a range of antibodies and chimeric antigen receptors (CARs) that bind CD84.
  • CARs chimeric antigen receptors
  • the inventors have characterised the cellular expression of the CARs and functionally characterised CAR-T cells, for example through determination of their proliferation, cytokine production and their cytotoxicity against a range of target cancer cell lines. Moreover, the inventors have demonstrated that chimeric antigen receptors of the present invention can induce cytotoxicity in cancer cells expressing CD84.
  • the present invention provides an antigen-binding domain comprising: a) a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - NYWIN (SEQ ID NO: 1); CDR2 - DIYPVSGTTNYNEKFKR (SEQ ID NO: 2); and CDR3 - GTGRFAY (SEQ ID NO: 3); or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - NYWLG (SEQ ID NO: 7); CDR2 - DIYPGGGYTNYIEKFKG (SEQ ID NO: 8); and CDR3 - YEGGYYGNYDAMDY (SEQ ID NO: 9), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - GFTFSSYA (SEQ ID NO: 13); CDR2 - ISGSGGST (SEQ ID NO: 14); and CDR3 - AKWDCSDGRCYWAY (SEQ ID NO: 15), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - GFTFSSYP (SEQ ID NO: 19); CDR2 - ISYHGRNK (SEQ ID NO: 20); and CDR3 - ARDRDATPGGTGVGNHGMAV (SEQ ID NO: 21), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - GFTFSDNA (SEQ ID NO: 25); CDR2 - ISGTGRTT (SEQ ID NO: 26); and CDR3 - AKWDCSDGRCYWAY (SEQ ID NO: 27), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - TSGMGVG (SEQ ID NO: 31); CDR2 - HIWWDDVKRYNPALKS (SEQ ID NO: 32); and CDR3 - MRTSYYFDY (SEQ ID NO: 33), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - SYWIN (SEQ ID NO: 37); CDR2 - DIYLGSGSTNYNEKFKS (SEQ ID NO: 38); and CDR3 - SGGYLGY (SEQ ID NO: 39), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - NYWIG (SEQ ID NO: 43); CDR2 - DIYPGGGYTNYNENFKG (SEQ ID NO: 44); and CDR3 - STTYYSSYWCFDV (SEQ ID NO: 45), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - RYWMS (SEQ ID NO: 49); CDR2 - EINPDSSTINYTPSLKD (SEQ ID NO: 50); and CDR3 - PGPTVVATYWYFDV (SEQ ID NO: 51), or variants thereof each having up to three amino acid substitutions, additions or deletions
  • VL light chain variable region
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - RYWIN (SEQ ID NO: 55); CDR2 - DIYPGSGSTNYNEKFKS (SEQ ID NO: 56); and CDR3 - DTTIAY (SEQ ID NO: 57), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - GYNMN (SEQ ID NO: 131); CDR2 - NIDPYYGGTNYNQKFKG (SEQ ID NO: 132); and CDR3 - GLLSGSFPY (SEQ ID NO: 133), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - RSWMS (SEQ ID NO: 137); CDR2 - EINPDSSTINYTPSLKD (SEQ ID NO: 138); and CDR3 - FYDGYSIYWYFDV (SEQ ID NO: 139), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - TSGMGVG (SEQ ID NO: 143); CDR2 - HIWWDDVKRYNPALRS (SEQ ID NO: 144); and CDR3 - IAVTYFFDF (SEQ ID NO: 145), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - TSGMGVG (SEQ ID NO: 149); CDR2 - HIWWDDVKRYNPALKS (SEQ ID NO: 150); and CDR3 - MSTSYYFDY (SEQ ID NO: 151), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - IYAMN (SEQ ID NO: 155); CDR2 - RIRSKSNNYARFYADSVKD (SEQ ID NO: 156); and CDR3 - PLRSYFSMDY (SEQ ID NO: 157), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - KASENVDTYVS (SEQ ID NO: 158); CDR2 - GASNRYT (SEQ ID NO: 159); and CDR
  • the antigen-binding domain comprises: a) a VH domain having the sequence of SEQ ID NO: 61 ; and a VL domain having the sequence of SEQ ID NO: 62 or 108; b) a VH domain having the sequence of SEQ ID NO: 63; and a VL domain having the sequence of SEQ ID NO: 64 or 109; c) a VH domain having the sequence of SEQ ID NO: 65; and a VL domain having the sequence of SEQ ID NO: 66; d) a VH domain having the sequence of SEQ ID NO: 68; and a VL domain having the sequence of SEQ ID NO: 69; e) a VH domain having the sequence of SEQ ID NO: 71 ; and a VL domain having the sequence of SEQ ID NO: 72; f) a VH domain having the sequence of SEQ ID NO: 74; and a VL domain having the sequence of SEQ ID NO: 75; g) a VH domain having the sequence of S
  • the antigen-binding domain is a CD84-binding domain.
  • the antigen-binding domain is an scFv.
  • the invention provides an antibody comprising the antigen-binding domain of the invention.
  • the invention provides a chimeric antigen receptor (CAR) comprising the antigen-binding domain of the invention.
  • CAR chimeric antigen receptor
  • the antigen-binding domain, antibody or CAR of the invention binds to CD84.
  • the CAR is an scFv CAR.
  • the CAR comprises a CD8a or a CD28 transmembrane domain. In preferred embodiments, the CAR comprises a CD8a transmembrane domain.
  • the antigen-binding domain and the transmembrane domain may be connected by a spacer.
  • the spacer comprises a CD8a hinge or a CD28 hinge.
  • the CAR comprises a CD8a hinge.
  • the CAR may comprise one or more, for example two or three, intracellular signalling domains.
  • the CAR comprises a CD3-zeta signalling domain.
  • the CAR may comprise one or more, for example two or three, co-stimulatory domains.
  • the CAR comprises one or more co-stimulatory domains selected from the group consisting of a 4-1 BB co-stimulatory domain, a CD28 co-stimulatory domain, a 0X40 co-stimulatory domain and an ICOS co-stimulatory domain.
  • the CAR comprises a 4-1 BB co-stimulatory domain.
  • the CAR comprises a CD28 co-stimulatory domain.
  • the CAR comprises an 0X40 co-stimulatory domain.
  • the CAR comprises an ICOS co-stimulatory domain.
  • the CAR comprises a 4-1 BB co-stimulatory domain and a CD3- zeta signalling domain.
  • the CAR comprises the antigen-binding domain of the invention, a CD8a transmembrane domain, a 4-1 BB co-stimulatory domain and a CD3-zeta signalling domain.
  • the invention provides a polynucleotide comprising one or more nucleotide sequences encoding the antigen-binding domain, the antibody or the CAR of the invention.
  • the invention provides a vector comprising the polynucleotide of the invention.
  • the vector is a viral vector. In some embodiments, the vector is a retroviral vector or lentiviral vector, preferably a lentiviral vector.
  • the invention provides a cell comprising the polynucleotide or the vector of the invention.
  • the invention provides a cell comprising the antigen-binding domain or the CAR of the invention.
  • the cell may comprise a further (second) CAR.
  • the invention provides a cell comprising a first CAR and a second CAR, wherein the first CAR is the CAR of the invention.
  • the invention provides a composition comprising a first cell and a second cell, wherein the first cell comprises a first CAR and the second cell comprises a second CAR, and wherein the first CAR is the CAR of the invention.
  • the first CAR and the second CAR are different. In some embodiments, the first CAR and the second CAR bind to different antigens.
  • the invention provides a cell comprising a tandem CAR, wherein the tandem CAR comprises a first antigen-binding domain (e.g. scFv) and a second antigen-binding domain (e.g. scFv), and wherein the first antigen-binding domain (e.g. scFv) is the antigenbinding domain (e.g. scFv) of the invention.
  • first antigen-binding domain e.g. scFv
  • a second antigen-binding domain e.g. scFv
  • the first antigen-binding domain (e.g. scFv) and the second antigenbinding domain (e.g. scFv) are different. In some embodiments, the first antigen-binding domain (e.g. scFv) and the second antigen-binding domain (e.g. scFv) bind to different antigens.
  • the second CAR is an anti-CD19 CAR, an anti-CD20 CAR or an anti- CD22 CAR (e.g. for the treatment of B-cell malignancies); an anti-CD33 CAR or an anti-CD123 CAR (e.g. for the treatment of AML); or an anti-CD7 CAR (e.g. for the treatment of T-ALL).
  • the second antigen-binding domain is an anti-CD19 antigen-binding domain (e.g. scFv), an anti-CD20 antigen-binding domain (e.g. scFv) or an anti-CD22 antigen-binding domain (e.g. scFv) (e.g. for the treatment of B-cell malignancies); an anti-CD33 antigen-binding domain (e.g. scFv) or an anti-CD123 antigen-binding domain (e.g. scFv) (e.g. for the treatment of AML); or an anti-CD7 antigen-binding domain (e.g. scFv) (e.g. for the treatment of T-ALL).
  • an anti-CD19 antigen-binding domain e.g. scFv
  • an anti-CD20 antigen-binding domain e.g. scFv
  • an anti-CD22 antigen-binding domain e.g. for the treatment of B
  • the cell is a T cell or NK cell, preferably a T cell.
  • the T cell is an autologous or allogeneic T cell.
  • the NK cell is an autologous or allogeneic NK cell.
  • NK cells may, for example, be sourced from any suitable tissue sample, cell line or stem cell source.
  • the NK cell preferably allogeneic NK cell
  • the NK cell is from cord blood (CB), induced pluripotent stem cells (iPSCs), bone marrow (BM), human embryonic stem cells (hESCs), a cell line (e.g. NK92 or YT), or peripheral blood (PB) (e.g. autologous or allogeneic).
  • CB cord blood
  • iPSCs induced pluripotent stem cells
  • BM bone marrow
  • hESCs human embryonic stem cells
  • a cell line e.g. NK92 or YT
  • PB peripheral blood
  • the NK cell is from CB.
  • the invention provides a pharmaceutical composition comprising the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector or the cell of the invention.
  • the invention provides the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in therapy.
  • the therapy is treatment of cancer.
  • the invention provides a method for treating a disease comprising administering the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention to a subject in need thereof.
  • the disease is cancer.
  • the invention provides use of the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for the manufacture of a medicament.
  • the medicament is for treating a disease, preferably cancer.
  • the cancer is a haematological malignancy.
  • the cancer cells express CD84, for example the haematological malignancy may be a CD84-expressing haematological malignancy.
  • the cancer is selected from the group consisting of chronic lymphocytic leukaemia (CLL), B-cell lymphoma, diffuse large B-cell lymphoma (DLBCL), Burkitt’s lymphoma, follicular lymphoma, mantle cell lymphoma, B-cell acute lymphoblastic leukaemia (B-ALL), acute myeloid leukaemia (AML), myelodysplastic syndrome, T-cell acute lymphoblastic leukaemia/lymphoma (T-ALL), chronic myeloproliferative syndrome, chronic myeloid leukaemia (CML), chronic myelomonocytic leukaemia, dendritic-cell neoplasm and histiocytic sarcoma.
  • CLL chronic lymphocytic leukaemia
  • B-ALL B-cell acute lymphoblastic leukaemia
  • AML acute myeloid leukaemia
  • T-ALL T-cell acute lymphoblastic leuka
  • the cancer is selected from the group consisting of chronic lymphocytic leukaemia (CLL), diffuse large B-cell lymphoma (DLBCL), Burkitt’s lymphoma, follicular lymphoma, mantle cell lymphoma, B-cell acute lymphoblastic leukaemia (B-ALL), T-cell acute lymphoblastic leukaemia/lymphoma (T-ALL), acute myeloid leukemia (AML) and histiocytic sarcoma.
  • CLL chronic lymphocytic leukaemia
  • DLBCL diffuse large B-cell lymphoma
  • Burkitt’s lymphoma Burkitt’s lymphoma
  • follicular lymphoma mantle cell lymphoma
  • B-ALL B-cell acute lymphoblastic leukaemia
  • T-ALL T-cell acute lymphoblastic leukaemia/lymphoma
  • AML acute myeloid leukemia
  • the cancer is selected from the group consisting of CLL, B-cell lymphoma, B-ALL, T-ALL and AML.
  • the invention provides the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in treating AML.
  • the invention provides the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in treating T-ALL.
  • the invention provides the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in treating B-cell lymphoma.
  • the invention provides the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in treating Burkitt’s lymphoma.
  • the invention provides use of the antigen-binding domain or the antibody of the invention for determining CD84 expression level in a sample, optionally for analysing a CD84 expression level in a sample from a subject.
  • the invention provides a method for identifying a subject suitable for treatment with an anti-CD84 CAR or antibody, wherein the method comprises determining a CD84 expression level in a sample isolated from the subject, wherein the CD84 expression level is determined using the antigen-binding domain or the antibody of the invention.
  • the sample is a blood sample.
  • Figure 2 Box and whisker (10-90 percentile) representation of CD84 mRNA expression measured by RNA sequencing (top) or Affymetrix microarrays (bottom) in cell lines obtained from different tumour types. From htps://portals.broadinstitute.org/ccle. The figure only shows the 20 tumour types with the highest CD84 expression.
  • FIG. 1 Expression of CD84 in different cell lines.
  • the histogram in light grey represents the staining with an isotype-matched control antibody and the histogram in dark grey the staining with the specific CD84 antibody.
  • Figure 4 Expression of CD84 in nine samples from patients diagnosed with chronic lymphocytic leukaemia assessed by flow cytometry. The histogram in light grey represents the staining with an isotype-matched control antibody and the histogram in dark grey the staining with the specific CD84 antibody.
  • Figure 5. Expression of CD84 in ten samples from patients diagnosed with acute myeloid leukaemia was assessed by flow cytometry. One representative example is shown for moderate expression of CD84, patient P04, and one for high expression of CD84, patient P10. The histogram in light grey represents the staining with an isotype-matched control antibody and the histogram in dark grey the staining with the specific CD84 antibody.
  • FIG. 1 Map of the pCCL-EF1a_CAR84 plasmid vector showing where the CD84 CAR sequence has been inserted (top). Scheme of the anti-CD84 2 nd generation CAR construct (bottom).
  • FIG. 7 IFN-y secretion by CD84-targeting CAR-T cells in co-culture with Ramos cells at an effectortarget ratio of 2:1 , following a 24 h incubation.
  • UT untransduced T cells.
  • Statistical significance was determined with a Kruskal-Wallis (multiple comparisons to UT). The mean of 4 experiments ⁇ SEM is shown. *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • Figure 8 IL-2 secretion by CD84-targeting CART cells in co-culture with Ramos cells at an effectortarget ratio of 2:1 , following a 24 h incubation.
  • UT untransduced T cells.
  • Statistical significance was determined with a Kruskal-Wallis (multiple comparisons to UT). The mean of 4 experiments ⁇ SEM is shown. *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • FIG. 9 Granzyme B secretion by CD84-targeting CART cells in co-culture with Ramos cells at an effector: target ratio of 2:1 , following a 24 h incubation.
  • UT untransduced T cells.
  • Statistical significance was determined with a Kruskal-Wallis (multiple comparisons to UT). The mean of 4 experiments ⁇ SEM is shown. *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • FIG. 10 TNF-a secretion by CD84-targeting CART cells in co-culture with Ramos cells at an effectortarget ratio of 2:1 , following a 24 h incubation.
  • UT untransduced T cells.
  • Statistical significance was determined with a Kruskal-Wallis (multiple comparisons to UT). The mean of 4 experiments ⁇ SEM is shown. *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • FIG. 11 Cytotoxicity assay of different CD84-targeting CART cells vs. Ramos-GFP + cells after an incubation period of 24 hours at an effectortarget ratio of 2:1. Percentage of target surviving cells relative to untreated cells (target cells alone) is shown. Mean of 8 independent experiments ⁇ SEM. UT : untransduced T cells. Statistical significance was determined with an ordinary one-way ANOVA (multiple comparisons to UT): ** p ⁇ 0.001 , * p ⁇ 0.01.
  • FIG. 13 Cytotoxicity assay of different CD84-targeting CART cells vs. Ramos-GFP + cells after an incubation period of 24 and 48 hours at effectortarget (E:T) cell ratios of 4:1 , 2:1 , 1 :1 and 0.5:1. Percentage of target surviving cells relative to untreated cells (target cells alone) is shown. Mean of 5 independent experiments ⁇ SEM. UT: untransduced T cells. Statistical significance was determined with an ordinary one-way ANOVA (multiple comparisons to UT): *** p ⁇ 0.001 , * p ⁇ 0.05.
  • FIG. 14 Cytotoxicity assay of different CD84-targeting CART cells vs. K562-GFP + cells after an incubation period of 24 and 48 hours at effectortarget (E:T) cell ratios of 4:1 , 2:1 , 1 :1 and 0.5:1. Percentage of target surviving cells relative to untreated cells (target cells alone) is shown.
  • UT untransduced T cells. Mean of 5 independent experiments ⁇ SEM. Statistical significance was determined with an ordinary one-way ANOVA (multiple comparisons to UT): ** p ⁇ 0.01 , * p ⁇ 0.05, n.s.: non significant.
  • FIG. 15 Cytotoxicity assay of different CD84-targeting CART cells vs. MOLM-13-GFP + cells after an incubation period of 24 and 48 hours at effectortarget (E:T) cell ratios of 4:1 , 2:1 , 1 :1 and 0.5:1. Percentage of target surviving cells relative to untreated cells (target cells alone) is shown. Mean of 3 independent experiments ⁇ SEM, UT: untransduced T cells. Statistical significance was determined with an ordinary one-way ANOVA (multiple comparisons to UT): *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • FIG. 16 Cytotoxicity assay of different CD84-targeting CART cells vs. NALM6-GFP + cells after an incubation period of 24 and 48 hours at effectortarget (E:T) cell ratios of 4:1 , 2:1 , 1 :1 and 0.5:1. Percentage of target surviving cells relative to untreated cells (target cells alone), is shown. Mean of 3 independent experiments ⁇ SEM. UT: untransduced T cells. Statistical significance was determined with an ordinary one-way ANOVA (multiple comparisons to UT): *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • FIG. 17 Cytotoxicity assay of different CD84-targeting CART cells vs. MOLT4-GFP + cells after an incubation period of 24 and 48 hours at effector: target ratios of 4:1 , 2:1 , 1 :1 and 0.5:1. Percentage of target surviving cells relative to untreated cells (target cells alone), is shown. Mean of 4 independent experiments ⁇ SEM. UT: untransduced T cells. Statistical significance was determined with an ordinary one-way ANOVA (multiple comparisons to UT): ** p ⁇ 0.01 , * p ⁇ 0.05, ns: non significant.
  • Figure 18 Expression of CD84 in peripheral blood mononuclear cells (PBMC) assessed by flow cytometry. The histogram in light grey represents the staining with an isotype-matched control antibody and the histogram in dark grey the staining with the specific CD84 antibody. PBMC were stained with specific antibodies for CD4, CD8, CD19, and CD14.
  • PBMC peripheral blood mononuclear cells
  • Figure 20 SDS PAGE gel image of CD84 antigen. Reduced SDS PAGE with Coomassie blue staining.
  • FIG. 21 CD84 expression assessed by flow cytometry on leukemic cells from peripheral blood from two patients diagnosed with T-ALL (P01 and P02).
  • the histograms represent CD84 expression on blasts gated for CD34; histograms in light grey represent the staining with an isotype-matched control antibody and those in dark grey, the staining with the specific CD84 antibody.
  • FIG. 22 Expansion of CAR T cells 6-7 days after transduction is shown as fold increase over number of T cells at day 0 of culture. The figure represents between 5 and 12 independent expansions, each using cells from a different healthy donor. UT: untransduced T cells.
  • FIG. 23 Cytotoxicity assays of different CD84-targeting CART cells vs. Ramos-GFPffLuc cells after an incubation period of 24 and 48 hours at effectortarget (E:T) cell ratios of 4:1 , 2:1 , 1 :1 and 0.5:1. Percentage of target surviving cells relative to untreated cells (target cells alone) is shown. Mean of 5 independent experiments ⁇ SEM. UT: untransduced T cells. Statistical significance was determined with a two-way ANOVA test (multiple comparisons to UT): *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • FIG. 24 Cytotoxicity assays of different CD84-targeting CART cells vs. MOLM-13 GFPffLuc cells after an incubation period of 24 and 48 hours at effectortarget (E:T) cell ratios of 4:1 , 2:1 , 1 :1 and 0.5:1. Percentage of target surviving cells relative to untreated cells (target cells alone) is shown. Mean of at least 5 independent experiments ⁇ SEM. UT: untransduced T cells. Statistical significance was determined with a two-way ANOVA test (multiple comparisons to UT): *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • Figure 25 Cytotoxicity assays of different CD84-targeting CART cells vs.
  • UT untransduced T cells. Statistical significance was determined with a two-way ANOVA test (multiple comparisons to UT): *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • FIG. 26 Cytotoxicity assays of different CD84-targeting CART cells vs. MOLT-4 GFPffLuc cells after an incubation period of 24 and 48 hours at effectortarget (E:T) cell ratios of 4:1 , 2:1 , 1 :1 and 0.5:1. Percentage of target surviving cells relative to untreated cells (target cells alone) is shown. Mean of at least 5 independent experiments ⁇ SEM. UT: untransduced T cells. Statistical significance was determined with a two-way ANOVA test (multiple comparisons to UT): *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • FIG. 27 Cytotoxicity assay of different CD84-targeting CART cells vs. primary AML cells stained with CFSE after an incubation period of 24 and 48 hours at effectortarget (E:T) cell ratios of 4:1 , 2:1 , 1 :1 and 0.5:1. Percentage of target surviving cells relative to untreated cells (target cells alone) is shown.
  • UT untransduced T cells.
  • Statistical significance was determined with a two-way ANOVA test (multiple comparisons to UT): *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • FIG. 28 Cytotoxicity assay of different CD84-targeting CART cells vs. primary T-ALL cells stained with CFSE after an incubation period of 24 and 48 hours at effectortarget (E:T) cell ratios of 4:1 , 2:1 , 1 :1 and 0.5:1. Percentage of target surviving cells relative to untreated cells (target cells alone) is shown.
  • UT untransduced T cells.
  • Statistical significance was determined with a two-way ANOVA test (multiple comparisons to UT): *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • FIG. 29 IFN-y secretion by CD84-targeting CAR-T cells in co-culture with Ramos, MOLM- 13 or MOLT-4 cells, as indicated, at an effectortarget ratio of 2:1 , following a 24 h incubation.
  • UT untransduced T cells.
  • Statistical analysis was determined with a 2-way ANOVA mixed- effect analysis assuming sphericity and Dunnet post-test for multiple comparisons (vs. UT). The mean of at least 3 experiments ⁇ SD is shown. *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • FIG. 30 Granzyme B secretion by CD84-targeting CAR-T cells in co-culture with Ramos, MOLM-13 or MOLT-4 cells, as indicated, at an effectortarget ratio of 2:1 , following a 24 h incubation.
  • UT untransduced T cells.
  • Statistical analysis was determined with a 2-way ANOVA mixed-effect analysis assuming sphericity and Dunnet post-test for multiple comparisons (vs. UT). The mean of at least 3 experiments ⁇ SD is shown. *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • Figure 31 Figure 31.
  • UT untransduced T cells.
  • Statistical analysis was determined with a 2-way ANOVA mixed- effect analysis assuming sphericity and Dunnet post-test for multiple comparisons (vs. UT). The mean of at least 3 experiments ⁇ SD is shown. *** p ⁇ 0.001 , ** p ⁇ 0.01 , * p ⁇ 0.05.
  • FIG. 32 CART-cell proliferation in vitro measured by a CFSE assay at a 4-day time point (flow cytometry images). Proliferation on day 0, after 4 days only with media (control), when stimulated with IL-2 or in the presence of MOLM-13 AML cells. UT: untransduced T cells.
  • Figure 33 CD84, CD33 and CD123 expression assessed by flow cytometry on CD34 + HPSC isolated from the apheresis product of a healthy donor for an allogeneic stem cell transplant.
  • the histograms in light grey represent the staining with an isotype-matched control antibody and those in dark grey, the staining with the specific antibody.
  • FIG. 34 Cytotoxicity assay of different CD84-targeting CART cells vs. CD34 + HPSC isolated from 5 different cord blood units after an incubation period of 24 hours at effector: target (E:T) cell ratios 4:1 and 2:1. Percentage of target surviving cells relative to untreated cells (target cells alone) is shown. Mean of 5 independent experiments ⁇ SEM. UT: untransduced T cells. Statistical significance was determined with a 2-way ANOVA (multiple comparisons to UT): *** p ⁇ 0.001 , **p ⁇ 0.01 , *p ⁇ 0.05.
  • FIG. 35 Cytotoxicity assay of different CD84-targeting CART cells vs. CD34 + HPSC isolated from the apheresis product of a healthy donor for an allogeneic stem cell transplant, after an incubation period of 24 hours at effectortarget (E:T) cell ratios 4:1 , 2:1 , 1 :1 and 0.5:1. Percentage of target surviving cells relative to untreated cells (target cells alone) is shown. Mean of three independent experiments ⁇ SEM. UT: untransduced T cells. Statistical significance was determined with a 2-way ANOVA (multiple comparisons to UT): *** p ⁇ 0.001 , **p ⁇ 0.01 , *p ⁇ 0.05.
  • FIG. 36 Cytotoxicity assay of different CD84-targeting CART cells vs. CD3 + T cells isolated from the same donor, after an incubation period of 24 hours at effectortarget (E:T) cell ratios 4:1 , 2:1 , 1 :1 and 0.5:1. Percentage of target surviving T cells relative to untreated cells (target T cells alone) is shown. Mean of 5 independent experiments ⁇ SEM. UT : untransduced T cells. Statistical significance was determined with a 2-way ANOVA (multiple comparisons to UT): *** p ⁇ 0.001 , **p ⁇ 0.01 , *p ⁇ 0.05.
  • FIG. 37 Analysis by flow cytometry of the different T-cell subsets on target T cells before and on surviving target T cells after co-culture with the different CART84.
  • the following T-cell subsets were studied: CD45RA+/CD62L+ naive (white), CD45RA-/CD62L+ central-memory (dark grey), CD45RA-/CD62L- effector-memory (black), and CD45RA+/CD62L- effector T cells (light grey).
  • FIG. 38 Efficacy of CART84 cells against MOLM-13 cells in vivo. MOLM-13 disease progression was monitored weekly by bioluminescence. Bioluminescence quantification (A) and animal survival (B). Statistical analysis of bioluminescence quantification was performed with a 2-way ANOVA model with Dunnett’s multiple comparisons vs. UT-treated mice. Statistical significance of survival was determined with a Log-Rank test with corrected p value for 3 comparisons.
  • FIG 39 Efficacy of CART84 cells against MOLM-13 cells in vivo. MOLM-13 disease progression was monitored weekly by bioluminescence. Bioluminescence quantification (A) and animal survival (B). Total number of MOLM-13 GFP-ffLuc cells (C), CD3 + T cells (D) and CART cells (E) assessed by flow cytometry in the bone marrow (top) and spleen (bottom) of mice at the experiment end-point. Statistical analysis of bioluminescence quantification was performed with a 2-way ANOVA model with Dunnett’s multiple comparisons vs. UT-treated mice. Statistical significance of survival was determined with a Log-Rank test with corrected p value for 3 comparisons.
  • FIG. 40 Efficacy of CD84 CART cells against MOLM-13 cells in vivo. MOLM-13 disease progression was followed weekly by bioluminescence. Bioluminescence quantification (A) and animal survival (B). Total number of MOLM-13 GFP-ffLuc cells (C), CD3 + T cells (D) and CART cells (E) assessed by flow cytometry in the bone marrow (top) and spleen (bottom) of mice at the experiment end-point. Statistical analysis of bioluminescence quantification was performed with a 2-way ANOVA model with Dunnett’s multiple comparisons vs. UT-treated mice. Statistical significance of survival was determined with a Log-Rank test with corrected p value for 3 comparisons.
  • FIG 41 Efficacy of CD84 CART cells against MOLT-4 cells in vivo. MOLT-4 disease progression was monitored weekly by bioluminescence. Bioluminescence quantification (A) and animal survival (B). Statistical analysis of bioluminescence quantification was performed with a 2-way ANOVA model with Dunnett’s multiple comparisons vs. UT-treated mice. Statistical significance of survival was determined with a Log-Rank test with corrected p value for 3 comparisons.
  • FIG. 42 Efficacy of CD84 CART cells against MOLT-4 cells in vivo. MOLT-4 disease progression was monitored weekly by bioluminescence. Bioluminescence quantification (A) and animal survival (B). Total number of MOLT-4 GFP-ffLuc cells (C), CD3 + T cells (D) and CART cells (E) detected by flow cytometry in the bone marrow (top) and spleen (bottom) of mice at the experiment end-point. Statistical analysis of bioluminescence quantification was performed with a 2-way ANOVA model with Dunnett’s multiple comparisons vs. UT-treated mice. Statistical significance of survival was determined with a Log-Rank test with corrected p value for 3 comparisons.
  • Figure 43 CD84 expression on human primary cells assessed by flow cytometry.
  • the histogram in light grey represents the staining with an isotype-matched control antibody and the histogram in dark grey the staining with the specific CD84 antibody.
  • FIG. 44 Cytotoxicity assays of CART84 cells 152.3, 153.5 and UT vs. human primary cells, measured during 72 hours after CART I UT addition (arrow) to the cell culture using an XCELLigence instrument. UT: untransduced T cells.
  • Figure 45 Efficacy of CD84 CART cells against Ramos cells in vivo.
  • A Ramos disease progression was monitored weekly by bioluminescence. Statistical analysis of bioluminescence quantification was performed with a 2-way ANOVA model with Dunnett’s multiple comparisons vs. UT-treated mice.
  • B Total number of Ramos GFP-ffLuc cells assessed by flow cytometry in the bone marrow of mice at the end-point. Statistical analysis was performed with a one-way ANOVA model with Dunnett’s multiple comparisons vs. UT- treated mice. UT: untransduced T cells. * p ⁇ 0.05.
  • CD84 (also known as LY9B and SLAMF5) is a membrane glycoprotein that is a member of the signalling lymphocyte activation molecule (SLAM) family, which itself is a subset of the larger CD2 cell-surface receptor subgroup of the Ig superfamily.
  • SLAM signalling lymphocyte activation molecule
  • the extracellular part of the CD84 receptor contains a non-canonical IgV distal domain and an lgC2g proximal domain, a structure common to all members of the SLAM family.
  • CD84 functions as an homophilic adhesion molecule and is expressed in numerous immune cell types.
  • CD84 is overexpressed in a range of cell lines derived from malignant haematological diseases, including Burkitt’s lymphoma, acute myeloid leukaemia (AML), chronic myeloid leukaemia (CML), B-cell acute lymphoblastic leukaemia (B- ALL), T-cell acute lymphoblastic leukaemia (T-ALL) and histiocytic lymphoma.
  • AML acute myeloid leukaemia
  • CML chronic myeloid leukaemia
  • B- ALL B-cell acute lymphoblastic leukaemia
  • T-ALL T-cell acute lymphoblastic leukaemia
  • histiocytic lymphoma histiocytic lymphoma
  • CD84 is overexpressed in chronic lymphocytic leukaemia (CLL).
  • An example amino acid sequence of CD84 is:
  • An antigen-binding domain may be a protein or peptide that possesses the ability to recognise and bind to an antigen.
  • the antigen-binding domain includes any naturally occurring, synthetic, semi-synthetic or recombinantly produced binding partner for an antigen of interest.
  • Illustrative antigen-binding domains include antibodies or antibody fragments or derivatives, extracellular domains of receptors (e.g. TCRs), ligands for cell surface molecules/receptors, or receptor binding domains thereof.
  • TCRs extracellular domains of receptors
  • ligands for cell surface molecules/receptors ligands for cell surface molecules/receptors, or receptor binding domains thereof.
  • the antigen-binding domain is, or is derived from, an antibody.
  • An antibody-derived domain can be a fragment of an antibody or a genetically engineered product of one or more fragments of the antibody, which fragment is involved in binding with the antigen. Examples include a variable region (Fv), a complementarity determining region (CDR), a Fab, a single chain variable fragment (scFv), a heavy chain variable region (VH), a light chain variable region (VL) and a camelid antibody (VHH).
  • the antigen-binding domain may be non-human (e.g. murine), chimeric, humanised or fully human.
  • the antigen-binding domain is a single chain variable fragment (scFv).
  • the scFv may be, for example, a murine, human or humanised scFv.
  • CDR complementarity determining region
  • VH Heavy chain variable region
  • Light chain variable region refers to the variable fragment of the light chain of an antibody that contains three CDRs interposed between framework regions.
  • Fv refers to the smallest fragment of an antibody to bear the complete antigen-binding site.
  • An Fv consists of the variable region of a single light chain bound to the variable region of a single heavy chain.
  • Single chain variable fragment refers to an engineered antibody consisting of a light chain variable region (VL) and a heavy chain variable region (VH) connected to one another directly or via a peptide linker sequence.
  • the antigen-binding domain may specifically bind to the antigen, for example bind to the antigen but not bind to other peptides, or bind at a lower affinity to other peptides.
  • the binding affinity between two molecules may be quantified, for example, by determination of the dissociation constant (K D ).
  • K D can be determined by measurement of the kinetics of complex formation and dissociation between the antigen-binding domain and antigen, e.g. using a technique such as surface plasmon resonance (SPR).
  • SPR surface plasmon resonance
  • the rate constants corresponding to the association and the dissociation of a complex are referred to as the association rate constant k a (or k on ) and dissociation rate constant kd (or k O ff) , respectively.
  • the antigen-binding domain is a CD84-binding domain.
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - NYWIN (SEQ ID NO: 1); CDR2 - DIYPVSGTTNYNEKFKR (SEQ ID NO: 2); and CDR3 - GTGRFAY (SEQ ID NO: 3); or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - RASQSVSTSSYSYMH (SEQ ID NO: 4); CDR2 - FASNLES (SEQ ID NO: 5); and CDR3 - QHSWEIPYT (SEQ ID NO: 6); or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region having complementarity determining regions
  • CDRs complementarity determining regions
  • CDRs complementarity determining regions
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - NYWLG (SEQ ID NO: 7); CDR2 - DIYPGGGYTNYIEKFKG (SEQ ID NO: 8); and CDR3 - YEGGYYGNYDAMDY (SEQ ID NO: 9), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - RASESVDNYGISFMN (SEQ ID NO: 10); CDR2 - AASNQGS (SEQ ID NO: 11); and CDR3 - QQSKAVPRT (SEQ ID NO: 12), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region
  • CDRs complementarity determining regions
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - GFTFSSYA (SEQ ID NO: 13); CDR2 - ISGSGGST (SEQ ID NO: 14); and CDR3 - AKWDCSDGRCYWAY (SEQ ID NO: 15), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - NIESKD (SEQ ID NO: 16); CDR2 - DDA (SEQ ID NO: 17); and CDR3 - QVWDSSSDHVV (SEQ ID NO: 18), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region
  • CDRs complementarity determining regions
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - GFTFSSYP (SEQ ID NO: 19); CDR2 - ISYHGRNK (SEQ ID NO: 20); and CDR3 - ARDRDATPGGTGVGNHGMAV (SEQ ID NO: 21), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - QSLLHSSGYNY (SEQ ID NO: 22); CDR2 - MGS (SEQ ID NO: 23); and CDR3 - MQGLQTPPT (SEQ ID NO: 24), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region
  • CDRs complementarity determining regions
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - GFTFSDNA (SEQ ID NO: 25); CDR2 - ISGTGRTT (SEQ ID NO: 26); and CDR3 - AKWDCSDGRCYWAY (SEQ ID NO: 27), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - QSLVYSDGDTY (SEQ ID NO: 28); CDR2 - KVS (SEQ ID NO: 29); and CDR3 - MQGTHWPPNT (SEQ ID NO: 30), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region having complementarity determining regions
  • CDRs complementarity determining regions
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - TSGMGVG (SEQ ID NO: 31); CDR2 - HIWWDDVKRYNPALKS (SEQ ID NO: 32); and CDR3 - MRTSYYFDY (SEQ ID NO: 33), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - RASENIFSSLA (SEQ ID NO: 34); CDR2 - NAKTLAE (SEQ ID NO: 35); and CDR3 - QHHYATPFT (SEQ ID NO: 36), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region having complementarity determining regions
  • CDRs complementarity determining regions
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - SYWIN (SEQ ID NO: 37); CDR2 - DIYLGSGSTNYNEKFKS (SEQ ID NO: 38); and CDR3 - SGGYLGY (SEQ ID NO: 39), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - RASQSVSTSSYSYMH (SEQ ID NO: 40); CDR2 - FASNLES (SEQ ID NO: 41); and CDR3 - QHSWEIPYT (SEQ ID NO: 42), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region having complementarity determining regions
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - NYWIG (SEQ ID NO: 43); CDR2 - DIYPGGGYTNYNENFKG (SEQ ID NO: 44); and CDR3 - STTYYSSYWCFDV (SEQ ID NO: 45), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - KSSQSLLNSGNQANYLA (SEQ ID NO: 46); CDR2 - GASTRES (SEQ ID NO: 47); and CDR3 - QNDHSYPFT (SEQ ID NO: 48), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region having complementarity determining regions
  • CDRs complementarity determining regions
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - RYWMS (SEQ ID NO: 49); CDR2 - EINPDSSTINYTPSLKD (SEQ ID NO: 50); and CDR3 - PGPTWATYWYFDV (SEQ ID NO: 51), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - RSSQSIVHSNGNTYLE (SEQ ID NO: 52); CDR2 - KVSSRFS (SEQ ID NO: 53); and CDR3 - FQGSHVPRT (SEQ ID NO: 54), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region having complementarity determining regions
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - RYWIN (SEQ ID NO: 55); CDR2 - DIYPGSGSTNYNEKFKS (SEQ ID NO: 56); and CDR3 - DTTIAY (SEQ ID NO: 57), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - RASQSVTTSRYSYMH (SEQ ID NO: 58); CDR2 - FASNLES (SEQ ID NO: 59); and CDR3 - QHSWEIPYT (SEQ ID NO: 60), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region having complementarity determining regions
  • CDRs complementarity determining regions
  • CDRs complementarity determining regions
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - GYNMN (SEQ ID NO: 131); CDR2 - NIDPYYGGTNYNQKFKG (SEQ ID NO: 132); and CDR3
  • VH heavy chain variable region
  • CDRs complementarity determining regions
  • VL light chain variable region having CDRs with the sequences: CDR1 - RASENIYSYLA (SEQ ID NO: 134); CDR2 - NAKTLAE (SEQ ID NO: 135); and CDR3 - QHHYGSPLT (SEQ ID NO: 136), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - RSWMS (SEQ ID NO: 137); CDR2 - EINPDSSTINYTPSLKD (SEQ ID NO: 138); and CDR3
  • VH heavy chain variable region
  • CDRs complementarity determining regions
  • VL light chain variable region having CDRs with the sequences: CDR1 - RSSQSIVHSNGDTYLE (SEQ ID NO: 140); CDR2 - KVSNRFS (SEQ ID NO: 141); and CDR3 - FQGSHVPRT (SEQ ID NO: 142), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - TSGMGVG (SEQ ID NO: 143); CDR2 - HIWWDDVKRYNPALRS (SEQ ID NO: 144); and CDR3 - IAVTYFFDF (SEQ ID NO: 145), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - RASENIFSSFA (SEQ ID NO: 146); CDR2 - NARTLAE (SEQ ID NO: 147); and CDR3 - QHHYASPFT (SEQ ID NO: 148), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region
  • CDRs complementarity determining regions
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - TSGMGVG (SEQ ID NO: 149); CDR2 - HIWWDDVKRYNPALKS (SEQ ID NO: 150); and CDR3 - MSTSYYFDY (SEQ ID NO: 151), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - KASQSLFTSVA (SEQ ID NO: 152); CDR2 - SASYRYT (SEQ ID NO: 153); and CDR3 - QQHYSSPFT (SEQ ID NO: 154), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region
  • CDRs complementarity determining regions
  • the antigen-binding domain comprises a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - IYAMN (SEQ ID NO: 155); CDR2 - RIRSKSNNYARFYADSVKD (SEQ ID NO: 156); and CDR3 - PLRSYFSMDY (SEQ ID NO: 157), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - KASENVDTYVS (SEQ ID NO: 158); CDR2 - GASNRYT (SEQ ID NO: 159); and CDR3 - GQTYSYPWT (SEQ ID NO: 160), or variants thereof each having up to three amino acid substitutions, additions or deletions.
  • VH heavy chain variable region
  • CDRs complementarity determining regions
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 61 ; and a VL domain having the sequence of SEQ ID NO: 62 or
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 63; and a VL domain having the sequence of SEQ ID NO: 64 or
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 65; and a VL domain having the sequence of SEQ ID NO: 66, or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 68; and a VL domain having the sequence of SEQ ID NO: 69, or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 71; and a VL domain having the sequence of SEQ ID NO: 72, or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 74; and a VL domain having the sequence of SEQ ID NO: 75, or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 76; and a VL domain having the sequence of SEQ ID NO: 77, or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 78; and a VL domain having the sequence of SEQ ID NO: 79, or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 80; and a VL domain having the sequence of SEQ ID NO: 81 , or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 82; and a VL domain having the sequence of SEQ ID NO: 83, or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 161 ; and a VL domain having the sequence of SEQ ID NO: 162, or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 163; and a VL domain having the sequence of SEQ ID NO: 164, or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 165; and a VL domain having the sequence of SEQ ID NO: 166, or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 167; and a VL domain having the sequence of SEQ ID NO: 168, or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the antigen-binding domain comprises a VH domain having the sequence of SEQ ID NO: 169; and a VL domain having the sequence of SEQ ID NO: 170, or variants thereof each having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the CD84-binding domain may be a scFv.
  • a scFv may comprise the heavy variable region (VH) and light chain variable region (VL) of an antibody, connected with a short linker peptide, for example of about 10 to 25 amino acids.
  • the scFv may be in the orientation (from N- to C- terminus) VH-VL or VL-VH. In some embodiments, the scFv is in the orientation (from N- to C-terminus) VH-VL. In some embodiments, the scFv is in the orientation (from N- to C- terminus) VL-VH.
  • Example linker sequences for connecting VH and VL domains include:
  • GGGGSGGGGSGGGGSGGGGAS SEQ ID NO : 67
  • GGGGSGGGGSGGGGS SEQ ID NO : 110
  • the antigen-binding domain may comprise or consist of the sequence of any one of SEQ ID NOs: 61 , 63, 112-125 or 181-184, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the variant may bind to CD84 at least as well as the corresponding antigen-binding domain shown as SEQ ID NO: 61 , 63, 112-125 or 181-184.
  • the variant may specifically bind to CD84 with a binding affinity which is at least equivalent to the binding affinity between the corresponding antigen-binding domain shown as SEQ ID NO: 61 , 63, 112- 125 or 181-184 and CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 61 , or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 63, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 112, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 113, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 114, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 115, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 116, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 117, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of
  • SEQ ID NO: 118 or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 119, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 120, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 121 , or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 122, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 123, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 124, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 125, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 181 , or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 182, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 183, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain comprises or consists of the sequence of SEQ ID NO: 184, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto, and preferably retaining the ability to bind to CD84.
  • the antigen-binding domain may be comprised in a chimeric antigen receptor (CAR).
  • CAR chimeric antigen receptor
  • CAR Chimeric antigen receptor
  • NK cells e.g. from cord blood (CB), induced pluripotent stem cells (iPSCs), bone marrow (BM), human embryonic stem cells (hESCs), a cell line (e.g.
  • CARs used in NK cells may have other transmembrane domains (such as NKG2D or DAP12) and other co-stimulatory domains (such as NKG2D or 2B4) and they may incorporate genes for IL-2 or IL-15 within the CAR construct to constantly provide cytokine support to the CAR-NK cells.
  • CARs may, for example, comprise an antigen-binding domain, a transmembrane domain and an intracellular signaling domain (endodomain).
  • the CAR comprises a CD84-binding domain, a transmembrane domain and an intracellular signaling domain.
  • the CAR may comprise one or more co-stimulatory domain.
  • the antigen-binding domain (e.g. CD84-binding domain) of the CAR may be an antigenbinding domain as disclosed herein.
  • the invention provides a chimeric antigen receptor (CAR) comprising or consisting of the sequence of any one of SEQ ID NOs: 172-180, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • CAR chimeric antigen receptor
  • the variant may function at least as well as the corresponding CAR shown as SEQ ID NO: 172-180.
  • the variant may specifically bind to CD84 with a binding affinity which is at least equivalent to the binding affinity between the corresponding CAR shown as SEQ ID NO: 172-180 and CD84.
  • the invention provides a chimeric antigen receptor (CAR) comprising or consisting of the sequence of SEQ ID NO: 172, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • CAR chimeric antigen receptor
  • the invention provides a chimeric antigen receptor (CAR) comprising or consisting of the sequence of SEQ ID NO: 173, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • CAR chimeric antigen receptor
  • the invention provides a chimeric antigen receptor (CAR) comprising or consisting of the sequence of SEQ ID NO: 174, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • CAR chimeric antigen receptor
  • the invention provides a chimeric antigen receptor (CAR) comprising or consisting of the sequence of SEQ ID NO: 175, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • CAR chimeric antigen receptor
  • the invention provides a chimeric antigen receptor (CAR) comprising or consisting of the sequence of SEQ ID NO: 176, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • CAR chimeric antigen receptor
  • the invention provides a chimeric antigen receptor (CAR) comprising or consisting of the sequence of SEQ ID NO: 177, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • CAR chimeric antigen receptor
  • the invention provides a chimeric antigen receptor (CAR) comprising or consisting of the sequence of SEQ ID NO: 178, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • CAR chimeric antigen receptor
  • the invention provides a chimeric antigen receptor (CAR) comprising or consisting of the sequence of SEQ ID NO: 179, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • CAR chimeric antigen receptor
  • the invention provides a chimeric antigen receptor (CAR) comprising or consisting of the sequence of SEQ ID NO: 180, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • CAR chimeric antigen receptor
  • the CAR may comprise a transmembrane domain.
  • the transmembrane domain may comprise the transmembrane sequence from any protein which has a transmembrane domain, including any of the type I, type II or type III transmembrane proteins.
  • the transmembrane domain of the CAR may also comprise an artificial hydrophobic sequence.
  • the transmembrane domains of the CAR may be selected so as not to dimerise.
  • transmembrane (TM) regions used in CAR constructs are: a) the CD28 TM region (Pule et al., Mol Ther, 2005, Nov;12(5):933-41 ; Brentjens et al., CCR, 2007, Sep 15;13(18 Pt 1):5426-35; Casucci et al., Blood, 2013, Nov 14;122(20):3461-72.); b) the 0X40 TM region (Pule et al., Mol Ther, 2005, Nov;12(5):933-41); c) the 4-1 BB TM region (Brentjens et al, CCR, 2007, Sep 15;13 (18 Pt 1):5426-35); d) the CD3-zeta TM region (Pule et al., Mol Ther, 2005, Nov;12(5):933-41 ; Di Stasi et al.
  • An example amino acid sequence of a CD8a transmembrane domain is:
  • An example amino acid sequence of a CD28 transmembrane domain is:
  • the transmembrane domain comprises or consists of the sequence of SEQ ID NO: 127 or 128, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • the CAR may comprise a signal peptide such that when the CAR is expressed in a cell the protein is directed to the endoplasmic reticulum and subsequently to the cell surface.
  • Signal peptides may be recognised and cleaved by a signal peptidase during or after translocation to generate a mature protein.
  • the signal peptide is a CD8a signal peptide.
  • the CAR may comprise a spacer that joins the antigen-binding domain to the transmembrane domain.
  • the spacer sequence may, for example, comprise an lgG1 Fc region, an lgG1 hinge or a human or mouse CD8 stalk.
  • the CAR comprises a CD8a stalk.
  • the intracellular domain may provide for signal-transmission in a CAR.
  • the intracellular signalling domain may comprise one or more immunoreceptor tyrosine-based activation motif (ITAM), which is a conserved sequence of four amino acids repeated twice in the cytoplasmic tails of certain cell-surface proteins of the immune system.
  • ITAM immunoreceptor tyrosine-based activation motif
  • the motif contains a tyrosine separated from a leucine or isoleucine by any two other amino acids (YxxL/l).
  • the tyrosine residues of these motifs may be phosphorylated following interaction of the receptor molecules with their ligands and may form binding sites for other proteins involved in signalling pathways.
  • the intracellular signalling domain may comprise or consist of the CD3-zeta endodomain, which contains three ITAMs.
  • the CD3-zeta endodomain may transmit an activation signal to the T cell after the antigen is bound.
  • the CAR may comprise one or more co-stimulatory domain.
  • 4-1 BB also known as CD137
  • CD28 can be used with CD3-zeta
  • CD28 can be used with CD3- zeta to transmit a proliferative I survival signal.
  • ICOS can be used with CD3- zeta to transmit a proliferative I survival signal.
  • NKG2D, 2B4 also known as CD244
  • DAP12 and/or DAP10 can be used with CD3-zeta to transmit a proliferative I survival signal.
  • the CAR comprises a CD3-zeta signalling domain and lacks any costimulatory domains. In some embodiments, the CAR comprises a CD3-zeta signalling domain and one or more co-stimulatory domain.
  • the CAR comprises one or more co-stimulatory domains selected from the group consisting of a 4-1 BB co-stimulatory domain, a CD28 co-stimulatory domain and an 0X40 co-stimulatory domain.
  • the CAR comprises a 4-1 BB co-stimulatory domain. In some embodiments, the CAR comprises a CD28 co-stimulatory domain. In some embodiments, the CAR comprises a 0X40 co-stimulatory domain.
  • the CAR comprises a 4-1 BB co-stimulatory domain and a CD3- zeta signalling domain.
  • An example amino acid sequence of a CD3-zeta signalling domain is: RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNE LQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
  • the signalling domain comprises or consists of the sequence of SEQ ID NO: 129, or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • An example amino acid sequence of a 4-1 BB co-stimulatory domain is:
  • An example amino acid sequence of a CD28 co-stimulatory domain is:
  • the co-stimulatory domain comprises or consists of the sequence of SEQ ID NO: 130 or 171 , or a variant thereof having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, preferably at least 90%, sequence identity thereto.
  • Polynucleotides of the invention may comprise DNA or RNA, preferably DNA. They may be single-stranded or double-stranded. Preferably the polynucleotides are isolated polynucleotides. It will be understood by a skilled person that numerous different polynucleotides can encode the same polypeptide as a result of the degeneracy of the genetic code. In addition, it is to be understood that skilled persons may, using routine techniques, make nucleotide substitutions that do not affect the polypeptide sequence encoded by the polynucleotides of the invention to reflect the codon usage of any particular host organism in which the polypeptides of the invention are to be expressed.
  • polynucleotides may be modified by any method available in the art. Such modifications may be carried out in order to enhance the in vivo activity or lifespan of the polynucleotides of the invention.
  • Polynucleotides such as DNA polynucleotides may be produced recombinantly, synthetically or by any means available to those of skill in the art. They may also be cloned by standard techniques.
  • Longer polynucleotides will generally be produced using recombinant means, for example using polymerase chain reaction (PCR) cloning techniques. This will involve making a pair of primers (e.g. of about 15 to 30 nucleotides) flanking the target sequence which it is desired to clone, bringing the primers into contact with mRNA or cDNA obtained from an animal or human cell, performing a PCR under conditions which bring about amplification of the desired region, isolating the amplified fragment (e.g. by purifying the reaction mixture with an agarose gel) and recovering the amplified DNA.
  • the primers may be designed to contain suitable restriction enzyme recognition sites so that the amplified DNA can be cloned into a suitable vector.
  • the polynucleotide may comprise a promoter and/or enhancer operably linked to the one or more nucleotide sequence encoding the antigen-binding domain, antibody or CAR of the invention.
  • operably linked may mean that two components are linked together in a manner, which enables both to carry out their function substantially unhindered.
  • the promoter and/or enhancer may facilitate and/or enhance expression of the antigen-binding domain, antibody or CAR.
  • the promoter is a EF1a promoter.
  • the polynucleotide is a vector.
  • the vector is a viral vector, such as a retroviral vector, lentiviral vector, adeno- associated viral (AAV) vector or adenoviral vector.
  • the polynucleotide is a viral genome.
  • the invention provides a viral vector comprising the polynucleotide of the invention.
  • the viral vector is in the form of a viral vector particle.
  • a vector is a tool that allows or facilitates the transfer of an entity from one environment to another.
  • some vectors used in recombinant nucleic acid techniques allow entities, such as a segment of nucleic acid (e.g. a heterologous DNA segment, such as a heterologous cDNA segment), to be transferred into a target cell.
  • the vector may serve the purpose of maintaining the heterologous nucleic acid (DNA or RNA) within the cell, facilitating the replication of the vector comprising a segment of nucleic acid and/or facilitating the expression of the protein encoded by a segment of nucleic acid.
  • Vectors comprising polynucleotides used in the invention may be introduced into cells using a variety of techniques known in the art, such as transfection, transduction and transformation.
  • Transfection may refer to a general process of incorporating a nucleic acid into a cell and includes a process using a non-viral vector to deliver a polynucleotide to a cell.
  • Transduction may refer to a process of incorporating a nucleic acid into a cell using a viral vector.
  • a retroviral vector may be derived from or may be derivable from any suitable retrovirus.
  • retroviruses include murine leukaemia virus (MLV), human T-cell leukaemia virus (HTLV), mouse mammary tumour virus (MMTV), Rous sarcoma virus (RSV), Fujinami sarcoma virus (FuSV), Moloney murine leukaemia virus (Mo-MLV), FBR murine osteosarcoma virus (FBR MSV), Moloney murine sarcoma virus (Mo-MSV), Abelson murine leukaemia virus (A-MLV), avian myelocytomatosis virus-29 (MC29) and avian erythroblastosis virus (AEV).
  • a detailed list of retroviruses may be found in Coffin, J.M. et al. (1997) Retroviruses, Cold Spring Harbour Laboratory Press, 758- 63.
  • Retroviruses may be broadly divided into two categories, “simple” and “complex”. Retroviruses may be even further divided into seven groups. Five of these groups represent retroviruses with oncogenic potential. The remaining two groups are the lentiviruses and the spumaviruses.
  • retrovirus and lentivirus genomes share many common features such as a 5’ LTR and a 3’ LTR. Between or within these are located a packaging signal to enable the genome to be packaged, a primer-binding site, integration sites to enable integration into a host cell genome, and gag, pol and env genes encoding the packaging components - these are polypeptides required for the assembly of viral particles. Lentiviruses have additional features, such as rev and RRE sequences in HIV, which enable the efficient export of RNA transcripts of the integrated provirus from the nucleus to the cytoplasm of an infected target cell.
  • LTRs long terminal repeats
  • the LTRs are responsible for proviral integration and transcription. LTRs also serve as enhancer-promoter sequences and can control the expression of the viral genes.
  • the LTRs themselves are identical sequences that can be divided into three elements: U3, R and U5.
  • U3 is derived from the sequence unique to the 3’ end of the RNA.
  • R is derived from a sequence repeated at both ends of the RNA.
  • U5 is derived from the sequence unique to the 5’ end of the RNA. The sizes of the three elements can vary considerably among different retroviruses.
  • gag, pol and env may be absent or not functional.
  • At least part of one or more protein coding regions essential for replication may be removed from the virus. This makes the viral vector replication-defective.
  • Lentivirus vectors are part of the larger group of retroviral vectors. A detailed list of lentiviruses may be found in Coffin, J.M. etal. (1997) Retroviruses, Cold Spring Harbour Laboratory Press, 758-63. In brief, lentiviruses can be divided into primate and non-primate groups. Examples of primate lentiviruses include but are not limited to human immunodeficiency virus (HIV), the causative agent of human acquired immunodeficiency syndrome (AIDS); and simian immunodeficiency virus (SIV).
  • HIV human immunodeficiency virus
  • AIDS the causative agent of human acquired immunodeficiency syndrome
  • SIV simian immunodeficiency virus
  • non-primate lentiviruses examples include the prototype “slow virus” visna/maedi virus (VMV), as well as the related caprine arthritis-encephalitis virus (CAEV), equine infectious anaemia virus (EIAV), and the more recently described feline immunodeficiency virus (FIV) and bovine immunodeficiency virus (BIV).
  • VMV visna/maedi virus
  • CAEV caprine arthritis-encephalitis virus
  • EIAV equine infectious anaemia virus
  • FIV feline immunodeficiency virus
  • BIV bovine immunodeficiency virus
  • the lentivirus family differs from retroviruses in that lentiviruses have the capability to infect both dividing and non-dividing cells (Lewis, P et al. (1992) EMBO J. 11 : 3053-8; Lewis, P.F. et al. (1994) J. Virol. 68: 510-6).
  • retroviruses such as MLV
  • MLV are unable to infect non-dividing or slowly dividing cells such as those that make up, for example, muscle, brain, lung and liver tissue.
  • a lentiviral vector is a vector, which comprises at least one component part derivable from a lentivirus. Preferably, that component part is involved in the biological mechanisms by which the vector infects cells, expresses genes or is replicated.
  • the lentiviral vector may be a “primate” vector.
  • the lentiviral vector may be a “non-primate” vector (i.e. derived from a virus which does not primarily infect primates, especially humans).
  • non-primate lentiviruses may be any member of the family of lentiviridae, which does not naturally infect a primate.
  • HIV-1- and HIV-2-based vectors are described below.
  • the HIV-1 vector contains cis-acting elements that are also found in simple retroviruses. It has been shown that sequences that extend into the gag open reading frame are important for packaging of HIV-1 . Therefore, HIV-1 vectors often contain the relevant portion of gag in which the translational initiation codon has been mutated. In addition, most HIV-1 vectors also contain a portion of the env gene that includes the RRE. Rev binds to RRE, which permits the transport of full-length or singly spliced mRNAs from the nucleus to the cytoplasm. In the absence of Rev and/or RRE, full-length HIV-1 RNAs accumulate in the nucleus. Alternatively, a constitutive transport element from certain simple retroviruses such as Mason-Pfizer monkey virus can be used to relieve the requirement for Rev and RRE. Efficient transcription from the HIV-1 LTR promoter requires the viral protein Tat.
  • HIV-2-based vectors are structurally very similar to HIV-1 vectors. Similar to HIV-1-based vectors, HIV-2 vectors also require RRE for efficient transport of the full-length or singly spliced viral RNAs.
  • the viral vector used in the present invention has a minimal viral genome.
  • minimal viral genome it is to be understood that the viral vector has been manipulated so as to remove the non-essential elements and to retain the essential elements in order to provide the required functionality to infect, transduce and deliver a nucleotide sequence of interest to a target host cell. Further details of this strategy can be found in WO 1998/017815.
  • the plasmid vector used to produce the viral genome within a host cell/packaging cell will have sufficient lentiviral genetic information to allow packaging of an RNA genome, in the presence of packaging components, into a viral particle which is capable of infecting a target cell, but is incapable of independent replication to produce infectious viral particles within the final target cell.
  • the vector lacks a functional gag-pol and/or env gene and/or other genes essential for replication.
  • the plasmid vector used to produce the viral genome within a host cell/packaging cell will also include transcriptional regulatory control sequences operably linked to the lentiviral genome to direct transcription of the genome in a host cell/packaging cell.
  • transcriptional regulatory control sequences may be the natural sequences associated with the transcribed viral sequence (i.e. the 5’ U3 region), or they may be a heterologous promoter, such as another viral promoter (e.g. the CMV promoter).
  • the vectors may be self-inactivating (SIN) vectors in which the viral enhancer and promoter sequences have been deleted.
  • SIN vectors can be generated and transduce non-dividing cells in vivo with an efficacy similar to that of wild-type vectors.
  • the transcriptional inactivation of the long terminal repeat (LTR) in the SIN provirus should prevent mobilisation by replication- competent virus. This should also enable the regulated expression of genes from internal promoters by eliminating any cis-acting effects of the LTR.
  • LTR long terminal repeat
  • the vectors may be integration-defective.
  • Integration defective lentiviral vectors can be produced, for example, either by packaging the vector with catalytically inactive integrase (such as an HIV integrase bearing the D64V mutation in the catalytic site; Naldini, L. et al. (1996) Science 272: 263-7; Naldini, L. et al. (1996) Proc. Natl. Acad. Sci. USA 93: 11382-8; Leavitt, A.D. et al. (1996) J. Virol. 70: 721-8) or by modifying or deleting essential att sequences from the vector LTR (Nightingale, S.J. et al. (2006) Mol. Ther. 13: 1121-32), or by a combination of the above.
  • catalytically inactive integrase such as an HIV integrase bearing the D64V mutation in the catalytic site
  • the invention provides a cell comprising the polynucleotide, the vector, the antigen-binding domain or the CAR of the invention.
  • the cell is a T cell, lymphocyte or stem cell, such as a hematopoietic stem cell, cord blood stem cell (CB) or induced pluripotent stem cell (iPSC).
  • stem cell such as a hematopoietic stem cell, cord blood stem cell (CB) or induced pluripotent stem cell (iPSC).
  • the cell may be selected from the group consisting of CD4 cells, CD8 cells, ThO cells, TcO cells, Th1 cells, Tc1 cells, Th2 cells, Tc2 cells, Th17 cells, Th22 cells, gamma/delta T cells, natural killer (NK) cells, natural killer T (NKT) cells, double-negative T cells, naive T cells, memory stem T cells, central memory T cells, effector memory T cells, effector T cells, cytokine-induced killer (CIK) cells, hematopoietic stem cells and induced pluripotent stem cells (iPSC).
  • NK natural killer
  • NKT natural killer T
  • naive T cells memory stem T cells
  • central memory T cells effector memory T cells
  • effector T cells effector T cells
  • CIK cytokine-induced killer
  • iPSC induced pluripotent stem cells
  • the cell is a T cell or NK cell, preferably a T cell.
  • the T cell is an autologous or allogeneic T cell.
  • the cell may have been isolated from a subject.
  • the cell of the invention may be provided for use in adoptive cell transfer.
  • adoptive cell transfer refers to the administration of a cell population to a patient.
  • the cells are T cells isolated from a subject and then genetically modified and cultured in vitro before being administered to the patient.
  • Adoptive cell transfer may be allogenic or autologous.
  • autologous cell transfer it is to be understood that the starting population of cells (which are then transduced with a polynucleotide or vector according to the invention) is obtained from the same subject as that to which the transduced cell population is administered. Autologous transfer is advantageous as it avoids problems associated with immunological incompatibility and is available to subjects irrespective of the availability of a genetically matched donor.
  • allogeneic cell transfer it is to be understood that the starting population of cells (which are then transduced with a polynucleotide or vector according to the invention) is obtained from a different subject as that to which the transduced cell population is administered.
  • the donor will be genetically matched to the subject to which the cells are administered to minimise the risk of immunological incompatibility.
  • the donor may be mismatched and unrelated to the patient.
  • the invention provides the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in therapy.
  • the therapy is treatment of cancer.
  • the cancer is a haematological malignancy.
  • the cancer cells express CD84, for example the haematological malignancy may be a CD84-expressing haematological malignancy.
  • the cancer is selected from the group consisting of chronic lymphocytic leukaemia (CLL), B-cell lymphoma, diffuse large B-cell lymphoma (DLBCL), Burkitt’s lymphoma, follicular lymphoma, mantle cell lymphoma, B-cell acute lymphoblastic leukaemia (B-ALL), acute myeloid leukaemia (AML), myelodysplastic syndrome, T-cell acute lymphoblastic leukaemia/lymphoma (T-ALL), chronic myeloproliferative syndrome, chronic myeloid leukaemia (CML), chronic myelomonocytic leukaemia, dendritic-cell neoplasm and histiocytic sarcoma.
  • CLL chronic lymphocytic leukaemia
  • B-ALL B-cell acute lymphoblastic leukaemia
  • AML acute myeloid leukaemia
  • T-ALL T-cell acute lymphoblastic leuka
  • the cancer is selected from the group consisting of chronic lymphocytic leukaemia (CLL), diffuse large B-cell lymphoma (DLBCL), Burkitt’s lymphoma, follicular lymphoma, mantle cell lymphoma, B-cell acute lymphoblastic leukaemia (B-ALL), T-cell acute lymphoblastic leukaemia/lymphoma (T-ALL), acute myeloid leukemia (AML) and histiocytic sarcoma.
  • CLL chronic lymphocytic leukaemia
  • DLBCL diffuse large B-cell lymphoma
  • Burkitt’s lymphoma follicular lymphoma
  • mantle cell lymphoma mantle cell lymphoma
  • B-ALL B-cell acute lymphoblastic leukaemia
  • T-ALL T-cell acute lymphoblastic leukaemia/lymphoma
  • AML acute myeloid leukemia
  • the cancer is selected from the group consisting of B-cell lymphoma, B-ALL, T-ALL and AML.
  • the invention provides the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in treating AML.
  • the invention provides the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in treating T-ALL.
  • the invention provides the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in treating B-cell lymphoma.
  • the invention provides the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention for use in treating Burkitt’s lymphoma.
  • the cancer is not a T-cell lymphoma. In some embodiments, the cancer is not a mature T-cell lymphoma. In some embodiments, the cancer is not CLL. In some embodiments, the cancer is not a solid tumour.
  • agents for use in the invention can be administered alone, they will generally be administered in admixture with a pharmaceutical carrier, excipient or diluent, particularly for human therapy.
  • the medicaments for example cells or vector particles, of the invention may be formulated into pharmaceutical compositions.
  • These compositions may comprise, in addition to the medicament, a pharmaceutically acceptable carrier, diluent, excipient, buffer, stabiliser or other materials well known in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
  • a pharmaceutically acceptable carrier diluent, excipient, buffer, stabiliser or other materials well known in the art.
  • Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
  • the precise nature of the carrier or other material may be determined by the skilled person according to the route of administration, e.g. intravenous or intra-arterial.
  • the pharmaceutical composition is typically in liquid form.
  • Liquid pharmaceutical compositions generally include a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, magnesium chloride, dextrose or other saccharide solution, or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included. In some cases, a surfactant, such as pluronic acid (PF68) 0.001 % may be used. In some cases, serum albumin may be used in the composition.
  • PF68 pluronic acid
  • serum albumin may be used in the composition.
  • the active ingredient may be in the form of an aqueous solution, which is pyrogen-free, and has suitable pH, isotonicity and stability.
  • aqueous solution which is pyrogen-free, and has suitable pH, isotonicity and stability.
  • isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection or Lactated Ringer's Injection.
  • Preservatives, stabilisers, buffers, antioxidants and/or other additives may be included as required.
  • the medicament may be included in a pharmaceutical composition which is formulated for slow release, such as in microcapsules formed from biocompatible polymers or in liposomal carrier systems according to methods known in the art.
  • Handling of the cell therapy products is preferably performed in compliance with FACT-JACIE International Standards for cellular therapy.
  • the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention is administered to a subject systemically.
  • the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention is administered to a subject locally.
  • systemic delivery or “systemic administration” as used herein means that the agent of the invention is administered into the circulatory system, for example to achieve broad distribution of the agent. In contrast, topical or local administration restricts the delivery of the agent to a localised area.
  • the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention is administered intravascularly, intravenously or intra-arterially.
  • the antigen-binding domain, the antibody, the CAR, the polynucleotide, the vector, the cell or the pharmaceutical composition of the invention is administered intravenously.
  • an appropriate dose of an agent of the invention to administer to a subject can readily determine an appropriate dose of an agent of the invention to administer to a subject.
  • a physician will determine the actual dosage which will be most suitable for an individual patient and it will depend on a variety of factors including the activity of the specific compound employed, the metabolic stability and length of action of that compound, the age, body weight, general health, sex, diet, mode and time of administration, rate of excretion, drug combination, the severity of the particular condition, and the individual undergoing therapy. There can of course be individual instances where higher or lower dosage ranges are merited, and such are within the scope of the invention.
  • subject refers to either a human or non-human animal.
  • non-human animals include vertebrates, for example mammals, such as non- human primates (particularly higher primates), dogs, rodents (e.g. mice, rats or guinea pigs), pigs and cats.
  • the non-human animal may be a companion animal.
  • the subject is human.
  • the invention also encompasses variants, derivatives, analogues, homologues and fragments thereof.
  • a “variant” of any given sequence is a sequence in which the specific sequence of residues (whether amino acid or nucleic acid residues) has been modified in such a manner that the polypeptide or polynucleotide in question retains at least one of its endogenous functions.
  • a variant sequence can be obtained by addition, deletion, substitution, modification, replacement and/or variation of at least one residue present in the naturally occurring polypeptide or polynucleotide.
  • derivative as used herein in relation to proteins or polypeptides of the invention includes any substitution of, variation of, modification of, replacement of, deletion of and/or addition of one (or more) amino acid residues from or to the sequence, providing that the resultant protein or polypeptide retains at least one of its endogenous functions.
  • analogue as used herein in relation to polypeptides or polynucleotides includes any mimetic, that is, a chemical compound that possesses at least one of the endogenous functions of the polypeptides or polynucleotides, which it mimics.
  • amino acid substitutions may be made, for example from 1 , 2 or 3, to 10 or 20 substitutions, provided that the modified sequence retains the required activity or ability.
  • Amino acid substitutions may include the use of non-naturally occurring analogues.
  • Proteins used in the invention may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent protein.
  • Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity and/or the amphipathic nature of the residues as long as the endogenous function is retained.
  • negatively charged amino acids include aspartic acid and glutamic acid
  • positively charged amino acids include lysine and arginine
  • amino acids with uncharged polar head groups having similar hydrophilicity values include asparagine, glutamine, serine, threonine and tyrosine.
  • homologue as used herein means an entity having a certain homology with the wild type amino acid sequence or the wild type nucleotide sequence.
  • the term “homology” can be equated with “identity”.
  • a homologous sequence is taken to include an amino acid sequence which may be at least 50%, 55%, 65%, 75%, 85% or 90% identical, preferably at least 95%, 96% or 97% or 98% or 99% identical to the subject sequence.
  • the homologues will comprise the same active sites etc. as the subject amino acid sequence.
  • homology can also be considered in terms of similarity (i.e. amino acid residues having similar chemical properties/functions), in the context of the present invention it is preferred to express homology in terms of sequence identity.
  • a homologous sequence is taken to include a nucleotide sequence which may be at least 50%, 55%, 65%, 75%, 85% or 90% identical, preferably at least 95%, 96% or 97% or 98% or 99% identical to the subject sequence.
  • homology can also be considered in terms of similarity, in the context of the present invention it is preferred to express homology in terms of sequence identity.
  • reference to a sequence which has a percent identity to any one of the SEQ ID NOs detailed herein refers to a sequence which has the stated percent identity over the entire length of the SEQ ID NO referred to.
  • Homology comparisons can be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs can calculate percent homology or identity between two or more sequences.
  • Percent homology may be calculated over contiguous sequences, i.e. one sequence is aligned with the other sequence and each amino acid or nucleotide in one sequence is directly compared with the corresponding amino acid or nucleotide in the other sequence, one residue at a time. This is called an “ungapped” alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues.
  • the alignment process itself is typically not based on an all-or-nothing pair comparison. Instead, a scaled similarity score matrix is generally used that assigns scores to each pairwise comparison based on chemical similarity or evolutionary distance.
  • a scaled similarity score matrix is generally used that assigns scores to each pairwise comparison based on chemical similarity or evolutionary distance.
  • An example of such a matrix commonly used is the BLOSUM62 matrix (the default matrix for the BLAST suite of programs).
  • GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table if supplied (see the user manual for further details). For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62.
  • the software Once the software has produced an optimal alignment, it is possible to calculate percent homology, preferably percent sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result.
  • “Fragments” are also variants and the term typically refers to a selected region of the polypeptide or polynucleotide that is of interest either functionally or, for example, in an assay. “Fragment” thus refers to an amino acid or nucleic acid sequence that is a portion of a full- length polypeptide or polynucleotide. Such variants may be prepared using standard recombinant DNA techniques such as site- directed mutagenesis. Where insertions are to be made, synthetic DNA encoding the insertion together with 5’ and 3’ flanking regions corresponding to the naturally-occurring sequence either side of the insertion site may be made.
  • flanking regions will contain convenient restriction sites corresponding to sites in the naturally-occurring sequence so that the sequence may be cut with the appropriate enzyme(s) and the synthetic DNA ligated into the cut.
  • the DNA is then expressed in accordance with the invention to make the encoded protein.
  • the polynucleotides used in the invention may be codon-optimised. Codon optimisation has previously been described in WO 1999/41397 and WO 2001/79518. Different cells differ in their usage of particular codons. This codon bias corresponds to a bias in the relative abundance of particular tRNAs in the cell type. By altering the codons in the sequence so that they are tailored to match with the relative abundance of corresponding tRNAs, it is possible to increase expression. By the same token, it is possible to decrease expression by deliberately choosing codons for which the corresponding tRNAs are known to be rare in the particular cell type. Thus, an additional degree of translational control is available. Codon usage tables are known in the art for mammalian cells, as well as for a variety of other organisms.
  • GEPIA an interactive web server for analysing the RNA sequencing expression data of 9,736 tumours and 8,587 normal samples from the TCGA and the GTEx projects (http://aepia.cancer-pku.cn/index.html: Tang et al.
  • GEPIA a web server for cancer and normal gene expression profiling and interactive analyses. Nucleic Acids Res. 2017; 10.1093/nar/gkx247) we have found that:
  • CD84 expression is 4.2 times higher in 47 Lymphoid Neoplasm Diffuse Large B-cell Lymphoma (in Figure 1 presented as DLBC) than in 337 blood samples.
  • CD84 expression is 10.1 times higher in 173 Acute Myeloid Leukaemia (in Figure 1 presented as LAML) than in 70 bone marrow samples.
  • CCLE Cancer Cell Line Encyclopaedia
  • RNAseq and Affymetrix analysis of mRNA expression showed that CD84 is expressed at high levels in cell lines derived from Burkitt’s lymphoma, acute myeloid leukaemia (AML), B-cell lymphomas, chronic myeloid leukaemia (CML), B-cell acute lymphoblastic leukaemia (B-ALL) and T-cell acute lymphoblastic leukaemia (T-ALL), but not in T-cell lymphomas or solid tumours ( Figure 2).
  • Table 1 shows the cell lines that were used, the haematological malignancy from which they originate and a qualitative assessment of CD84 expression based on the cytometry analysis shown in Figure 3.
  • Table 1 List of cells lines derived from haematological malignancies used to assess surface CD84 expression and qualitative assessment of CD84 expression (the acute myeloblastic leukaemia cell line in the experiments herein described as MOLM-13 was previously indicated to be the acute myeloblastic leukaemia cell line Kasumi-1 ; references to Kasumi-1 have been updated accordingly).
  • Table 2 shows a qualitative assessment of CD84 expression based on the cytometry analysis shown in Figure 4.
  • the expression of CD84 on the leukemic cells was compared to the expression of CD84 in lymphocytes (CD84 moderate ) and monocytes (CD84 high ).
  • the histogram in light grey represents the staining with an isotype-matched control antibody and the histogram in dark grey the staining with the specific CD84 antibody.
  • Table 3 summarizes the features of these antibodies, characterized as described in Methods. Binding to 300.19-CD84 + , Raji and Ramos cells, lymphocytes and monocytes was carried out using hybridoma supernatants with equal amounts/concentration of anti-CD84 antibody. Table 4. Summary of features of anti-CD84 mouse monoclonal antibodies.
  • the sequence corresponding to the variable region from the light chain (VL) and the sequence corresponding to the variable region from the heavy chain (VH) were determined from the different hybridomas using the Mouse Ig-Primer Set (Novagen). Sanger sequencing of this region was carried out by AbsoluteAntibody (United Kingdom).
  • the antibody-sequence analysis was performed as follows: the complementarity-determining regions (CDR) and framework regions (FR) were identified using Abysis (s were defined by the Kabat- numbered scheme), IMGT and IgBLAST databases.
  • Table 5 shows the VH and VL sequence of these antibodies. The three CDRs in each sequence are highlighted in bold and underlined.
  • Phage display screening was used to identify novel human scFvs that bind to CD84.
  • Three different scFvs were identified (R3-B3, R3-G7 and R3-H3); the sequence of the CDR and FR in the variable domains of the heavy (VH) and light (VL) chains is shown in Table 6.
  • CAR84 We engineered several anti-CD84 CAR constructs (CAR84).
  • the complete CAR84 sequence was cloned into the third-generation lentiviral vector pCCL (Dull et al. A Third-Generation Lentivirus Vector with a Conditional Packaging System. J. Virol. 1998:72:8463-8471), including the signal peptide, the scFv specific for CD84, the CD8a hinge and transmembrane regions, the co-stimulatory domain 4-1 BB and the signalling domain CD3-zeta, under the control of an EF1a promoter ( Figure 6).
  • Lentiviruses containing the different versions of the pCCL-EF1a-CD84 vectors were produced in HEK293-T cells and the number of transducing units was determined by the limiting dilution method. The lentiviruses were then used to transduce T cells isolated from whole blood. These CAR-T cells were then expanded for 6 to 8 days.
  • Tables 9-11 summarize the number of T cells obtained after three different transductions for the different CARTs, as well as the percentage of these T cells that expressed the CD84 CAR on their surface.
  • Table 9 Number and percentage of CAR-positive T cells obtained following three independent transductions with lentivirus expressing CD84 CARs based on the 152-1 D5 antibody.
  • Table 10 Number and percentage of CAR-positive T cells obtained following three independent transductions with lentivirus expressing CD84 CARs based on the 153-4D9 antibody.
  • Table 11 Number and percentage of CAR-positive T cells obtained following three independent transductions with lentivirus expressing CD84 CARs based on the R3-B3, R3- G7 and R3-H3 scFvs.
  • CAR LVs did not lead to an efficient expansion of CAR-positive T cells: 152.1 , 153.1 , 153.2, B3.4 and B3.5.
  • the 152.1 and 153.1 CARs were not used in further experiments.
  • the supernatant of the effectortarget cell co-cultures were collected.
  • the CD84 high cell line Ramos was used as the target cell at a 2:1 effectortarget cell ratio.
  • the levels of IFN-y ( Figure 7), IL-2 ( Figure 8), granzyme- B ( Figure 9) and TNF-a (FigurelO) in the supernatants was determined by enzyme linked immunosorbent assays (ELISA) after 24 hours of co-culture. Untransduced T cells (UT) were used as negative control (in co-culture with the target cells). Four different independent experiments were performed.
  • CART cells with the R3-B3 scFv CAR binding domain lack cytokine release activity and therefore were not used in subsequent experiments.
  • CART cells with the R3-H3 scFv CAR binding domain released a high amount of cytokines, with these two CART cells (H3.4 and H3.5) being the ones with the largest proinflammatory profile (based on TNF-a secretion), followed by CART cells with the 152-1 D5 antibody CAR binding domain, which also show a high cytokine release profile.
  • the 152-1 D5 CART cells showed a similar profile independently of the scFv design (VH-VL order and linker length).
  • CART cells based on the 153-4D9 and R3-G7 antibodies have a similar profile, with lower cytokine release in comparison to R3-H3 and 152-1 D5 CART cells, except for 153.3 CART cells, which barely secrete cytokines.
  • CART84 cells To evaluate the efficacy of the CART84 cells in vitro, we performed cytotoxicity assays of each CART cell against several GFP-expressing target cell lines with different levels of CD84 expression and from both lymphoid (Ramos, NALM6 and MOLT-4 cell lines) and myeloid origin (K562 and MOLM-13 cell lines). CART cytotoxicity was assessed after a 24-hour coculture by determining the percentage of live GFP-positive cells by cytometry. Effectortarget cell ratios of 4:1 , 2:1. 1 :1 and 0.5:1 were tested.
  • the selected CARs displayed a statistically significant cytotoxic activity against Ramos cells for each of the effectortarget ratios in comparison with UT cells ( Figure 13).
  • the same pattern shown in Figure 12 was observed, with CARs based on the 152-1 D5 and 153-4D9 antibodies showing a statistically significant cytotoxic activity in comparison with UT cells ( Figure 14).
  • CARs based on 152.1 D5 and 153.4D9 antibodies showed a higher cytotoxic activity against NALM-6 cell line than CARs based on R3-G7 and R3-H3 scFv ( Figure 16).
  • the CAR based on the 152-1 D5 antibody showed the highest statistically significant cytotoxic activity, compared to UT cells, followed by CARs based on 153-4D9 and R3-G7 antibodies ( Figure 17).
  • EXAMPLE 6 CD84 expression in peripheral blood mononuclear cells (PBMC)
  • mice were immunized three to four times, at 3-week intervals, with 300.19 cells stably transfected with the CD84 full-length DNA (de la Fuente MA et al. CD84 leukocyte antigen is a new member of the Ig superfamily. Blood. 1997; 15;90(6):2398-405).
  • the first intraperitoneal (i.p.) injection consisted of 20x10 6 cells in 300 pl PBS, the second consisted of 20x10 6 cells in 300 pl of PBS and the final injection consisted of 30x10 6 cells in 300 pl in PBS.
  • Mice were euthanized on the third day after the final boost and the splenocytes were harvested to perform the cell fusion.
  • NS1 myeloma cells European Collection of Cell Cultures, Salisbury, UK
  • spleen cells were fused with spleen cells by incubating them at a ratio of 4:1 (splenocytes: NS1) at 37°C, centrifuging for 10 minutes at RT and adding 1 mL of warm PEG solution to the cell pellet while constantly swirling.
  • Cells were slowly resuspended in RPMI culture medium, centrifuged and incubated at 37°C in 5% CO2 in a humidified incubator.
  • Screening was carried out 10 days after fusion by analysing 50pl of hybridoma supernatant by flow cytometry with 300.19-CD84 cells, using untransfected 300.19 cells as a negative control. Hybridomas that tested positive to 300.19-CD84 and negative to 300.19 cells were transferred to 24-well plates, grown until confluent and then transferred to T75 flasks. Single hybridoma clones producing antibodies of interest were then isolated by limited dilution. For each hybridoma, 10 single clones were retested by flow cytometry with 300.19-CD84 cells. The cloning protocol was repeated with one of the positive clones.
  • isotype class and subclass
  • isotype was determined by ELISA using anti-IgG coated plates to which the antibodies were added and then incubating the plates with an antimouse HRP antibody.
  • flow cytometry analysis was carried out with COS cells expressing a chimeric CD84 extracellular domain in which the domain 1 (D1) and 2 (D2) sequence is either human or murine.
  • Human CD84 produced by mammalian cells was used as an antigen to carry out panning of a human naive phage display LiAb SFMax library (Proteogenix, France) with high diversity of 5.37x10 10 scFv variants.
  • tubes were coated with antigen, blocked, washed and incubated with the phage library. After washing, elution of phage binders was done with Glycine HCI followed by neutralization.
  • Phages from round 3 were selected for monoclonal ELISA analysis. Single E. coli G'l clones were picked and cultured with helper phage. Following centrifugation, supernatants containing phages were collected. Plates were coated with either antigen or buffer, washed, blocked and washed again. Phages were then added to plates and incubated. Plates were washed and then an anti-phage horseradish peroxidase (HRP) antibody was added, followed by washing and incubation of TMB followed by HCI. Plates were read at 450 nm.
  • HRP horseradish peroxidase
  • Ramos, Raji, NALM6, K562, MOLM-13, Kasumi-6, THP-1 , and U937 were purchased from the American Type Culture Collection (ATCC).
  • Ramos, Raji, NALM6, K562, NS1 and THP-1 cell lines were cultured in RPMI medium (ThermoFisher) supplemented with 10% foetal bovine serum (FBS, Merck) and penicillin-streptomycin (Labclinics), 300.19 cells were supplemented also with 1 % L-glutamine (Gibco) and 0.1 % 2-Beta-Mercaptoethanol (Sigma).
  • the HEK293T and the COS cell line was cultured in DM EM medium (Gibco) supplemented with 10% FBS (Merck) and penicillin-streptomycin (Labclinics) and with 1% L-glutamine (Gibco). All cell lines were grown at 37°C and 5% CO2.
  • HEK293-T cells were transfected with our transfer vector pCCL-EF1a-CD84 together with the packaging plasmids pRSV-Rev (Addgene, 12253), pMDLg/Prre (Addgene, 12251), and envelope plasmid pCMV-VSV-G (Addgene, 12259) using linear polyethylenimine (PEI, molecular weight 25000, Polysciences Inc 23966-1). Lentiviral supernatant was collected 48 hours later and concentrated with LentiX-Concentrator (Clontech, Takara) following the manufacturer’s protocol. Concentrated lentivirus was stored at -80°C until use. Lentivirus titration
  • the number of transducing units was determined by the limiting dilution method.
  • HEK293T cells were seeded 24 h before transduction and 1 :10 dilutions of the viral supernatant were prepared and added in DMEM medium (Gibco) supplemented with polybrene (Sigma-Aldrich) at 8 mg/mL. Cells were trypsinyzed 48 h later and labelled with AffiniPure F(ab’)2 fragment goat anti-mouse immunoglobulin G (IgG) allophycocyanin (APC)- conjugated (Jacksonlmmuno Research Laboratories, 115-136-072). A dilution corresponding to 2%-20% of positive cells was used to calculate viral titer.
  • T cells were isolated from whole blood during density gradient centrifugation with Ficoll- PaqueTM by RosetteSepTM (RosetteSep Human T cell Enrichment cocktail from StemCell). T cells were cultured in X-Vivo 15 Serum Free Cell Medium (Lonza) supplemented with 5% AB human serum (Sigma H4522), penicillin-streptomycin (ThermoFisher, 100 mg/mL), and IL-2 at 50 IIJ/mL (Miltenyi). Cells were then activated using beads conjugated with CD3 and CD28 mAbs (Dynabeads Human T-Activator CD3/CD28 Gibco, 11131 D). Twenty-four hours later they were transduced with the lentivirus in the presence of polybrene (Sigma-Aldrich) at 8 ug/mL. An expansion of 6 to 8 days was required before conducting the experiments.
  • CAR84 was detected with a recombinant CD84-His protein (R&D, 1855-CD) and a secondary His Tag APC-conjugated antibody (R&D, IC050A) and with a biotinSP-conjugated AffiniPure F(ab’)2-fragment goat-anti-mouse IgG (Jackson ImmunoResearch Laboratories, 115-065- 072) or with a biotin SP-conjugated AffiniPure F(ab’)2-fragment goat-anti-human IgG (Jackson ImmunoResearch Laboratories, 109-065-006) with a BV421 -conjugated streptavidin (BD Horizon, 563259).
  • CD3-APC CD4- PE-Cy7, CD4-Alexa Fluor-488, CD19-PE, CD8-APC-H7, PD-1- PE-Cy7, TIM-3- BB515, CD69-PerCP-CyTM5.5, LAG-3-BV-605, CD62L-FITC, CCR7-PerCP-CyTM5.5, CD84-PE, CD4- PE-CyTM7, CD45RA-APC (Becton Dickinson), CD84-APC and CD84-PE (BioLegend).
  • cytotoxicity of CART cells was assessed using different effectortarget ratios and at different time-points.
  • Target cells used in these assays were modified with a lentiviral vector to over-express GFP-firefly luciferase (GFP-ffLuc) as previously described (Shah et al. Antigen Presenting Cell-Mediated Expansion of Human Umbilical Cord Blood Yields Log- Scale Expansion of Natural Killer Cells with Anti-Myeloma Activity. PLoS One. 2013; 8(10)).
  • % of live cell 100 x (number of GFP + cells with T cells at time x I number of GFP + cells alone at time x).
  • IFN-y, TNF-a, IL-6, IL-1 cytokines were quantified by Enzyme-Linked ImmunoSorbent Assay (DuoSet ELISA, R&D systems) following manufacturer’s protocol.
  • Lentiviruses (LV) containing the CART84 1.7.3, 1.226.5 and 3.89.5 pCCL-EF1a-CD84 vectors were produced in HEK293-T cells and the number of transducing units per mL was determined by the limiting dilution method. The lentiviruses were used to transduce T cells isolated from whole blood and these CAR-T cells were then expanded for 6 to 8 days.
  • Table 17 summarizes the number of T cells obtained after three different transductions, as well as the percentage of T cells that expressed the CD84 CAR on their surface.
  • EXAMPLE 12 CD84 CART in vitro cytotoxicity
  • CART84 152.3, 153.5 and H3.5 were selected for additional characterization and compared with 1.7.3 and 1.226.5 and 3.89.5.
  • CD84 expression on these cells is shown in Figure 3.
  • EXAMPLE 13 CD84 CART in vitro cytotoxicity against primary leukemic blasts from AML and T-ALL
  • CART84 cells 152.3, 153.5, G7.5 and H.3.5 were assessed the cytotoxicity of CART84 cells 152.3, 153.5, G7.5 and H.3.5 against primary AML cells from patient samples obtained from the Haematology Department of Hospital Clinic de Barcelona (HCB).
  • CD84 expression was assessed on the primary blasts, which were then stained with CFSE and co-cultured with the effector cells (CART/UT) at effectortarget cell ratios of 4:1 , 2:1 , 1 :1 and 0.5:1 during 24 h and 48 h. After this period, cells were stained with LIVE/DeadTM Fixable Aqua to differentiate live/dead cells.
  • CART cells 152.3 and 153.5 displayed the highest cytotoxic activity towards AML blasts, which was statistically significant in comparison with the effect of UT.
  • CARTs H3.5 and G7.5 exerted a low cytotoxic effect.
  • the cytotoxic effect induced by all CARTs increased over time (Figure 27).
  • EXAMPLE 14 CD84 CART in vitro cytokine production
  • CART84 H3.5 displayed the highest cytokine production of all CART84 tested when cocultured with Ramos.
  • the cytokine profile of CART84 1.7.3 was similar to that of H3.5 after being co-cultured with MOLM-13 and MOLT-4 cells. All other CART cells tested produced similar levels of cytokines.
  • CART84 proliferation assays were performed. Briefly, on day 0 CART cells were stained with CellTraceTM CFSE. Four conditions were tested: Cells (UT or CART cells) at day 0; cells alone cultured with media at day 4; cells stimulated with an unspecific stimulus of IL-2 (50 UI/mL) at day 4; and cells stimulated with the specific antigen at day 4, that is, with MOLM-13 cells, at an effector: target ratio of 0.5:1.
  • IL-2 50 UI/mL
  • EXAMPLE 16 CD84 CART in vitro cytotoxicity against haematopoietic progenitor stem cells
  • CD84 is expressed on malignant cells from several haematological malignancies. Among these is AML, where CD84 expression is shared between myeloid leukemic blasts and, to a lower extent, haematopoietic progenitor stem cells (HPSC). The same occurs CD33 and CD123, both of which are targets for CART products in development for treatment of AML.
  • Figure 33 shows the expression of CD84, CD33 and CD123 on HPSC from an apheresis product.
  • CD34 + HPSC obtained from two different sources: cord blood units (CBU, from BST) and the apheresis product from a healthy donor that had been mobilized with G-CSF for an allogeneic stem cell transplant (also from BST).
  • CD34 + cells from the apheresis product represent the ideal model to study myelotoxicity; however, it is more common to use CD34 + cells from CBU to study this type of on-target/off-tumour toxicity
  • EXAMPLE 17 CD84 CART in vitro T-cell toxicity
  • T cells Since CD84 is expressed on T cells, we studied the potential CART84 toxicity towards them. T cells were isolated directly from donor whole blood; half of them were activated and transduced to generate CART cells, and the other half was cryopreserved until the CART cells were available (i.e., for 6-7 days). T cells were stained with CFSE and then, co-cultured with the CART84. Figure 36 displays the results of 5 independent experiments. CART84 152.3, 153.5, 1.7.3 and 3.89.5 exerted moderate cytotoxic effect against their own T cells. On the other hand, the cytotoxic activity induced by 1.226.5 was low and not statistically significant in comparison with UT.
  • T-cell subsets were analyzed: naive, central-memory, effector-memory, and effector CD4/CD8 T cells.
  • the different T-cell subpopulations were studied by flow cytometry on: 1) target T cells before the assay and 2) on surviving T cells after co-culture with the different CART84 as indicated in Figure 37.
  • the central-memory T cell fraction was most affected by CART84, especially by 152.3, 153.5 and 1.7.3, as expected since CD84 is mostly expressed on memory T cells.
  • all T-cell subsets were still present after co-culture with CART84.
  • EXAMPLE 18 In vivo efficacy of anti-CD84 CARTs in an AML model
  • the efficacy of several CART84 cells was tested in three different experiments in NOD scid gamma (NSG) immunodeficient mice using MOLM-13 AML cells, modified to express GFP- firefly Luciferase (GFPffLuc).
  • NSG NOD scid gamma
  • GFPffLuc GFP- firefly Luciferase
  • mice euthanized at experiment endpoint were collected and analysed by flow cytometry in order to quantify the presence of tumour cells (MOLM-13- GFPffLuc), human CD3 + T cells or CART cells.
  • CART84-treated mice had a significantly lower number of tumour cells in both bone marrow and spleen when compared to UT-treated mice ( Figures 39C and 40C).
  • Human T cells proliferated both bone marrow and spleen of mice treated with UT, most probably due to xeno-graft versus host disease (xeno-GvHD) ( Figures 39D and 40D).
  • CART84 cells were found both bone marrow and spleen, most prominently in the case of CART84 152.3 ( Figures 39E and 40E).
  • 152.3 and 153.5 were able to consistently control AML disease progression and increased survival of treated animals.
  • CART84 cells were tested in two different experiments in NOD scid gamma (NSG) mice using MOLT-4 T-ALL cells modified to express GFP-ffLuc.
  • NSG NOD scid gamma
  • MOLT-4 T-ALL cells modified to express GFP-ffLuc.
  • the following CART84 were tested: 152.3, 153.5, 1.7.3 and 1.226.5.
  • CART84 152.3 and 153.5 were the most efficacious in terms of controlling T-ALL disease and prolonging survival in both T-ALL experiments.
  • EXAMPLE 20 CD84 CART in vitro toxicity towards human primary cells
  • human primary cells were studied for CD84 expression and afterwards, the potential cytotoxic effect induced by CART84.
  • the following human cells were studied: human coronary artery endothelial cells (HCAEC), human small airway epithelial cells (HsaEpC), human cardiac myocytes (HCM), human renal epithelial cells (HREpC) and human uterine fibroblasts (HUF).
  • HCAEC human coronary artery endothelial cells
  • HsaEpC human small airway epithelial cells
  • HCM human cardiac myocytes
  • HREpC human renal epithelial cells
  • HREpC human uterine fibroblasts
  • the positive CAR fraction of T cells was detected with Biotin-SP (long spacer) AffiniPure Goat Anti-Mouse IgG, F(ab') 2 fragment goat-anti-mouse IgG (Jackson ImmunoResearch) or with a biotin SP-conjugated AffiniPure F(ab’)2-fragment goat-anti-human IgG (Jackson ImmunoResearch), washed and then incubated with a BV421/PE-conjugated streptavidin (eBioscience) and with the antibodies required to study each panel of proteins as described below.
  • Biotin-SP long spacer
  • AffiniPure Goat Anti-Mouse IgG F(ab') 2 fragment goat-anti-mouse IgG
  • biotin SP-conjugated AffiniPure F(ab’)2-fragment goat-anti-human IgG Jackson ImmunoResearch
  • CCR7 CD197-BV510
  • CD62L-FITC CD4-Pecy7
  • CD8-APCH7 CD45RA-APC
  • Becton Dickinson The following mAbs against human proteins were used to study CAR T-cell phenotype: CD197-BV510 (CCR7), CD62L-FITC, CD4-Pecy7, CD8-APCH7, CD45RA-APC, (Becton Dickinson).
  • CD11-APC CD19-Fitc, HLA-DR-A450, CD45-PerCPCy5.5, CD34-PerCPCy5.5, CD3-APC, CD3-APCH7, CD33-Fitc, CD14-Fitc, CD14-APCH7, CD13- PE, CD13-BV421 (Becton Dickinson), CD84-APC, CD84-PE (BioLegend), CD45-A750, CD117-PeCy7 (Beckman Coulter), CD123-PECy7 (eBiosciences).
  • CD3-BV421 The following mAbs against human proteins were used to study the different population of mononuclear cells present in peripheral blood: CD3-BV421 , CD14-APCH7, CD19-FITC, CD33-APC, CD34-PerCPCy5.5, CD38-APC, CD84-PE (BioLegend), CD123-PECy7 (eBiosciences) and HLA-DR-BV450 (Becton Dickinson)
  • the following mAbs against proteins were used in the in vivo experiments carried out in the MOLM-13 model: anti-human CD3-APCH7, anti-human CD33-APC, anti-human CD45- PerCP-Cy5.5, anti-mouse CD45-PECy7, Streptavidin-BV421 (Becton Dickinson).
  • the following mAbs against proteins were used in the in vivo experiments carried out in the MOLT- 4 model: anti-human CD3-APC, anti-human CD45-PerCP-Cy5.5, anti-mouse CD45 Pe-Cy7, Streptavidin-BV421 (Becton Dickinson).
  • % of live cell 100 x (number of negative LIVE/Dead-positive CFSE cells with CART cells at time x I number of negative LIVE/Dead- positive CFSE cells alone at time x).
  • Haematopoietic progenitor stem cells were obtained from two sources: cord blood units (CBU, from the blood bank Banc de Sang i Teixits de Barcelona, BST) and from an apheresis product from a healthy donor that had been mobilized with G-CSF for an allogeneic stem cell transplant (also obtained from BST).
  • CBU cord blood units
  • Banc de Sang i Teixits de Barcelona, BST cord blood units
  • apheresis product from a healthy donor that had been mobilized with G-CSF for an allogeneic stem cell transplant (also obtained from BST).
  • CD34 + cells were isolated from CBU by first, Ficoll-Paque density-gradient centrifugation and second, purifying the CD34 + haematopoietic progenitor stem cells by magnetic separation with a human CD34-MicroBead kit (Miltenyi Biotec, positive selection). To isolate CD34 + cells from the apheresis product, cells were directly purified with the CD34-magnetic beads.
  • CD34 + cells were co-cultured with effector cells (CART/ UT) at effectortarget cell ratios 4:1 , 2:1 for 24 h and 48 h. After this period, co-cultured cells were stained with APC-conjugated CD3 and PE-conjugated CD34 antibodies to differentiate effector from target cells and with LIVE/Dead Fixable Aqua to differentiate live/dead cells.
  • T cells were isolated during Ficoll-Paque density-gradient centrifugation from donor buffy coats using an immune-cell isolation reagent from RosetteSepTM. Half of the T cells obtained in the process were activated and transduced to generate CART cells, and the other half was cryopreserved to be used as target cells until the CART cells were available (i.e. for 8 days). To perform the cytotoxicity assay, T cells were thawed and stained with CFSE before being co-cultured with the CART cells at different effectortarget ratios. After 24 hours, both effector and target cells were fixed and stained with LIV/Dead Fixable Aqua cell stain kit.
  • mice Eight- to 12-week-old non obese diabetic-Cg-Prkdcscid H2rgtm1Wjl/SzJ (NSG) mice (Charles River) were bred and housed under pathogen-free conditions in the animal facility of the Faculty of Medicine and Health Sciences of University of Barcelona. Between 0.1 and 1 x 10 6 GFPffLuc-expressing MOLM-13 or GFPffLuc-MOLT-4 cells were resuspended in saline and infused intravenously (IV) into each NSG mouse at day 0. Between 3 and 5 x 10 6 UT or CD84 CARTs were intravenously (i.v.) infused 2 to 9 days after tumour-cells infusion.
  • IV intravenously
  • Tumour progression was monitored by bioluminescence using the Xenogen I VIS 50 Imaging System (PerkinElmer). To measure bioluminescence, 100uL of XenoLight D-Luciferin (Perkin Elmer Ref. 122799) were administered intraperitoneally into each mouse, and tumour burden was monitored weekly. Living Image software (PerkinElmer) was used to visualize and calculate total luminescence flux. Mice were euthanized when presenting signs of humane endpoint criteria. The bone marrow and the spleen were extracted and analysed by flow cytometry to quantify the presence of tumour cells, T cells and CART cells.
  • HCAEC human coronary artery endothelial cells
  • HAEpC human small airway epithelial cells
  • HEF human uterine fibroblasts
  • HCM human cardiac myocytes
  • HREpC human renal epithelial cells
  • an xCELLigence instrument was used that allows real-time measurements of live cell proliferation by impedance.
  • Target cells were seeded in RTCA E-Plates for xCELLigence (16 wells) and cell index was monitored during 24 h using the xCELLigence RTCA multiple plate monitoring system.
  • 100 mL of either growth medium or T cells untransduced T cells or CART cells at a 4:1 effector: target ratio
  • T cells untransduced T cells or CART cells at a 4:1 effector: target ratio
  • EXAMPLE 22 In vivo efficacy of CART84 in a B-cell lymphoma model
  • An antigen-binding domain comprising: a) a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - NYWIN (SEQ ID NO: 1); CDR2 - DIYPVSGTTNYNEKFKR (SEQ ID NO: 2); and CDR3 - GTGRFAY (SEQ ID NO: 3); or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1 - RASQSVSTSSYSYMH (SEQ ID NO: 4); CDR2 - FASNLES (SEQ ID NO: 5); and CDR3 - QHSWEIPYT (SEQ ID NO: 6); or variants thereof each having up to three amino acid substitutions, additions or deletions; b) a heavy chain variable region (VH) having complementarity determining regions (CDRs) with the sequences: CDR1 - NYWLG (
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - GFTFSSYA (SEQ ID NO: 13); CDR2 - ISGSGGST (SEQ ID NO: 14); and CDR3 - AKWDCSDGRCYWAY (SEQ ID NO: 15), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - GFTFSSYP (SEQ ID NO: 19); CDR2 - ISYHGRNK (SEQ ID NO: 20); and CDR3 - ARDRDATPGGTGVGNHGMAV (SEQ ID NO: 21), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - GFTFSDNA (SEQ ID NO: 25); CDR2 - ISGTGRTT (SEQ ID NO: 26); and CDR3 - AKWDCSDGRCYWAY (SEQ ID NO: 27), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - TSGMGVG (SEQ ID NO: 31); CDR2 - HIWWDDVKRYNPALKS (SEQ ID NO: 32); and CDR3 - MRTSYYFDY (SEQ ID NO: 33), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - SYWIN (SEQ ID NO: 37); CDR2 - DIYLGSGSTNYNEKFKS (SEQ ID NO: 38); and CDR3 - SGGYLGY (SEQ ID NO: 39), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - NYWIG (SEQ ID NO: 43); CDR2 - DIYPGGGYTNYNENFKG (SEQ ID NO: 44); and CDR3 - STTYYSSYWCFDV (SEQ ID NO: 45), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - RYWMS (SEQ ID NO: 49); CDR2 - EINPDSSTINYTPSLKD (SEQ ID NO: 50); and CDR3 - PGPTVVATYWYFDV (SEQ ID NO: 51), or variants thereof each having up to three amino acid substitutions, additions or deletions
  • VL light chain variable region
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - RYWIN (SEQ ID NO: 55); CDR2 - DIYPGSGSTNYNEKFKS (SEQ ID NO: 56); and CDR3 - DTTIAY (SEQ ID NO: 57), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - GYNMN (SEQ ID NO: 131); CDR2 - NIDPYYGGTNYNQKFKG (SEQ ID NO: 132); and CDR3 - GLLSGSFPY (SEQ ID NO: 133), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - RSWMS (SEQ ID NO: 137); CDR2 - EINPDSSTINYTPSLKD (SEQ ID NO: 138); and CDR3 - FYDGYSIYWYFDV (SEQ ID NO: 139), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - TSGMGVG (SEQ ID NO: 143); CDR2 - HIWWDDVKRYNPALRS (SEQ ID NO: 144); and CDR3 - IAVTYFFDF (SEQ ID NO: 145), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - TSGMGVG (SEQ ID NO: 149); CDR2 - HIWWDDVKRYNPALKS (SEQ ID NO: 150); and CDR3 - MSTSYYFDY (SEQ ID NO: 151), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • VH heavy chain variable region having complementarity determining regions (CDRs) with the sequences: CDR1 - IYAMN (SEQ ID NO: 155); CDR2 - RIRSKSNNYARFYADSVKD (SEQ ID NO: 156); and CDR3 - PLRSYFSMDY (SEQ ID NO: 157), or variants thereof each having up to three amino acid substitutions, additions or deletions; and a light chain variable region (VL) having CDRs with the sequences: CDR1
  • An antibody comprising the antigen-binding domain of paragraph 1 or 2.
  • a chimeric antigen receptor (CAR) comprising the antigen-binding domain of paragraph 1 or 2, optionally wherein a) the CAR is an scFv CAR; b) the CAR comprises a CD8a transmembrane domain; c) the CAR comprises a 4-1 BB or a CD28 co-stimulatory domain; and/or d) the CAR comprises a CD3-zeta signalling domain.
  • a polynucleotide comprising one or more nucleotide sequences encoding the antigenbinding domain of paragraph 1 or 2, the antibody of paragraph 3, or the CAR of paragraph 4.
  • a vector comprising the polynucleotide of paragraph 5.
  • a pharmaceutical composition comprising the antigen-binding domain of paragraph 1 or 2, the antibody of paragraph 3, the CAR of paragraph 4, the polynucleotide of paragraph 5, the vector of paragraph 6, or the cell of any one of paragraphs 7 to 10. 12.
  • a method for identifying a subject suitable for treatment with an anti-CD84 CAR or antibody comprises determining a CD84 expression level in a sample isolated from the subject, wherein the CD84 expression level is determined using the antigen-binding domain of paragraph 1 or 2, or the antibody of paragraph 3.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Cell Biology (AREA)
  • Biotechnology (AREA)
  • Hematology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Engineering & Computer Science (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Microbiology (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/EP2023/050194 2022-01-05 2023-01-05 Anti-cd84 antibodies and chimeric antigen receptors Ceased WO2023131657A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
JP2024540878A JP2025500618A (ja) 2022-01-05 2023-01-05 抗cd84抗体およびキメラ抗原受容体
CA3242498A CA3242498A1 (en) 2022-01-05 2023-01-05 Anti-cd84 antibodies and chimeric antigen receptors
MX2024008495A MX2024008495A (es) 2022-01-05 2023-01-05 Anticuerpos anti-cd84 y receptores de antigenos quimericos.
AU2023205629A AU2023205629A1 (en) 2022-01-05 2023-01-05 Anti-cd84 antibodies and chimeric antigen receptors
US18/724,147 US20250064853A1 (en) 2022-01-05 2023-01-05 Anti-cd84 antibodies and chimeric antigen receptors
IL313971A IL313971A (en) 2022-01-05 2023-01-05 Anti-cd84 antibodies and chimeric antigen receptors
KR1020247025889A KR20240130128A (ko) 2022-01-05 2023-01-05 항-cd84 항체 및 키메라 항원 수용체
CN202380016448.XA CN118660908A (zh) 2022-01-05 2023-01-05 抗cd84抗体和嵌合抗原受体
EP23700455.1A EP4460519B1 (en) 2022-01-05 2023-01-05 Anti-cd84 antibodies and chimeric antigen receptors

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
EP22382003.6 2022-01-05
EP22382003.6A EP4209511A1 (en) 2022-01-05 2022-01-05 Anti-cd84 antibodies amd chimeric antigen receptors
EP22205399 2022-11-03
EP22205399.3 2022-11-03

Publications (1)

Publication Number Publication Date
WO2023131657A1 true WO2023131657A1 (en) 2023-07-13

Family

ID=84982030

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2023/050194 Ceased WO2023131657A1 (en) 2022-01-05 2023-01-05 Anti-cd84 antibodies and chimeric antigen receptors

Country Status (9)

Country Link
US (1) US20250064853A1 (https=)
EP (1) EP4460519B1 (https=)
JP (1) JP2025500618A (https=)
KR (1) KR20240130128A (https=)
AU (1) AU2023205629A1 (https=)
CA (1) CA3242498A1 (https=)
IL (1) IL313971A (https=)
MX (1) MX2024008495A (https=)
WO (1) WO2023131657A1 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025113671A1 (zh) * 2023-12-01 2025-06-05 上海邦耀生物科技有限公司 Car、表达car的细胞及其用途
WO2026029044A1 (ja) * 2024-07-30 2026-02-05 学校法人藤田学園 うつ病または統合失調症の診断などを補助する方法、キットおよびバイオマーカー

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1998017815A1 (en) 1996-10-17 1998-04-30 Oxford Biomedica (Uk) Limited Retroviral vectors
WO1999041397A1 (en) 1998-02-17 1999-08-19 Oxford Biomedica (Uk) Limited Anti-viral vectors
WO2001079518A2 (en) 2000-04-19 2001-10-25 Oxford Biomedica (Uk) Limited Codon optimisation for expression in retrovirus packaging cells
US20140271582A1 (en) 2013-03-15 2014-09-18 City Of Hope Cd123-specific chimeric antigen receptor redirected t cells and methods of their use
WO2015118538A1 (en) * 2014-02-06 2015-08-13 Yeda Research And Development Co. Ltd. Anti cd84 antibodies, compositions comprising same and uses thereof
WO2021001404A1 (en) * 2019-07-01 2021-01-07 Julius-Maximilians-Universitaet-Wuerzburg Treatment and prevention of ischemic diseases and/or ischemic tissue damages

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1998017815A1 (en) 1996-10-17 1998-04-30 Oxford Biomedica (Uk) Limited Retroviral vectors
WO1999041397A1 (en) 1998-02-17 1999-08-19 Oxford Biomedica (Uk) Limited Anti-viral vectors
WO2001079518A2 (en) 2000-04-19 2001-10-25 Oxford Biomedica (Uk) Limited Codon optimisation for expression in retrovirus packaging cells
US20140271582A1 (en) 2013-03-15 2014-09-18 City Of Hope Cd123-specific chimeric antigen receptor redirected t cells and methods of their use
WO2015118538A1 (en) * 2014-02-06 2015-08-13 Yeda Research And Development Co. Ltd. Anti cd84 antibodies, compositions comprising same and uses thereof
WO2021001404A1 (en) * 2019-07-01 2021-01-07 Julius-Maximilians-Universitaet-Wuerzburg Treatment and prevention of ischemic diseases and/or ischemic tissue damages

Non-Patent Citations (36)

* Cited by examiner, † Cited by third party
Title
"Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
"Oligonucleotide Synthesis: A Practical Approach", 1984, IRL PRESS
ALTVATER, B. ET AL., CLIN. CANCERRES, no. 15, 22 July 2009 (2009-07-22), pages 4857 - 4866
ATSCHUL ET AL., J. MOL. BIOL., 1990, pages 403 - 410
AUSUBEL, F.M. ET AL.: "Current Protocols in Molecular Biology", 1995, OXFORD UNIVERSITY PRESS, pages: 483
BRENTJENS ET AL., CCR, vol. 13, 15 September 2007 (2007-09-15), pages 5426 - 35
CASTELLA, M. ET AL., MOL. THER. - METHODS CLIN. DEV., vol. 12, 2019, pages 134 - 144
CASUCCI ET AL., BLOOD, vol. 122, no. 20, 14 November 2013 (2013-11-14), pages 3461 - 72
CUENCA MARTA ET AL: "CD84 cell surface signaling molecule: An emerging biomarker and target for cancer and autoimmune disorders", CLINICAL IMMUNOLOGY, ELSEVIER, AMSTERDAM, NL, vol. 204, 26 October 2018 (2018-10-26), pages 43 - 49, XP085800151, ISSN: 1521-6616, [retrieved on 20181026], DOI: 10.1016/J.CLIM.2018.10.017 *
DE LA FUENTE M A ET AL: "CD84 leukocyte antigen is a new member of the Ig superfamily", BLOOD, AMERICAN SOCIETY OF HEMATOLOGY, US, vol. 90, no. 6, 15 September 1997 (1997-09-15), pages 2398 - 2405, XP002124601, ISSN: 0006-4971 *
DEVEREUX ET AL., NUCLEIC ACIDS RESEARCH, vol. 12, 1984, pages 387
DI STASI ET AL., BLOOD, vol. 113, no. 25, 18 June 2009 (2009-06-18), pages 6392 - 402
DULL ET AL.: "A Third-Generation Lentivirus Vector with a Conditional Packaging System", J. VIROL., vol. 72, 1998, pages 8463 - 8471, XP055715204, DOI: 10.1128/JVI.72.11.8463-8471.1998
FEMS MICROBIOL. LETT., vol. 177, 1999, pages 187 - 50
FUENTE MA ET AL.: "CD84 leukocyte antigen is a new member of the Ig superfamily", BLOOD, vol. 90, no. 6, 1997, pages 2398 - 405
IMAI C ET AL., LEUKEMIA, vol. 18, no. 4, April 2004 (2004-04-01), pages 676 - 84
LEAVITT, A.D. ET AL., J. VIROL., vol. 70, 1996, pages 721 - 8
LEWIS, P ET AL., EMBO J., vol. 11, 1992, pages 3053 - 8
LEWIS, P.F. ET AL., J. VIROL., vol. 68, 1994, pages 510 - 6
LI, Y ET AL., CELL STEM CELL, no. 23, 2 August 2018 (2018-08-02), pages 181 - 192
LILLEY, D.M.DAHLBERG, J.E.: "Methods in Enzymology: DNA Structures Part A: Synthesis and Physical Analysis of DNA", 1992, ACADEMIC PRESS
LIU ET AL., N. ENGL. J. MED., vol. 382, 2020, pages 545 - 553
MAHER ET AL., NAT BIOTECHNOL, vol. 20, no. 1, January 2002 (2002-01-01), pages 70 - 5
MEHTA ET AL., FRONT. IMMUNOL., vol. 9, 2018, pages 283
MILONE ET AL., MOL THER, vol. 17, no. 8, August 2009 (2009-08-01), pages 1453 - 64
MULLER, N. ET AL., J. IMMUNOTHER., vol. 38, 1 June 2015 (2015-06-01), pages 197
NALDINI, L. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 11382 - 8
NIGHTINGALE, S.J. ET AL., MOL. THER., vol. 13, 2006, pages 1121 - 32
PALOU ET AL.: "Genomic characterization of CD84 reveals the existence of five isoforms differing in their cytoplasmic domains", TISSUE ANTIGENS., vol. 55, no. 2, 2000, pages 118 - 27, XP002739389, DOI: 10.1034/j.1399-0039.2000.550203.x
POLAK, J.M.MCGEE, J.O'D.: "In Situ Hybridization: Principles and Practice", 1990, OXFORD UNIVERSITY PRESS
PULE ET AL., MOL THER, vol. 12, no. 5, November 2005 (2005-11-01), pages 933 - 41
PULE ET AL., MOL THER,, vol. 12, no. 5, November 2005 (2005-11-01), pages 933 - 41
ROE, B.CRABTREE, J.KAHN, A.: "DNA Isolation and Sequencing: Essential Techniques", 1996, JOHN WILEY & SONS
SCIENCE, vol. 272, 1996, pages 263 - 7
SHAH ET AL.: "Antigen Presenting Cell-Mediated Expansion of Human Umbilical Cord Blood Yields Log-Scale Expansion of Natural Killer Cells with Anti-Myeloma Activity", PLOS ONE, vol. 8, no. 10, 2013
TANG ET AL.: "GEPIA: a web server for cancer and normal gene expression profiling and interactive analyses.", NUCLEIC ACIDS RES., 2017

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025113671A1 (zh) * 2023-12-01 2025-06-05 上海邦耀生物科技有限公司 Car、表达car的细胞及其用途
WO2026029044A1 (ja) * 2024-07-30 2026-02-05 学校法人藤田学園 うつ病または統合失調症の診断などを補助する方法、キットおよびバイオマーカー

Also Published As

Publication number Publication date
US20250064853A1 (en) 2025-02-27
CA3242498A1 (en) 2023-07-13
EP4460519B1 (en) 2026-03-11
JP2025500618A (ja) 2025-01-09
EP4460519A1 (en) 2024-11-13
AU2023205629A1 (en) 2024-08-15
KR20240130128A (ko) 2024-08-28
IL313971A (en) 2024-08-01
MX2024008495A (es) 2024-09-04

Similar Documents

Publication Publication Date Title
JP7439002B2 (ja) ヒト化抗cd19キメラ抗原受容体を使用するがんの処置
US12325728B2 (en) Methods and compositions for genetically modifying lymphocytes to express polypeptides comprising the intracellular domain of CD79A and CD79B
JP2026054469A (ja) リンパ球の改変および送達のための方法および組成物
JP7672187B2 (ja) 血液中または濃縮pbmc中のリンパ球を遺伝子改変するための方法および組成物
JP7288503B2 (ja) 改変された抗cd19 car-t細胞
US12590321B2 (en) Methods and compositions for genetically modifying and expanding lymphocytes and regulating the activity thereof
Schäfer et al. A novel Siglec-4 derived spacer improves the functionality of CAR T cells against membrane-proximal epitopes
AU2018211081A1 (en) Chimeric antigen receptors against Axl or Ror2 and methods of use thereof
WO2018009923A1 (en) Methods and compositions for transducing lymphocytes and regulating the activity thereof
WO2020047527A2 (en) Methods and compositions for genetically modifying lymphocytes in blood or in enriched pbmcs
CN115551893A (zh) 靶向自然杀伤细胞的嵌合抗原受体(car)
EP4460519B1 (en) Anti-cd84 antibodies and chimeric antigen receptors
JP2020532969A (ja) キメラ抗原受容体と、cxcr5に結合するcar−t細胞
JP2022526187A (ja) 造血細胞の細胞傷害性を促進するための組成物及び方法
JP7591772B2 (ja) 強化された合成t細胞受容体及び抗原受容体
EP4209511A1 (en) Anti-cd84 antibodies amd chimeric antigen receptors
CN118660908A (zh) 抗cd84抗体和嵌合抗原受体
JP2024502170A5 (https=)
HK40111732A (zh) 嵌合抗原受体(car)信号传导分子的组合物及其用途

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23700455

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 3242498

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 313971

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2024540878

Country of ref document: JP

Ref document number: MX/A/2024/008495

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 202380016448.X

Country of ref document: CN

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024013096

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20247025889

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202447058000

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2023700455

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2023205629

Country of ref document: AU

Date of ref document: 20230105

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2023700455

Country of ref document: EP

Effective date: 20240805

ENP Entry into the national phase

Ref document number: 112024013096

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240626

WWP Wipo information: published in national office

Ref document number: 18724147

Country of ref document: US

WWG Wipo information: grant in national office

Ref document number: 2023700455

Country of ref document: EP