WO2023122659A2 - Conditionally activated antigen binding polypeptide complexes and methods of use thereof - Google Patents

Conditionally activated antigen binding polypeptide complexes and methods of use thereof Download PDF

Info

Publication number
WO2023122659A2
WO2023122659A2 PCT/US2022/082131 US2022082131W WO2023122659A2 WO 2023122659 A2 WO2023122659 A2 WO 2023122659A2 US 2022082131 W US2022082131 W US 2022082131W WO 2023122659 A2 WO2023122659 A2 WO 2023122659A2
Authority
WO
WIPO (PCT)
Prior art keywords
chain variable
variable region
identity
amino acid
specifically binds
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/082131
Other languages
English (en)
French (fr)
Other versions
WO2023122659A3 (en
Inventor
Hao Chen
Mark GRECI
Nicholas Jones
Ling Xu
Lan Wu
Edward Seung
Zhi-Yong Yang
Gary J. Nabel
Elias Zerhouni
Ronnie R. WEI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Isotis SA
Original Assignee
Modex Therapeutiques SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Modex Therapeutiques SA filed Critical Modex Therapeutiques SA
Priority to IL313770A priority Critical patent/IL313770A/en
Priority to KR1020247024380A priority patent/KR20240134257A/ko
Priority to EP22912696.6A priority patent/EP4452317A4/en
Priority to AU2022420594A priority patent/AU2022420594A1/en
Priority to JP2024537849A priority patent/JP2025503480A/ja
Priority to CA3240079A priority patent/CA3240079A1/en
Priority to MX2024007393A priority patent/MX2024007393A/es
Priority to CN202280089147.5A priority patent/CN118715247A/zh
Publication of WO2023122659A2 publication Critical patent/WO2023122659A2/en
Publication of WO2023122659A3 publication Critical patent/WO2023122659A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/522CH1 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/64Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/74Inducing cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site

Definitions

  • the present disclosure relates to antigen binding polypeptide complexes (e.g., antibodies and antigen binding fragments thereof) having certain structural features.
  • the present disclosure also relates to conditionally activated antigen binding polypeptide complexes (e.g., antibodies and antigen binding fragments thereof) having certain structural features.
  • the present disclosure further relates to polynucleotides and vectors encoding such polypeptide complexes; cells, pharmaceutical compositions, and kits containing such polypeptide complexes; and methods of using such polypeptide complexes.
  • Immunotherapy is the treatment of disease by activating or suppressing the immune system.
  • immunotherapy has become of great interest to researchers and clinicians, particularly in its promise to treat cancer and infectious disease.
  • Therapeutic antibodies are an important type of immunotherapy.
  • Therapeutic antibodies can be monospecific, meaning that they have specificity to one antigen or epitope.
  • Therapeutic antibodies have also been engineered to have specificity for two different antigens or epitopes (i.e., bispecific antibodies) or for multiple different antigens or epitopes (trispecific antibodies, tetraspecific antibodies, etc.).
  • monospecific, bispecific, and multispecific antibodies have been combined to form multi-targeting strategies to treat complex human diseases, such as cancer and infectious disease.
  • Bispecific T cell engagers are antibodies that recognize antigens expressed on target tumor cells and simultaneously engage the CD3 subunit of the T cell receptor on cytotoxic T cells, serving as an artificial immune synapse to mediate tumor cell lysis by the cytotoxic T cells.
  • bispecific T cell engager antibodies show high anti-tumor potency, they are also associated with strong side effects, particularly the cytokine release syndrome (CRS) associated with on-target, off-tumor toxicity for solid tumor targets, which can limit the therapeutic potential of these antibodies.
  • CRS cytokine release syndrome
  • On-target, off-tumor toxicity occurs when bispecific T cell engager antibodies bind to cancer antigens expressed on cells found in normal, non-cancerous tissue in addition to cancer antigens expressed on cancerous cells, thereby recruiting cytotoxic T cells to normal tissue and causing damage to the normal tissue. Because few solid tumor antigens are exclusively specific to tumors, such toxicity poses a great challenge for cancer immunotherapy using bispecific T cell or natural killer (NK) cell engagers.
  • NK natural killer
  • bispecific or multispecific antigen binding polypeptide complexes that can bind specific target molecules or combinations of target molecules and activate cytotoxic T cells only when in close proximity to tumor cells or within the tumor microenvironment.
  • bispecific or multispecific T cell engager antibodies that yield high efficacy with manageable adverse events (AD) and, at the same time, a wider therapeutic window and better tolerability.
  • an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VH1-L2-Fc; VH1-Ll-VL1-L2-Fc; VH1-L3-VL1-L4-Fc; or VL1-L3-VH1-L4-Fc; wherein the second polypeptide has a structure represented by VH2-L5- VH3-L6-CH1-L7-Fc or VH3-L5-VH2-L6-CH1-L7-Fc; wherein the third polypeptide has a structure represented by VL2-L8-VL3-L9-CL or VL3-L8-VL2-L9-CL; wherein VL1 is a first immunoglobulin light chain variable region; VL2 is a second immunoglobulin light chain variable region;
  • an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, a third polypeptide, and a fourth polypeptide; wherein the first polypeptide has a structure represented by VL1-L1-CL or VH1-L1-CL; wherein the second polypeptide has a structure represented by VH1-L2-CH1-L3-Fc or VL1-L2-CH1-L3-Fc; wherein the third polypeptide has a structure represented by VH2-L4-VH3-L5-CH1-L6-Fc or VH3-L4- VH2-L5-CH1-L6-Fc; wherein the fourth polypeptide has a structure represented by VL2-L7-VL3- L8-CL or VL3-L7-VL2-L8-CL; wherein VL1 is a first immunoglobulin light chain variable region; VL2 is a second immunoglobulin light chain variable region
  • an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; VL1-L1-VH2-L2-VL2-L3-VH1- L4-Fc; VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-L10-CH1-L11-Fc or VH4-L9-VH3-L10-CHl-Ll l-Fc; wherein the third polypeptide has a structure represented by VL3-L12-VL4-L
  • an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; VL1-L1-VH2-L2-VL2-L3-VH1- L4-Fc; VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; or VH4- L9-VH3-CH1-Fc; wherein the third polypeptide has a structure represented by VL3-L10-VL4-CL; or VL4-L10-VL3-
  • an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL 1 -L 1 - VL2-L2- VH2-L3 -VH1 -L4-Fc; VL 1 -L 1 - VH2-L2- VL2-L3 -VH 1 -L4-Fc; VH1-L5-VH2- L6-VL2-L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-Ll l-VH3-L12-Fc; VL3-L9- VH4-L10-VL4-L11-VH3-L12-Fc; VH3-L13-VH
  • an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-L1-VH2-L2-VL2-L3-VH1-L4-CH1-L10- Fc; VH1 -L6-VH2-L7-VL2-L8- VL 1 -L9-CH1 -L 10-Fc; VH1 -L6- VL2-L7-VH2-L8-VL 1 -L9-CH1 - LlO-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VL1-L11-VH2-L12-VL2-L13- VH 1 -L 14-CL-L 15-Fc; VL1-
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to a tumor-associated antigen
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to a tumor-associated antigen
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD3
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to a tumor-associated antigen
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to a tumor-associated antigen
  • VH2 is a second immunoglobulin heavy chain variable region that
  • the one or more linkers LI -L88 has a length of from 0 amino acids to about 50 amino acids. In some aspects, the one or more linkers L1-L88 is non-immunogenic. In some aspects, the one or more linkers L1-L88 does not contain a consensus T cell epitope.
  • the one or more linkers L1-L88 is a cleavable linker.
  • the cleavable linker is cleaved by a matrix metalloprotease (MMP), a type II transmembrane serine protease, or a MMP and a type II transmembrane serine protease.
  • MMP matrix metalloprotease
  • the MMP is MMP1, MMP2, MMP7, MMP8, MMP9, MMP13, or a combination thereof.
  • the type II transmembrane serine protease is a matriptase, hepsin, or a combination thereof.
  • the matriptase is matriptase 1, matriptase 2, matriptase 3, or a combination thereof.
  • the cleavable linker is cleaved by urokinase or legumain.
  • the cleavable linker is GPAALV, GSGRKG, GPLGLTG, GPSGLVG, GLVGRKAG, GPAGLVG, GPAGLVSG, STRKAGG, ASTRKAG, or ASTRKAGG (SEQ ID NOs:22-31), or a sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% identity to any one of SEQ ID NOs:22-31.
  • the one or more of linkers L1-L88 comprise the amino acid sequence of g, a, gss, asg, ggssg, gssgs, gtvaa, asggs, astgg, ggsgs, asggsg, ggsgssg, ggsggssgs, sggsgssggs, ggsggsgsgggs, ggsggsgsgggsasgsg, ggsggsggggsggsgsg, ggggsggsggsggsgsgs, ggggsggsggggsgsg, ggggsggsggggsgsg, gggssggsggsggsgsgsgs, sggsggsggsggsgsggsgsg, gsgssggggsggsggsgsg, gsgssggggsggsggsgsg, ggggsgg
  • one of VH1, VH2, VH3 or VH4 specifically binds to CD3. In some aspects, one of VL1, VL2, VL3 or VL4 specifically binds to CD3. In some aspects, VH1 and VL1, VH2 and VL2, VH3 and VL3, or VH4 and VL4 specifically binds to CD3.
  • the VH1, VH2, VH3 or VH4 that specifically binds to CD3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:32, 40, 96, 433, 524, 667, 703, 739, 767, 803.
  • a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:33, 41, 97, 434, 525, 668, 704, 740, 768, 804, 840, 852 and 860; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:34, 42, 98, 435, 526, 669, 705, 741, 769, 805, 841, 853 and 861; and wherein the VL1, VL2, VL3 or VL4 that specifically binds to CD3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:35, 44, 99, 446, 456, 466, 476, 520, 663, 699, 735, 763, 799, 835, 855 and
  • the VH1, VH2, VH3 or VH4 that specifically binds to CD3 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:38, 43, 102, 423, 432, 523,
  • VL1, VL2, VL3 or VL4 that specifically binds to CD3 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:39, 47, 103, 422, 445, 455, 465, 475, 519, 662, 698, 734, 762, 798, 834, 854 and 862.
  • one or more of VH1, VH2, VH3 or VH4 specifically binds to a tumor-associated antigen (TAA). In some aspects, one or more of VL1, VL2, VL3 or VL4 specifically binds to a TAA. In some aspects, VH1 and VL1, VH2 and VL2, VH3 and VL3, and/or VH4 and VL4 specifically binds to a TAA.
  • TAA tumor-associated antigen
  • the TAA is A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4, CXCL12, C
  • the one or more of VH1, VH2, VH3 or VH4 that specifically binds to a TAA comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:64, 72, 80, 88, 104, 112, 120, 128, 389, 409, 419, 429, 659, 695, 731, 397, 508, 540, 552, 757, 793, 829, 875, 500, 749, 785, 821, 649, 685, 775, 847, 625, 641, 677 and 713; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:65, 73, 81, 89, 105, 113, 121, 129, 390, 410, 420, 430, 660, 696, 732, 398, 509, 54
  • the one or more of VH1, VH2, VH3 or VH4 that specifically binds to a TAA comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:70, 78, 86, 94, 102, 110, 118, 126, 134, 388, 408, 418, 428, 584, 658, 694, 730, 396, 403, 507, 539, 551, 756, 792, 828, 883, 866, 874, 499, 544, 556, 748, 784, 820, 528, 648, 684, 774, 846, 624, 640, 676 and 712; and the one or more of VL1, VL2, VL3 or VL4 that specifically binds to a TAA comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NO
  • one or more of VH1, VH2, VH3 or VH4 specifically binds to an immune stimulating receptor. In some aspects, one or more of VL1, VL2, VL3 or VL4 specifically binds to an immune stimulating receptor. In some aspects, VH1 and VL1, VH2 and VL2, VH3 and VL3, and/or VH4 and VL4 specifically bind to an immune stimulating receptor. In some aspects, the immune stimulating receptor is CD28.
  • the VH1, VH2, VH3 or VH4 that specifically binds to an immune stimulating receptor comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:48, 56, 649, 685, 775 and 847; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:49, 57, 650, 686, 776 and 848; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:50, 58, 651, 687, 777 and 849; and wherein the VL1, VL2, VL3 or VL4 that specifically binds to an immune stimulating receptor comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:
  • the VH1, VH2, VH3 or VH4 that specifically binds to an immune stimulating receptor comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:54, 62, 528, 648, 684, 774 and 846
  • the VL1, VL2, VL3 or VL4 that specifically binds to an immune stimulating receptor comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:55, 63, 527, 644, 680, 770 and 842.
  • L5, L8, or L5 and L8 are cleavable linkers.
  • L4, L7, or L4 and L7 are cleavable linkers.
  • L9, L12, or L9 and L12 are cleavable linkers.
  • VH3 and VL3 specifically bind to CD3.
  • VH1 and VL1 and/or VH2 and VL2 specifically bind to a TAA.
  • VH1 and VL1 or VH2 and VL2 specifically bind to CD28.
  • VH4 and VL4 specifically bind to CD3.
  • VH1 and VL1, VH2 and VL2, and VH3 and VL3 specifically bind to a TAA.
  • VH1 and VL1 specifically bind to a TAA
  • VH2 and VL2 specifically bind to a TAA
  • VH3 and VL3 specifically bind to CD28.
  • VH1 and VL1 specifically bind to CD28
  • VH2 and VL2 specifically bind to a TAA
  • VH3 and VL3 specifically bind to a TAA.
  • VH1 and VL1 specifically bind to cMet
  • VH2 and VL2 specifically bind to Trop2, and VH3 and VL3 specifically bind to CD28.
  • VH1 and VL1 specifically bind to Trop2, VH2 and VL2 specifically bind to cMet, and VH3 and VL3 specifically bind to CD28. In some aspects, VH1 and VL1 specifically bind to cMet, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to Trop2. In some aspects, VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to cMet, and VH3 and VL3 specifically bind to Trop2. In some aspects, VH1 and VL1 specifically bind to Trop2, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to cMet.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to Trop2, and VH3 and VL3 specifically bind to cMet.
  • VH1 and VL1 specifically bind to CD19, VH2 and VL2 specifically bind to CD20, and VH3 and VL3 specifically bind to CD28.
  • VH1 and VL1 specifically bind to CD20, VH2 and VL2 specifically bind to CD 19, and VH3 and VL3 specifically bind to CD28.
  • VH1 and VL1 specifically bind to CD19, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD20.
  • VH1 and VL1 specifically bind to CD20, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD19. In some aspects, VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD 19, and VH3 and VL3 specifically bind to CD20. In some aspects, VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD20, and VH3 and VL3 specifically bind to CD 19.
  • LI, L3, or LI and L3 are cleavable linkers, or L5, L7, or L5 and L7 are cleavable linkers.
  • L9, Li l, or L9 and Li l are cleavable linkers, or L13, L15, or L13 and L15 are cleavable linkers.
  • VH1 and VL1, VH2 and VL2, VH3 and VL3, or VH4 and VL4 specifically bind to CD3.
  • one or more of VH1 and VL1, VH2 and VL2, VH3 and VL3, and VH4 and VL4 specifically bind to a TAA.
  • VH1 and VL1, VH2 and VL2, VH3 and VL3, or VH4 and VL4 specifically bind to CD28.
  • an antigen binding polypeptide complex described herein is an antibody or antigen binding fragment thereof.
  • the immunoglobulin hinge comprises an upper hinge region, a middle hinge region, a lower hinge region, or a combination thereof.
  • the Fc region comprises at least one knob-into-hole modification.
  • the antigen binding polypeptide complex is an IgGl or IgG4 antibody and the knob-into-hole modification comprises (i) knob substitutions of S354C and T366W and hole substitutions of Y349C, T366S, L368A and Y407V; (ii) hole substitutions of L234A, L235A and P329A; (iii) hole substitutions of L234A and L235A; (iv) hole substitutions of M428L and N433S; (v) hole substitutions of M252Y, S254T and T256E; or (vi) a combination thereof; based on the EU numbering scheme.
  • an antibody or antigen binding fragment thereof comprising an antigen binding polypeptide complex described herein.
  • composition comprising an antigen binding polypeptide complex described herein, or an antibody or antigen binding fragment thereof, and a pharmaceutically acceptable carrier.
  • kits comprising an antigen binding polypeptide complex, an antibody or antigen binding fragment thereof, or a pharmaceutical composition described herein, and instructions for use.
  • 100311 Also provided herein are specified methods of use of an antigen binding polypeptide complex, antibody or antigen binding fragment thereof, pharmaceutical composition or kit described herein, or a combination thereof.
  • a method for treating cancer comprising administering to a subject in need thereof an antigen binding polypeptide complex, an antibody or antigen binding fragment thereof, or a pharmaceutical composition described herein.
  • the cancer is a solid cancer.
  • the cancer is breast cancer, lung cancer, gastric cancer, prostate cancer, cervical cancer, urothelial cancer, or pancreatic cancer.
  • the cancer is a hematological cancer.
  • the hematological cancer is leukemia or lymphoma.
  • the leukemia or lymphoma is B cell leukemia, B cell lymphoma, diffuse large B-cell lymphoma (DLBCL) Follicular lymphoma, Chronic lymphocytic leukemia (CLL) /small lymphocytic lymphoma (SLL), Mantle cell lymphoma (MCL), Burkitt lymphoma, Lymphoplasmacytic lymphoma (Waldenstrom macroglobulinemia), prolymphocytic leukemia (PLL), or hairy cell leukemia (HCL).
  • B cell leukemia B cell lymphoma
  • DLBCL diffuse large B-cell lymphoma
  • CLL Chronic lymphocytic leukemia
  • SLL small lymphocytic lymphoma
  • MCL Mantle cell lymphoma
  • Burkitt lymphoma Burkitt lymphoma
  • FIG. 1A depicts configurations of masked trispecific T cell engagers.
  • Fvl-Fv2 are against tumor associated antigens (TAAs) or immune costimulatory receptors.
  • TAAs tumor associated antigens
  • the third Fv targets CD3.
  • FIG. IB depicts a configuration of masked tetraspecific T cell engagers.
  • Fvl-Fv3 are against tumor associated antigens (TAAs) or immune costimulatory receptors.
  • TAAs tumor associated antigens
  • the fourth Fv targets CD3.
  • FIG. 2 shows SDS-PAGE results of in vitro cleavage of exemplary masked tetraspecific molecules as depicted. Molecules were treated with either MTP or MMP9 protease as specified.
  • FIG. 3 shows ELISA binding results of exemplary masked tetraspecific molecules as depicted in FIG. 2, or negative isotype (Control IgGl), with or without protease treatment. Molecules cleaved or not cleaved by MTP or MMP9 as specified were tested for binding affinity to Trop2 and cMet.
  • FIG. 4 shows ELISA binding results of exemplary masked tetraspecific molecules as depicted in FIG. 2, or negative isotype (Control IgGl), with or without protease treatment. Molecules cleaved or not cleaved by MTP or MMP9 as specified were tested for binding affinity to CD28. 100371
  • FIG. 5 shows ELISA binding results of exemplary masked tetraspecific molecules as depicted in FIG. 2, or negative isotype (Control IgGl), with or without protease treatment. Molecules cleaved or not cleaved by MTP or MMP9 as specified were tested for binding affinity to CD3.
  • FIG. 6 shows cytolysis of HCC1954 tumor cells by peripheral blood mononuclear cells PBMCs (E:T: 10: l) mediated by exemplary masked tetraspecific molecules as depicted in FIG. 2, or negative isotype (Control IgGl), from PBMCs of two donors (KP63250 and KP63251).
  • FIG. 7 shows ELISA binding results of exemplary non-masked tetraspecific molecules as depicted, or negative isotype (hIgGILALPA) control, to their respective targets of hTrop2, hcMet, hCD28, and hCD3.
  • FIG. 8 shows CD69+ activation by exemplary non-masked tetraspecific molecules, or negative isotype (IgGILALPA) control, of CD2+ T cells from PBMCs of two different donors.
  • FIG. 9 shows ELISA binding results (OD650) of MX612 and MX613 to their targets hTrop2, hcMet, hCD28, and hCD3. Results from a control antibody (control IgG), which does not bind these targets, is also shown.
  • FIG. 10 shows simultaneous co-binding of MX612 to its targets hTrop2, hcMet, hCD28, and hCD3, measured by biolayer-interferometry.
  • FIG. 11 shows simultaneous co-binding of MX446 to its targets hTrop2, hcMet, hCD28, and hCD3, measured by biolayer-interferometry.
  • FIG. 12 shows the ability of exemplary non-masked tetraspecific molecules to activate CD4+ and CD8+ T cells (CD69+).
  • Results from PBMCs from six different donors in the absence of target tumor cells and following treatment with 1 nM MX446 and MX612 are shown.
  • Results from a negative control (isotype IgGILALPA; "- Ctl”) and positive control (CD3+CD28 mAbs; "+ Ctl”) are also shown.
  • FIG. 13A-13B shows the ability of exemplary non-masked tetraspecific molecules to initiate release of the cytokines IL-2, IFN-gamma, IL-6 and TNF alpha.
  • Results from PBMCs from six different donors in the absence of target tumor cells and following treatment with 1 nM MX446 and MX612 are shown.
  • Results from a negative control (isotype IgGILALPA; "- Ctl”) and positive control (CD3+CD28 mAbs; "+ Ctl”) are also shown.
  • FIG. 14A-14B shows the ability of exemplary non-masked tetraspecific molecules to initiate release of the cytokines IL-2, IFN-gamma, IL-6 and TNF alpha.
  • Results from PBMCs from six different donors in the presence of HCC1954 tumor cells and following treatment with 62.5 pM MX446 and MX612 are shown.
  • Results from a negative control are also shown.
  • FIG. 15A-15B shows the ability of exemplary non-masked tetraspecific molecules to initiate release of the cytokines IL-2, IFN-gamma, IL-6 and TNF alpha.
  • Results from PBMCs from six different donors in the presence of BT20 tumor cells and following treatment with 62.5 pM MX446 and MX612 are shown.
  • Results from a negative control are also shown.
  • FIG. 16A-16B shows cytolysis of tumor cell lines by exemplary non-masked tetraspecific molecules or a negative control from PBMCs (E:T 5: 1).
  • HCC1954, BT-20, HCC1143 and HCC70 breast cancer cells, PC3 and DU145 prostate cancer cells, and Hs746T andN87 gastric cancer cells were used.
  • Percent lysis of cells following treatment with MX446 and MX612, and EC50 values in pM are shown.
  • Results from a negative control isotype IgGILALAPA
  • FIG. 17 summarizes cytolysis potencies of various tumor cell lines mediated by exemplary non-masked tetraspecific molecules.
  • FIG. 18A-18C shows binding of exemplary non-masked tetraspecific molecules to their targets hTrop2, hcMet, hCD28, and hCD3, measured by biolayer-interferometry. Results are shown for cells treated with MX974 (FIG. 18A), MX975 (FIG. 18B) and MX976 (FIG. 18C).
  • FIG. 19 shows in vitro cytolysis of HCC1954 tumor cells by exemplary nonmasked tetraspecific molecules. Cytolysis mediated by MX974, MX975 and MX976 or a negative control from PBMCs (E:T: 5: 1) was measured from a representative donor after 48 and 72 hours of incubation at 37°C. Results are shown as percent lysis of cells with increasing concentration of antibody. Results from a negative control (hIgGILALAPA) are also shown.
  • FIG. 20 shows activation of CD4+ and CD8+ T cells (CD69+) from PBMCs by exemplary masked tetraspecific molecules. Results are shown as the percentage of CD69+ cells from six donors in the absence of target tumor cells, following treatment with MX444 or MX634 at 1 nM. Results from a negative control (isotype IgGILALPA; Ctl") and a positive control (CD3+CD28 mAbs; "+ Ctl”) are also shown.
  • FIG. 21A-21B shows the ability of exemplary non-masked tetraspecific molecules to initiate release of the cytokines IL-2, IFN-gamma, IL-6 and TNF alpha.
  • Results from PBMCs from six different donors in the absence of target tumor cells and following treatment with 1 nM MX444 and MX634 are shown.
  • Results from a negative control (isotype IgGILALPA; Ctl") and positive control (CD3+CD28 mAbs; "+ Ctl”) are also shown.
  • FIG. 22A-22B shows the ability of exemplary non-masked tetraspecific molecules to initiate release of the cytokines IL-2, IFN-gamma, IL-6 and TNF alpha.
  • Results from PBMCs from six different donors in the absence of target tumor cells and following treatment with 1 nM MX444 and MX634 are shown.
  • Results from a negative control (isotype IgGILALPA; "- Ctl”) and positive control (CD3+CD28 mAbs; "+ Ctl”) are also shown.
  • FIG. 23A-23B shows the ability of exemplary non-masked tetraspecific molecules to initiate release of the cytokines IL-2, IFN-gamma, IL-6 and TNF alpha.
  • Results from PBMCs from six different donors in the presence of HCC1954 tumor cells and following treatment with 62.5 pM MX444 and MX634 are shown.
  • Results from a negative control are also shown.
  • FIG. 24A-24B shows the ability of exemplary non-masked tetraspecific molecules to initiate release of the cytokines IL-2, IFN-gamma, IL-6 and TNF alpha.
  • Results from PBMCs from six different donors in the presence of BT20 tumor cells and following treatment with 62.5 pM MX444 and MX634 are shown.
  • Results from a negative control are also shown.
  • FIG. 25 summarizes cytolysis potencies of various tumor cell lines mediated by exemplary non-masked tetraspecific molecules.
  • FIG. 26 shows the structures of MX433, MX434, MX435 and MX436.
  • FIG. 27 shows the ability of exemplary non-masked tetraspecific molecules
  • MX433, MX434, MX435 and MX436 to bind to their targets, as tested by ELISA. Binding results to hCD19, hCD28 and hCD3 are shown. Results from a negative control (hIgGILALPA) are also shown.
  • FIG. 28 shows the structures of MX647, MX648, MX685 and MX686.
  • FIG. 29 shows the ability of exemplary non-masked tetraspecific molecules
  • MX647, MX648, MX685 and MX686 to bind to their targets, as tested by ELISA. Binding results to hCD19, hCD28 and hCD3 are shown.
  • FIG. 30 shows surface staining of exemplary non-masked tetraspecific molecules to hCD20-expressing Epi293 cells.
  • the molecules tested were MX647, MX789, MX788, MX787, MX786, MX685, MX793, MX792, MX791 and MX790. Staining with a negative control (hIgGILALPA) is also shown.
  • FIG. 31 shows the structures of MX647, MX648, MX685, MX786 and MX790.
  • FIG. 32 shows ability of exemplary non-masked tetraspecific molecules to activate
  • T cells (CD69+).
  • the molecules tested were MX647, MX648, MX685, MX786 and MX790.
  • the percentage of CD69+ cells from PBMCs of a representative donor in the absence of tumor cells and following treatment with MX647, MX648, MX685, MX786 and MX790 are shown.
  • EC50 values in pM and results from a negative control (hIgGILALAPA) are also shown.
  • FIG. 33 shows the measurement of cytolysis mediated by MX647, MX648, MX685, MX786 and MX790 or a negative control (hIgGILALAPA) from PBMCs (E:T: 5: 1). Results are shown as percent lysis with increasing concentration of antibody. EC50 in pM and Rmax values are also shown.
  • FIG. 34 shows cytokine release from PBMCs from a representative donor in the absence of target tumor cells and following treatment with 8 pM or 40 pM MX647, MX648, MX685, MX786 and MX790. Results from a negative control (hIgGILALPA) are also shown.
  • FIG. 35 shows cytokine release from PBMCs from a representative donor in the presence of Z-138 tumor cells and following treatment with 8 pM or 40 pM MX647, MX648, MX685, MX786 and MX790. Results from a negative control (hIgGILALAPA) are also shown.
  • FIG. 36 shows surface staining of exemplary trispecific molecules MX848, MX856 and MX857 to hCD20-expressing Epi293 cells. Staining with a negative control (control) is also shown.
  • FIG. 37 shows in vitro cytolysis of Z-138 tumor cells mediated by MX857 or a negative control (hIgGILALAPA) from PBMCs from two representative donors (E:T: 3: 1). Results are shown as percent lysis of cells with increasing concentration of antibody.
  • FIG. 38 shows surface staining of 12.5 nM MX846, MX854 and MX855 to hCD20- expressing Epi293 cells. Staining with a negative control (control) is also shown.
  • FIG. 41A-41B show binding of MX977 and MX978 to their targets CD20, CD 19, CD28 and CD3 by biolayer-interferometry.
  • FIG. 42 shows surface staining of 12.5 nM MX977 and MX978 to hCD20- expressing Epi293 cells. Staining with a negative control (hlgGLALAPA) is also shown.
  • the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see, e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
  • single chain Fv single chain Fv
  • Such single chain antibodies are also intended to be encompassed within the term "antigen-binding fragment" of an antibody.
  • CDRs within an antibody heavy chain molecule are typically present at amino acid positions 31 to 35, which optionally can include one or two additional amino acids, following 35 (referred to in the Kabat numbering scheme as 35A and 35B) (CDR1), amino acid positions 50 to 65 (CDR2), and amino acid positions 95 to 102 (CDR3).
  • CDRs within an antibody light chain molecule are typically present at amino acid positions 24 to 34 (CDR1), amino acid positions 50 to 56 (CDR2), and amino acid positions 89 to 97 (CDR3).
  • Fab refers to a region of an antibody that binds to an antigen. It is typically composed of one constant and one variable domain of each of the heavy and the light chain.
  • one or more of VH1, VH2, VH3 or VH4 of an antigen binding polypeptide complex described herein specifically binds to a tumor-associated antigen (TAA).
  • TAA tumor-associated antigen
  • one or more of VL1, VL2, VL3 or VL4 of an antigen binding polypeptide complex described herein specifically binds to a TAA.
  • VH1 and VL1, VH2 and VL2, VH3 and VL3, and/or VH4 and VL4 or an antigen binding polypeptide complex described herein specifically binds to a TAA.
  • the first polypeptide has a structure represented by VL1-Ll-VH1-L2-Fc; VH1-L3-VL1-L4-Fc; VH1-Ll-VL1-L2-Fc; or VL1-L3-VH1-L4-Fc;
  • the second polypeptide has a structure represented by VH2-L5-VH3-L6-CH1-L7-Fc;
  • the third polypeptide has a structure represented by VL2-L8-VL3-L9-CL.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; VL1-L1-VH2- L2-VL2-L3-VH1-L4-Fc; VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-L7- VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-L10- CHl-Ll l-Fc or VH4-L9-VH3-L10-CH1-L11-Fc; wherein the third polypeptide has a structure represented by VL3-L12-VL
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; VL1-L1-VH2- L2-VL2-L3-VH1-L4-Fc; VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-L7- VL1-L8-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-L10-CH1-L11- Fc; and the third polypeptide has a structure represented by VL4-L12-VL3-L13-CL.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-Fc; VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; or VH1-L5- VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH4-L9- VH3-L10-CHl-Ll l-Fc, and the third polypeptide has a structure represented by VL3-L12-VL4- L13-CL.
  • the first polypeptide has a structure represented by: VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH I -L5-VH2-L6-VL2-L7-VL I -L8- Fc;
  • the second polypeptide has a structure represented by: VH3-L9-VH4-L10-CHl-Ll l-Fc;
  • the third polypeptide has a structure represented by: VL3-L12-VL4-L13-CL.
  • the first polypeptide has a structure represented by VL1-L1- VL2-L2-VH2-L3-VH1-L4-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-Fc; VH1-L5-VH2-L6-VL2- L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; and the third polypeptide has a structure represented by VL4-L10-VL3-CL.
  • the first polypeptide has a structure represented by VL1-L1- VL2-L2-VH2-L3-VH1-L4-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-Fc; VH1-L5-VH2-L6-VL2- L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH4-L9-VH3-CH1-Fc, and the third polypeptide has a structure represented by VL3-L10-VL4-CL.
  • the first polypeptide has a structure represented by : VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-Fc or VH1 -L5- VL2-L6- VH2-L7- VL 1 -L8-Fc;
  • the second polypeptide has a structure represented by: VH3-L9-VH4-CH1-Fc;
  • the third polypeptide has a structure represented by: VL3-L10-VL4-CL.
  • the first polypeptide has a structure represented by: VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc;
  • the second polypeptide has a structure represented by: VH3-L9-VH4-CH1-Fc;
  • the third polypeptide has a structure represented by: VL3-L10-VL4-CL.
  • the first polypeptide has a structure represented by VL1- L 1 -VL2-L2- VH2-L3 - VH1 -L4-Fc; VL 1 -L 1 - VH2-L2- VL2-L3 - VH1 -L4-Fc; VH1 -L5- VH2-L6- VL2-L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-VL1-L8-Fc; and the second polypeptide has a structure represented by VL3-L9-VH4-L10-VL4-Ll l-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc or VH1-L5-VH2-L6-VL2- L7-VL1-L8-Fc; and the second polypeptide has a structure represented by VL3-L9-VL4-L10- VH4-L11-VH3-L12-Fc or VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6- VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10- VH4-L11-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VH1- L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3- L 13 - VH4-L 14- VL4-L 15 - VL3 -L 16-Fc.
  • L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-L5-VL4- L6-VH4-L7-VH3-L8-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VL3 is a third immunoglobulin light chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VL4 is a fourth immunoglobulin light chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VH1 is a first immunoglobulin heavy chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VH2 is a second immunoglobulin heavy chain variable region that specifically binds to Trop2, cMet,
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to Trop2;
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to cMet;
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD3;
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD28;
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to Trop2;
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to cMet;
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD3; and
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD28.
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to Trop2;
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to cMet;
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD28;
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD3;
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to Trop2;
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to cMet;
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD28; and
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD3.
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to cMet
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to Trop2
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD3
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD28
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to cMet
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to Trop2
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD3
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD28.
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to cMet
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to Trop2
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD28
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD3
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to cMet
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to Trop2
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD28
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD3.
  • the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:204 and 511. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:205 and 512.
  • the first polypeptide has a structure represented by VL1-L1-VH2- L2-VL2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-L5-VH4- L6-VL4-L7-VH3-L8-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VL3 is a third immunoglobulin light chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VL4 is a fourth immunoglobulin light chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VH1 is a first immunoglobulin heavy chain variable region that specifically binds to Trop2, cMet, CD3 or CD28
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to cMet
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to CD28
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to Trop2
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD3
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to cMet
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD28
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to Trop2
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD3.
  • the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:634 and 652. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:635 and 653.
  • the first polypeptide has a structure represented by VH1-L1-VL2- L2-VH2-L3-VL1-L4-Fc and the second polypeptide has a structure represented by VH3-L5-VL4- L6-VH4-L7-VL3-L8-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VL3 is a third immunoglobulin light chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VL4 is a fourth immunoglobulin light chain variable region that specifically binds to Trop2, cMet, CD3 or CD28; VH1 is a first immunoglobulin heavy chain variable region that specifically binds to Trop2, cMet, CD3 or CD28
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to cMet
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to CD28
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to Trop2
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD3
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to cMet
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD28
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to Trop2
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD3.
  • the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:670 and 688. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:671 and 689.
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to cMet
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to CD28
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to Trop2
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD3
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to cMet
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD28
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to Trop2
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD3.
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-L5-VL4- L6-VH4-L7-VH3-L8-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to CD 19, CD20, CD3 or CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to CD 19, CD20, CD3 or CD28; VL3 is a third immunoglobulin light chain variable region that specifically binds to CD 19, CD20, CD3 or CD28; VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD 19, CD20, CD3 or CD28; VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD 19, CD20, CD3 or CD28; VH2 is
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to CD20;
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to CD 19;
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD3;
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD28;
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD20;
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD 19;
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD3; and
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD28.
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to CD 19;
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to CD20;
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD28;
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD3;
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD 19;
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD20;
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD28; and
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD3.
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to CD20;
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to a CD 19;
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD28;
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD3;
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD20;
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD 19;
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD28; and
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-
  • L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-L5-VL4- L6-VH4-L7-VH3-L8-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to CD20, CD3 or CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to CD20, CD3 or CD28; VL3 is a third immunoglobulin light chain variable region that specifically binds to CD20, CD3 or CD28; VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD20, CD3 or CD28; VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD20, CD3 or CD28; VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD20, CD3 or CD28; VH3 is a third immunoglobulin heavy
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to CD20
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to CD20
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD3
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD20
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD20
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD20
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD3
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD20.
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to CD20;
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to CD20;
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD3;
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD28;
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD20;
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD20;
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD3; and
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD28.
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to CD20;
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to CD20;
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD3;
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD28;
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD20;
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD20;
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD3; and
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD28.
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-L5-VL4- L6-VH4-L7-VH3-L8-Fc; wherein VL1 wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to CD20, BCMA, CD3 or CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to CD20, BCMA, CD3 or CD28; VL3 is a third immunoglobulin light chain variable region that specifically binds to CD20, BCMA, CD3 or CD28; VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD20, BCMA, CD3 or CD28; VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD20, BCMA
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to CD20;
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to BCMA;
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD28;
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD3;
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD20;
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to BCMA;
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD28; and
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD3.
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to BCMA
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to CD20
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD28
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD3
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to BCMA
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD20
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD28
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD3.
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to CD20;
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to CD20;
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD28;
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD3;
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD20;
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD20;
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD28; and
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD3.
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to CD 19;
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to CD20;
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD3;
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD28;
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD 19;
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD20;
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD3; and
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD28.
  • the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:742 and 760. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:743 and 761.
  • the first polypeptide has a structure represented by VH1-L1-VL2- L2-VH2-L3-VL1-L4-Fc and the second polypeptide has a structure represented by VH3-L5-VL4- L6-VH4-L7-VL3-L8-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to CD20, CD 19, CD3 or CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to CD20, CD 19, CD3 or CD28; VL3 is a third immunoglobulin light chain variable region that specifically binds to CD20, CD 19, CD3 or CD28; VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD20, CD 19, CD3 or CD28; VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD20, CD 19, CD3 or CD28; VH2 is
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to CD 19;
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to CD20;
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD3;
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to CD28;
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to CD 19;
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to CD20;
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to CD3; and
  • VH4 is a fourth immunoglobulin heavy chain variable region that specifically binds to CD28.
  • the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:778 and 796. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:779 and 797.
  • the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:206 and 513. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:207 and 514. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:204 and 511.
  • the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:205 and 512. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:274 and 513. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:275 and 514.
  • the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:228 and 511. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:229 and 512. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:206, 160 and 162.
  • the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:207, 161 and 163. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:206, 160 and 174. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:207, 161 and 175.
  • the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:206, 162 and 176. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:207, 163 and 177. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:204, 160 and 162.
  • the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:205, 161 and 163. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:204, 160 and 174. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:205, 161 and 175.
  • the antigen binding polypeptide complex comprises amino acid sequences having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:204, 162 and 176. In some aspects, the antigen binding polypeptide complex comprises amino acid sequences encoded by polynucleotides having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NOs:205, 163 and 177.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; VL1-L1-VH2-L2-VL2-L3-VH1- L4-Fc; VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11-VH3- L 12-Fc; VL3 -L9- VH4-L 10- VL4-L 11 - VH3 -L 12-Fc; VH3 -L 13 - VH4-L 14
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3 -VH1 -L4-Fc; VL 1 -L 1 - VH2-L2- VL2-L3 -VH1 -L4-Fc; VH1 -L5-VH2-L6- VL2-L7- VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VL1-L1-VH2-L2-VL2- L3-VH1-L4-Fc or VH I -L5-VH2-L6-VL2-L7-VL I -L8-Fc or VH1-L5-VL2-L6-VH2-L7-VL1-L8- Fc and the second polypeptide has a structure represented by VL3-L9-VH4-L10-VL4-L11-VH3- L12-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-Fc; or VL1-Ll-VH2-L2-VL2-L3-VH1-L4-Fc or VH1-L5-VH2-L6-VL2-L7- VL1-L8-Fc or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VL1-L1-VH2-L2-VL2- L3-VH1-L4-Fc or VH I -L5-VH2-L6-VL2-L7-VL I -L8-Fc or VH1-L5-VL2-L6-VH2-L7-VL1-L8- Fc and the second polypeptide has a structure represented by VH3-L13-VL4-L14-VH4-L15-VL3- L16-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-Fc or VH I -L5-VH2-L6-VL2-L7-VL I -L8-Fc; and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-Ll l -VH3-L12-Fc or VH3-L13-VH4-L14-VL4- L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VL1-L1- VL2-L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-L9- VL4-L10-VH4-Ll l-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-L1-VH2-L2-VL2-L3-VH1-L4-CH1-L5- Fc; VH1 -L6-VH2-L7-VL2-L8- VL 1 -L9-CH1 -L 10-Fc; VH1 -L6- VL2-L7-VH2-L8-VL 1 -L9-CH1 - LlO-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VL1-L11-VH2-L12-VL2-L13- VH1 -L 14-CL-L 15-Fc
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to a tumor-associated antigen
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to a tumor-associated antigen
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to CD3
  • VL4 is a fourth immunoglobulin light chain variable region that specifically binds to a tumor-associated antigen
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to a tumor-associated antigen
  • VH2 is a second immunoglobulin heavy chain variable region that
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1-L6- VH2-L7- VL2-L8- VL 1 -L9-CH1 -L 10-Fc; VH1 -L6-VL2-L7- VH2-L8- VL 1 -L9-CH1 -L 10-Fc; VL 1 - L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL- L 15-Fc; VH 1 -L 16-VH2-L 17- VL2-L 18- VL 1 -L 16
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1- LlO-Fc; VHl-L6-VL2-L7-VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1- L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-L1-VH2-L2- VL2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH1-L6-VL2- L7- VH2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VL 1 - L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 - L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14
  • the first polypeptide has a structure represented by VL1- Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc;
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2- L7-VL2-L8-VLl-L9-CHl-L10-Fc; VHl-L6-VL2-L7-VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18-VL 1 -L 19-
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1- Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH 1 -L6- VL2-L7- VH2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1-L14-CL- L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-L1-VH2-L2-VL2-L3-VH1- L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH1-L6-VL2-L7-VH2-L8- VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VL1-L11-VH2- L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18-VL 1 -L 19-CL-L20
  • the first polypeptide has a structure represented by VL1-L1- VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1- L6-VH2-L7-VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VH1 -L6- VL2-L7-VH2-L8-VL 1 -L9-CH1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15-Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14- CL-L 15-Fc; VH1 -L 16-VH2-L 17-VL2-L 18- VL 1 -
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1- L9-CHl-L10-Fc; VHl-L6-VL2-L7-VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2- L13-VH1-L14-CL-L15-Fc; VL1-L11-VH2-L12-VL2-L13-VH1-L14-CL-L15-Fc; VH1-L16- VH2-L 17- VL2-L 18-VL 1 -L 19-CL-L20-Fc; VH
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1- Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH 1 -L6- VL2-L7- VH2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1-L14-CL- L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L
  • the first polypeptide has a structure represented by VL I -L I -VL2-L2-VH2-L3-VH I -L4-CH I -L5-Fc; VL1-L1-VH2-L2-VL2- L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH1-L6-VL2-L7- VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VL1-L11- VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-L1-VH2-L2-VL2-L3-VH1-L4-CH1- L5-Fc; VH1 -L6- VH2-L7- VL2-L8- VL 1 -L9-CH1 -L 10-Fc; VH1 -L6- VL2-L7- VH2-L8- VL 1 -L9- CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2- L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 11 - VH2-L 12- VL2- L 13 - VH 1
  • the first polypeptide has a structure represented by VL1-L1- VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1- L6-VH2-L7-VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VH1 -L6- VL2-L7-VH2-L8-VL 1 -L9-CH1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14- CL-L 15-Fc; VH1 -L 16-VH2-L 17-VL2-L 18- VL 1
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8- VLl-L9-CHl-L10-Fc; VHl-L6-VL2-L7-VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12- VH2-L13-VH1-L14-CL-L15-Fc; VL1-L11-VH2-L12-VL2-L13-VH1-L14-CL-L15-Fc; VH1- L 16-VH2-L 17-VL2-L 18- VL 1 -L 19-CL-L20-Fc
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1- LlO-Fc; VHl-L6-VL2-L7-VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1- L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1- Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH 1 -L6- VL2-L7- VH2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL- L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 16
  • the first polypeptide has a structure represented by: VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7- VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VH1-L16- VH2-L 17- VL2-L 18-VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25- CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1-L31-CL-L32-Fc; VL1-L33-VL2-L34- VH2-
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VL1-L1-VH2-L2-VL2- L3-VH1-L4-Fc; or VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1- L8-Fc; wherein the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4- Ll l-VH3-L12-Fc; or VL3-L9-VH4-L10-VL4-L11-VH3-L12-Fc; or VH3-L13-V
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VL1-L1-VH2-L2-VL2- L3-VH1-L4-Fc or VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc or VH1-L5-VL2-L6-VH2-L7-VL1-L8- Fc and the second polypeptide has a structure represented by VL3-L9-VH4-L10-VL4-L11-VH3- L12-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-Fc; or VL1-Ll-VH2-L2-VL2-L3-VH1-L4-Fc or VH1-L5-VH2-L6-VL2-L7- VL1-L8-Fc or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VL1-L1-VH2-L2-VL2- L3-VH1-L4-Fc or VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc or VH1-L5-VL2-L6-VH2-L7-VL1-L8- Fc and the second polypeptide has a structure represented by VH3-L13-VL4-L14-VH4-L15-VL3- L16-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-Fc or VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-Ll l-VH3-L12-Fc or VH3-L13-VH4-L14-VL4- L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VL1-L1- VL2-L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-L9- VL4-L10-VH4-Ll l-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1 -Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VL1-L1-VH2-L2-VL2- L3-VH1-L4-Fc; or VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; or VH1-L5 -VL2-L6-VH2-VL1-L8- Fc; wherein the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11- VH3-L12-Fc; or VL3-L9-VH4-L10-VL4-L11-VH3-L12-Fc; or VH3-L13-VH4-
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3 -VH1 -L4-Fc; VL 1 -L 1 - VH2-L2- VL2-L3 -VH1 -L4-Fc; VH1 -L5-VH2-L6- VL2-L7- VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-VL1-L8-Fc; and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; VL1-L1-VH2-L2-VL2-L3- VH1-L4-Fc; VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-VL1-L8-Fc; and the second polypeptide has a structure represented by VL3-L9-VH4-L10-VL4-Ll l-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3- VH1-L4-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-Fc; VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-VL1-L8-Fc; and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-Fc; VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; or VH1-L5-VL2-L6-VH2-VL1-L8-Fc; and the second polypeptide has a structure represented by VH3-L13-VL4-L14-VH4-L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- Fc or VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc; and the second polypeptide has a structure represented by VL3 -L9- VL4-L 10- VH4-L 11 - VH3 -L 12-Fc or VH3 -L 13 - VH4-L 14- VL4-L 15 - VL3 - L16-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10- VH4-L11-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1- Ll-VL2-L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VH3- L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-Ll l-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL I -LI -VL2-L2-VH2-L3-VH I -L4-CH I -L5-Fc; VL1-L1-VH2-L2-VL2- L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH1-L6-VL2-L7- VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VL1-L11- VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15-Fc; VL
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-L1-VH2-L2-VL2-L3-VH1- L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH1-L6-VL2-L7-VH2-L8- VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VL1-L11-VH2- L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20
  • the first polypeptide has a structure represented by VL1-L1- VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1- L6-VH2-L7-VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VH1 -L6- VL2-L7-VH2-L8-VL 1 -L9-CH1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14- CL-L 15-Fc; VH1 -L 16-VH2-L 17-VL2-L 18- VL 1
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1- LlO-Fc; VHl-L6-VL2-L7-VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1- L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-L1-VH2-L2- VL2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH1-L6-VL2- L7- VH2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VL 1 - L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 - L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14
  • the first polypeptide has a structure represented by VL1-L1- VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1- L6-VH2-L7-VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VH1 -L6- VL2-L7-VH2-L8-VL 1 -L9-CH1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14- CL-L 15-Fc; VH1 -L 16-VH2-L 17-VL2-L 18- VL 1
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1- LlO-Fc; VHl-L6-VL2-L7-VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1- L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-L1-VH2-L2-VL2- L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH1-L6-VL2-L7- VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VL1-L11- VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20
  • the first polypeptide has a structure represented by VL1- Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc;
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2- L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH I -L6-VL2-L7-VH2-L8-VL I -L9-CH I -LI 0-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1- LlO-Fc; VHl-L6-VL2-L7-VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1- L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1- Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH 1 -L6- VL2-L7- VH2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL- L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 16
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-L1-VH2-L2-VL2- L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VH1-L6-VL2-L7- VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VL1-L11- VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18-VL 1 -L 19-CL-L20
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-L1-VH2-L2-VL2-L3-VH1-L4-CH1-L5- Fc; VH1 -L6-VH2-L7-VL2-L8- VL 1 -L9-CH1 -L 10-Fc; VH1 -L6- VL2-L7-VH2-L8-VL 1 -L9-CH1 - LlO-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VL1-L11-VH2-L12-VL2-L13- VH1 -L 14-CL-L 15-Fc; VH1 -L 16-VH2-L 17- VL2-L 18-VL 1 -L 19
  • the first polypeptide has a structure represented by VL1-L1- VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1- L6-VH2-L7-VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VH1 -L6- VL2-L7-VH2-L8-VL 1 -L9-CH1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14- CL-L 15-Fc; VH1 -L 16-VH2-L 17-VL2-L 18- VL 1
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CH1-L5-Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8- VLl-L9-CHl-L10-Fc; VHl-L6-VL2-L7-VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12- VH2-L13-VH1-L14-CL-L15-Fc; VL1-L11-VH2-L12-VL2-L13-VH1-L14-CL-L15-Fc; VH1- L 16-VH2-L 17-VL2-L 18-VL 1 -L 19-CL-L20-Fc
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VL1-Ll-VH2-L2-VL2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1- LlO-Fc; VHl-L6-VL2-L7-VH2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1- L 14-CL-L 15 -Fc; VL 1 -L 11 - VH2-L 12- VL2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-
  • the first polypeptide has a structure represented by: VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1- L6- VH2-L7- VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15- Fc; VH1 -L 16-VH2-L 17-VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 - L24-CH1-L25-CL-L26-Fc; VHl-L27-VH2-L28-VL2-L29-VLl-L30-CHl-L31-CL-L32-Fc;
  • any one of the first polypeptides described herein may be combined with any one of the second, third and/or fourth polypeptides described herein to form an antigen binding polypeptide complex of the invention.
  • the antigen binding polypeptide complex (e.g., antibody or antigen binding fragment thereof) specifically binds to a tumor-associated antigen (TAA).
  • TAA tumor-associated antigen
  • the antigen binding polypeptide complex specifically binds at least one epitope on a TAA.
  • a light chain variable region (VL) and a corresponding heavy chain variable region (VH) of the antigen binding polypeptide complex specifically bind to a TAA.
  • the TAA is A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4, CXCL12, C
  • the antigen binding polypeptide complex comprises a VL1 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CX
  • the VL1 may specifically bind to Trop2.
  • the VL1 may specifically bind to cMet.
  • the VL1 may specifically bind to CD19.
  • the VL1 may specifically bind to CD20.
  • the antigen binding polypeptide complex comprises a VL2 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD
  • the VL2 may specifically bind to CD3.
  • the VL2 may specifically bind to Trop2.
  • the VL2 may specifically bind to cMet.
  • the VL2 may specifically bind to CD19.
  • the VL2 may specifically bind to CD20.
  • the antigen binding polypeptide complex comprises a VL3 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7- 4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CX
  • the VL3 may specifically bind to CD3.
  • the VL3 may specifically bind to Trop2.
  • the VL3 may specifically bind to cMet.
  • the VL3 may specifically bind to CD19.
  • the VL3 may specifically bind to CD20.
  • the antigen binding polypeptide complex comprises a VL4 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3,
  • the VL4 may specifically bind to CD3.
  • the VL4 may specifically bind to Trop2.
  • the VL4 may specifically bind to cMet.
  • the VL4 may specifically bind to CD19.
  • the VL4 may specifically bind to CD20.
  • the antigen binding polypeptide complex comprises a VH1 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3,
  • the VH1 may specifically bind to CD3.
  • the VH1 may specifically bind to Trop2.
  • the VH1 may specifically bind to cMet.
  • the VH1 may specifically bind to CD19.
  • the VH1 may specifically bind to CD20.
  • the antigen binding polypeptide complex comprises a VH2 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3,
  • the VH2 may specifically bind to CD3.
  • the VH2 may specifically bind to Trop2.
  • the VH2 may specifically bind to cMet.
  • the VH2 may specifically bind to CD19.
  • the VH2 may specifically bind to CD20.
  • the antigen binding polypeptide complex comprises a VH3 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3,
  • the VH3 may specifically bind to CD3.
  • the VH3 may specifically bind to Trop2.
  • the VH3 may specifically bind to cMet.
  • the VH3 may specifically bind to CD19.
  • the VH3 may specifically bind to CD20.
  • the antigen binding polypeptide complex comprises a VH4 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3,
  • the VH4 may specifically bind to CD3.
  • the VH4 may specifically bind to Trop2.
  • the VH4 may specifically bind to cMet.
  • the VH4 may specifically bind to CD19.
  • the VH4 may specifically bind to CD20.
  • the antigen binding polypeptide comprises a VH1 and VL1 that specifically binds to cMet, a VH2 and VL2 that specifically binds to Trop2, a VH3 and VL3 that specifically binds to CD28, and a VH4 and VL4 that specifically binds to CD3.
  • the antigen binding polypeptide comprises a VH1 and VL1 that specifically binds to Trop2, a VH2 and VL2 that specifically binds to cMet, a VH3 and VL3 that specifically binds to CD28, and a VH4 and VL4 that specifically binds to CD3.
  • the antigen binding polypeptide comprises a VH1 and VL1 that specifically binds to cMet, a VH2 and VL2 that specifically binds to CD28, a VH3 and VL3 that specifically binds to Trop2, and a VH4 and VL4 that specifically binds to CD3.
  • the antigen binding polypeptide comprises a VH1 and VL1 that specifically binds to Trop2, a VH2 and VL2 that specifically binds to CD28, a VH3 and VL3 that specifically binds to cMet, and a VH4 and VL4 that specifically binds to CD3.
  • the antigen binding polypeptide comprises a VH1 and VL1 that specifically binds to CD28, a VH2 and VL2 that specifically binds to cMet, a VH3 and VL3 that specifically binds to Trop2, and VH4 and VL4 that specifically binds to CD3.
  • the antigen binding polypeptide comprises a VH1 and VL1 that specifically binds to CD28, a VH2 and VL2 that specifically binds to Trop2, a VH3 and VL3 that specifically binds to cMet, and VH4 and VL4 that specifically binds to CD3.
  • the antigen binding polypeptide comprises a VH1 and VL1 that specifically binds to CD 19, a VH2 and VL2 that specifically binds to CD20, a VH3 and VL3 that specifically binds to CD28, and VH4 and VL4 that specifically binds to CD3.
  • the antigen binding polypeptide comprises a VH1 and VL1 that specifically binds to CD20, a VH2 and VL2 that specifically binds to CD 19, a VH3 and VL3 that specifically binds to CD28, and VH4 and VL4 that specifically binds to CD3.
  • the antigen binding polypeptide comprises a VH1 and VL1 that specifically binds to CD 19, a VH2 and VL2 that specifically binds to CD28, a VH3 and VL3 that specifically binds to CD20, and VH4 and VL4 that specifically binds to CD3.
  • the antigen binding polypeptide comprises a VH1 and VL1 that specifically binds to CD20, a VH2 and VL2 that specifically binds to CD28, a VH3 and VL3 that specifically binds to CD 19, and VH4 and VL4 that specifically binds to CD3.
  • the antigen binding polypeptide comprises a VH1 and VL1 that specifically binds to CD28, a VH2 and VL2 that specifically binds to CD 19, a VH3 and VL3 that specifically binds to CD20, and VH4 and VL4 that specifically binds to CD3.
  • the antigen binding polypeptide comprises a VH1 and VL1 that specifically binds to CD28, a VH2 and VL2 that specifically binds to CD20, a VH3 and VL3 that specifically binds to CD 19, and VH4 and VL4 that specifically binds to CD3.
  • VH1 and VL1 that specifically binds to CD28
  • VH2 and VL2 that specifically binds to CD20
  • VH3 and VL3 that specifically binds to CD 19
  • VH4 and VL4 that specifically binds to CD3.
  • an antigen binding polypeptide complex of the invention comprises a VL that specifically binds to a TAA, the VL having a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:67, 75, 83, 91, 107, 115, 123, 131, 385, 405, 415, 441, 452, 462, 472, 655, 691, 727, 393, 486, 504, 536, 548, 753, 789, 825, 871, 879, 490, 496, 745, 781, 817, 645, 681, 771, 843, 621, 637, 673, 709 and 871; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:68, 76, 84, 92, 108, 116, 124, 132, 386 (YTS);
  • the VL that specifically binds to CD38 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 67; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:68; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:69; and the VH that specifically binds to CD38 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:64; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 65; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:66.
  • the VL that specifically binds to cMet comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:75; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:76; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:77; and the VH that specifically binds to cMet comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:72; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:73; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:74.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:83; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:84; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:85; and the VH that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:80; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:81; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:82.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:91; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:92; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:93; and the VH that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:88; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:89; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:90.
  • the VL that specifically binds to CD3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:99; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 100; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 101; and the VH that specifically binds to CD3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:96; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:97; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:98.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 107 a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 108; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 109; and the VH that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 104; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 105; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 106.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 115; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 116; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 117; and the VH that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 112; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:113; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 114.
  • the VL that specifically binds to CD19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 123; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 124; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 125; and the VH that specifically binds to CD 19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 120; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 121; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 122.
  • the VL that specifically binds to CD19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 131; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 132; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 133; and the VH that specifically binds to CD19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 128; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 129; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 130.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 385; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:386 (YTS); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:387; and the VH that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:389; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:390; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:391.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 405; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:406 (YTS); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:407; and the VH that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:409; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NON 10; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:411.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 415; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:416 (YTS); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:417; and the VH that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:419; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:420; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:421.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 441; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:442 (YTS); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:443; and the VH that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:429; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:430; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:431.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 452; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:453 (YTS); and a C
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 462; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:463 (YTS); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:464; and the VH that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:429; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:430; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:431.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 472; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:473 (YTS); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:474; and the VH that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:429; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:430; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:431.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 655; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:656; and a CDR3 compris
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 691; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:692; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:693; and the VH that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:695; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:696; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:697.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 727; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:728; and a CDR3 comprising
  • the VL that specifically binds to HER2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 393; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:394; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:395; and the VH that specifically binds to HER2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:397; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:398; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:399.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 486; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:487 (AT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:488; and the VH that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:508; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:509; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:510.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 504; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:505 (AT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:506; and the VH that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:508; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:509; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:510.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 536; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:537; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:538; and the VH that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:540; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:541; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:542.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:548; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:549; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:550; and the VH that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:552; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:553; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 554.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 753; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:754; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 755; and the VH that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:757; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:758; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:759.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 789; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:790; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:791; and the VH that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:793; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:794; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:795.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 825; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:826; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 827; and the VH that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:829; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:830; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:831.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 871; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:872; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:873; and the VH that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 879; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:880; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:881; and the VH that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:875; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:876; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:877.
  • the VL that specifically binds to CD 19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 490; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:491 (AT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:492; and the VH that specifically binds to CD19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:500; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:501; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 502.
  • the VL that specifically binds to CD 19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 496; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:497 (AT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:498; and the VH that specifically binds to CD19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:500; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:501; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:502.
  • the VL that specifically binds to CD 19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 745; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 746; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:747; and the VH that specifically binds to CD 19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:749; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:750; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:751.
  • the VL that specifically binds to CD19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 781; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 782; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:783; and the VH that specifically binds to CD 19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:785; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:786; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:787.
  • the VL that specifically binds to CD19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 817; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:818; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:819; and the VH that specifically binds to CD 19 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 821; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:822; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 823.
  • the VL that specifically binds to CD28 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 645; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:646; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:647; and the VH that specifically binds to CD28 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:649; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 650; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 651.
  • the VL that specifically binds to CD28 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 681; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:682; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:683; and the VH that specifically binds to CD28 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:685; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:686; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 687.
  • the VL that specifically binds to CD28 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 771; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:772; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:773; and the VH that specifically binds to CD28 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:775; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:776; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:777.
  • the VL that specifically binds to CD28 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 843; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:844; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:845; and the VH that specifically binds to CD28 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:847; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:848; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:849.
  • the VL that specifically binds to BCMA comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 621; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:622; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 623; and the VH that specifically binds to BCMA comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:625; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:626; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:627.
  • the VL that specifically binds to cMet comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 637; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:638; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:639; and the VH that specifically binds to cMet comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:641; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:642; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:643.
  • the VL that specifically binds to cMet comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 673; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:674; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:675; and the VH that specifically binds to cMet comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:677; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:678; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:679.
  • the VL that specifically binds to cMet comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 709; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:710; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:711; and the VH that specifically binds to cMet comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:713; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:714; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:715.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 871; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:872; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:873; and the VH that specifically binds to CD20 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:867; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:868; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:869.
  • the VL that specifically binds to CD38 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:67; a CDR2 comprising the amino acid sequence of SEQ ID NO:68; and a CDR3 comprising the amino acid sequence of SEQ ID NO:69; and the VH that specifically binds to CD38 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:64; a CDR2 comprising the amino acid sequence of SEQ ID NO:65; and a CDR3 comprising the amino acid sequence of SEQ ID NO:66.
  • the VL that specifically binds to cMet comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:75; a CDR2 comprising the amino acid sequence of SEQ ID NO:76; and a CDR3 comprising the amino acid sequence of SEQ ID NO:77; and the VH that specifically binds to cMet comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:72; a CDR2 comprising the amino acid sequence of SEQ ID NO:73; and a CDR3 comprising the amino acid sequence of SEQ ID NO:74.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:83; a CDR2 comprising the amino acid sequence of SEQ ID NO:84; and a CDR3 comprising the amino acid sequence of SEQ ID NO:85; and the VH that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:80; a CDR2 comprising the amino acid sequence of SEQ ID NO:81; and a CDR3 comprising the amino acid sequence of SEQ ID NO:82.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:91; a CDR2 comprising the amino acid sequence of SEQ ID NO:92; and a CDR3 comprising the amino acid sequence of SEQ ID NO:93; and the VH that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:88; a CDR2 comprising the amino acid sequence of SEQ ID NO:89; and a CDR3 comprising the amino acid sequence of SEQ ID NOVO.
  • the VL that specifically binds to CD3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 99; a CDR2 comprising the amino acid sequence of SEQ ID NO: 100; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 101; and the VH that specifically binds to CD3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:96; a CDR2 comprising the amino acid sequence of SEQ ID NO:97; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 98.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 107; a CDR2 comprising the amino acid sequence of SEQ ID NO: 108; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 109; and the VH that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 104; a CDR2 comprising the amino acid sequence of SEQ ID NO: 105; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 106.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 115; a CDR2 comprising the amino acid sequence of SEQ ID NO: 116; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 117; and the VH that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 112; a CDR2 comprising the amino acid sequence of SEQ ID NO: 113; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 114.
  • the VL that specifically binds to CD19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 123; a CDR2 comprising the amino acid sequence of SEQ ID NO: 124; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 125; and the VH that specifically binds to CD19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 120; a CDR2 comprising the amino acid sequence of SEQ ID NO: 121; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 122.
  • the VL that specifically binds to CD19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 131; a CDR2 comprising the amino acid sequence of SEQ ID NO: 132; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 133; and the VH that specifically binds to CD 19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 128; a CDR2 comprising the amino acid sequence of SEQ ID NO: 129; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 130.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 385; a CDR2 comprising the amino acid sequence of SEQ ID NO:386 (YTS); and a CDR3 comprising the amino acid sequence of SEQ ID NO:387; and the VH that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:389; a CDR2 comprising the amino acid sequence of SEQ ID NO:390; and a CDR3 comprising the amino acid sequence of SEQ ID NO:391.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 405; a CDR2 comprising the amino acid sequence of SEQ ID NO:406 (YTS); and a CDR3 comprising the amino acid sequence of SEQ ID NO:407; and the VH that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:409; a CDR2 comprising the amino acid sequence of SEQ ID NO:410; and a CDR3 comprising the amino acid sequence of SEQ ID NO:411.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 415; a CDR2 comprising the amino acid sequence of SEQ ID NO:416 (YTS); and a CDR3 comprising the amino acid sequence of SEQ ID NO:417; and the VHthat specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:419; a CDR2 comprising the amino acid sequence of SEQ ID NO:420; and a CDR3 comprising the amino acid sequence of SEQ ID NO:421.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 441; a CDR2 comprising the amino acid sequence of SEQ ID NO:442 (YTS); and a CDR3 comprising the amino acid sequence of SEQ ID NO:443; and the VH that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:429; a CDR2 comprising the amino acid sequence of SEQ ID NO:430; and a CDR3 comprising the amino acid sequence of SEQ ID NO:431.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 452; a CDR2 comprising the amino acid sequence of SEQ ID NO:453 (YTS); and a CDR3 comprising the amino acid sequence of SEQ ID NO:454; and the VHthat specifically binds to Trop2 comprises a CDR1 comprising the amino acid
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 462; a CDR2 comprising the amino acid sequence of SEQ ID NO:463 (YTS); and a CDR3 comprising the amino acid sequence of SEQ ID NO:464; and the VH that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:429; a CDR2 comprising the amino acid sequence of SEQ ID NO:430; and a CDR3 comprising the amino acid sequence of SEQ ID NO:431.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 472; a CDR2 comprising the amino acid sequence of SEQ ID NO:473 (YTS); and a CDR3 comprising the amino acid sequence of SEQ ID NO:474; and the VHthat specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:429; a CDR2 comprising the amino acid sequence of SEQ ID NO:430; and a CDR3 comprising the amino acid sequence of SEQ ID NO:431.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 655; a CDR2 comprising the amino acid sequence of SEQ ID NO:656; and a CDR3 the amino acid sequence of SEQ ID NO:657; and the VH that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 655;
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 691; a CDR2 comprising the amino acid sequence of SEQ ID NO:692; and a CDR3 comprising the amino acid sequence of SEQ ID NO:693; and the VH that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:695; a CDR2 comprising the amino acid sequence of SEQ ID NO:696; and a CDR3 comprising the amino acid sequence of SEQ ID NO:697.
  • the VL that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 727; a CDR2 comprising the amino acid sequence of SEQ ID NO:728; and a CDR3 comprising the amino acid sequence of SEQ ID NO:729; and the VH that specifically binds to Trop2 comprises a CDR1 comprising the amino acid sequence of SEQ
  • the VL that specifically binds to HER2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 393; a CDR2 comprising the amino acid sequence of SEQ ID NO:394; and a CDR3 comprising the amino acid sequence of SEQ ID NO:395; and the VH that specifically binds to HER2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:397; a CDR2 comprising the amino acid sequence of SEQ ID NO:398; and a CDR3 comprising the amino acid sequence of SEQ ID NO:399.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 486; a CDR2 comprising the amino acid sequence of SEQ ID NO:487 (AT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:488; and the VH that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:508; a CDR2 comprising the amino acid sequence of SEQ ID NO:509; and a CDR3 comprising the amino acid sequence of SEQ ID NO:510.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 504; a CDR2 comprising the amino acid sequence of SEQ ID NO:505 (AT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:506; and the VH that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:508; a CDR2 comprising the amino acid sequence of SEQ ID NO:509; and a CDR3 comprising the amino acid sequence of SEQ ID NO:510.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 536; a CDR2 comprising the amino acid sequence of SEQ ID NO:537; and a CDR3 comprising the amino acid sequence of SEQ ID NO:538; and the VH that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:540; a CDR2 comprising the amino acid sequence of SEQ ID NO:541; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 542.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 548; a CDR2 comprising the amino acid sequence of SEQ ID NO:549; and a CDR3 comprising the amino acid sequence of SEQ ID NO:550; and the VH that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:552; a CDR2 comprising the amino acid sequence of SEQ ID NO:553; and a CDR3 comprising the amino acid sequence of SEQ ID NO:554.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 753; a CDR2 comprising the amino acid sequence of SEQ ID NO:754; and a CDR3 comprising the amino acid sequence of SEQ ID NO:755; and the VH that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:757; a CDR2 comprising the amino acid sequence of SEQ ID NO:758; and a CDR3 comprising the amino acid sequence of SEQ ID NO:759.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 789; a CDR2 comprising the amino acid sequence of SEQ ID NO:790; and a CDR3 comprising the amino acid sequence of SEQ ID NO:791; and the VH that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:793; a CDR2 comprising the amino acid sequence of SEQ ID NO:794; and a CDR3 comprising the amino acid sequence of SEQ ID NO:795.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 825; a CDR2 comprising the amino acid sequence of SEQ ID NO:826; and a CDR3 comprising the amino acid sequence of SEQ ID NO:827; and the VH that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:829; a CDR2 comprising the amino acid sequence of SEQ ID NO:830; and a CDR3 comprising the amino acid sequence of SEQ ID NO:831.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 871; a CDR2 comprising the amino acid sequence of SEQ ID NO:872; and a CDR3 comprising the amino acid sequence of SEQ ID NO:873.
  • the VL that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 879; a CDR2 comprising the amino acid sequence of SEQ ID NO:880; and a CDR3 comprising the amino acid sequence of SEQ ID NO:881; and the VH that specifically binds to CD20 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:875; a CDR2 comprising the amino acid sequence of SEQ ID NO:876; and a CDR3 comprising the amino acid sequence of SEQ ID NO:877.
  • the VL that specifically binds to CD19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 490; a CDR2 comprising the amino acid sequence of SEQ ID NO:491 (AT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:492; and the VH that specifically binds to CD19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:500; a CDR2 comprising the amino acid sequence of SEQ ID NO:501; and a CDR3 comprising the amino acid sequence of SEQ ID NO:502.
  • the VL that specifically binds to CD 19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 496; a CDR2 comprising the amino acid sequence of SEQ ID NO:497 (AT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:498; and the VH that specifically binds to CD19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:500; a CDR2 comprising the amino acid sequence of SEQ ID NO:501; and a CDR3 comprising the amino acid sequence of SEQ ID NO:502.
  • the VL that specifically binds to CD19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 745; a CDR2 comprising the amino acid sequence of SEQ ID NO: 746; and a CDR3 comprising the amino acid sequence of SEQ ID NO:747; and the VH that specifically binds to CD19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:749; a CDR2 comprising the amino acid sequence of SEQ ID NO:750; and a CDR3 comprising the amino acid sequence of SEQ ID NO:751.
  • the VL that specifically binds to CD19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 781; a CDR2 comprising the amino acid sequence of SEQ ID NO: 782; and a CDR3 comprising the amino acid sequence of SEQ ID NO:783; and the VH that specifically binds to CD19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:785; a CDR2 comprising the amino acid sequence of SEQ ID NO:786; and a CDR3 the amino acid sequence of SEQ ID NO:787.
  • the VL that specifically binds to CD 19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 817; a CDR2 comprising the amino acid sequence of SEQ ID NO:818; and a CDR3 comprising the amino acid sequence of SEQ ID NO:819; and the VH that specifically binds to CD 19 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:821; a CDR2 comprising the amino acid sequence of SEQ ID NO: 822; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 823.
  • the VL that specifically binds to CD28 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 645; a CDR2 comprising the amino acid sequence of SEQ ID NO:646; and a CDR3 comprising the amino acid sequence of SEQ ID NO:647; and the VH that specifically binds to CD28 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:649; a CDR2 comprising the amino acid sequence of SEQ ID NO: 650; and a CDR3 comprising the amino acid sequence of SEQ ID NO:651.
  • the VL that specifically binds to CD28 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 681; a CDR2 comprising the amino acid sequence of SEQ ID NO:682; and a CDR3 comprising the amino acid sequence of SEQ ID NO:683; and the VH that specifically binds to CD28 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:685; a CDR2 comprising the amino acid sequence of SEQ ID NO:686; and a CDR3 comprising the amino acid sequence of SEQ ID NO:687.
  • the VL that specifically binds to CD28 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 771; a CDR2 comprising the amino acid sequence of SEQ ID NO:772; and a CDR3 comprising the amino acid sequence of SEQ ID NO:773; and the VH that specifically binds to CD28 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:775; a CDR2 comprising the amino acid sequence of SEQ ID NO:776; and a CDR3 comprising the amino acid sequence of SEQ ID NO:777.
  • the VL that specifically binds to CD28 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 843; a CDR2 comprising the amino acid sequence of SEQ ID NO:844; and a CDR3 comprising the amino acid sequence of SEQ ID NO:845; and the VH that specifically binds to CD28 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:847; a CDR2 comprising the amino acid sequence of SEQ ID NO:848; and a CDR3 comprising the amino acid sequence of SEQ ID NO:849.
  • the VL that specifically binds to BCMA comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 621; a CDR2 comprising the amino acid sequence of SEQ ID NO:622; and a CDR3 comprising the amino acid sequence of SEQ ID NO:623; and the VH that specifically binds to BCMA comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:625; a CDR2 comprising the amino acid sequence of SEQ ID NO:626; and a CDR3 comprising the amino acid sequence of SEQ ID NO:627.
  • the VL that specifically binds to cMet comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 637; a CDR2 comprising the amino acid sequence of SEQ ID NO:638; and a CDR3 comprising the amino acid sequence of SEQ ID NO:639; and the VH that specifically binds to cMet comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:641; a CDR2 comprising the amino acid sequence of SEQ ID NO: 642; and a CDR3 comprising the amino acid sequence of SEQ ID NO:643.
  • the VL that specifically binds to cMet comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 673; a CDR2 comprising the amino acid sequence of SEQ ID NO:674; and a CDR3 comprising the amino acid sequence of SEQ ID NO:675; and the VH that specifically binds to cMet comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:677; a CDR2 comprising the amino acid sequence of SEQ ID NO:678; and a CDR3 comprising the amino acid sequence of SEQ ID NO:679.
  • the VL that specifically binds to cMet comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 709; a CDR2 comprising the amino acid sequence of SEQ ID NO:710; and a CDR3 comprising the amino acid sequence of SEQ ID NO:711; and the VH that specifically binds to cMet comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:713; a CDR2 comprising the amino acid sequence of SEQ ID NO:714; and a CDR3 comprising the amino acid sequence of SEQ ID NO:715.
  • the VL that specifically binds to the TAA comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:71, 79, 87, 95, 103, 111, 119, 127, 135, 384, 404, 414, 440, 451, 461, 471, 583, 654, 690, 726, 392, 402, 485, 503, 535, 547, 752, 788, 824, 882, 870, 878, 489, 495, 543, 555, 744, 780, 816, 527, 644, 680, 770, 842, 620, 636, 672 and 708; and the VH that specifically binds to the TAA comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:70, 78, 86, 94, 102, 110,
  • the VL that specifically binds to CD38 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:71; and the VH that specifically binds to CD38 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:70.
  • the VL that specifically binds to cMet comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:79; and the VH that specifically binds to cMet comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:78.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 87; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:86.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:95; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:94.
  • the VL that specifically binds to CD3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 103; and the VH that specifically binds to CD3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 102.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 111; and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 110.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:119; and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:118.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 111; and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 118.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 119; and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 110.
  • the VL that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 127; and the VH that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 126.
  • the VL that specifically binds to CD19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 135 or 882; and the VH that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 134 or 883.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 384; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 388.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 404; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 408.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 414; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 418.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 440; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 428.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 451; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 428.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 461; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 428.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 471; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 428.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 583; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 584.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 654; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 658.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 690; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 694.
  • the VL that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 726; and the VH that specifically binds to Trop2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 730.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 485; and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 507.
  • the VL that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 489; and the VH that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 499.
  • the VL that specifically binds to HER2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 392; and the VH that specifically binds to HER2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 396.
  • the VL that specifically binds to HER2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 402; and the VH that specifically binds to HER2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 403.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 503; and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 507.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 535; and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 539.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 547; and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 551.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 752; and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 756.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 788; and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 792.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 824; and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 828.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 878; and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 874.
  • the VL that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 495; and the VH that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 499.
  • the VL that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 543; and the VH that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 544.
  • the VL that specifically binds to CD19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 555; and the VH that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 556.
  • the VL that specifically binds to CD19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 744; and the VH that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 748.
  • the VL that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 780; and the VH that specifically binds to CD19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 784.
  • the VL that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 816; and the VH that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 820.
  • the VL that specifically binds to CD28 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 527; and the VH that specifically binds to CD28 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 528.
  • the VL that specifically binds to CD28 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 644; and the VH that specifically binds to CD28 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 648.
  • the VL that specifically binds to CD28 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 680; and the VH that specifically binds to CD28 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 684.
  • the VL that specifically binds to CD28 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 770; and the VH that specifically binds to CD28 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 774.
  • the VL that specifically binds to CD28 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 842; and the VH that specifically binds to CD28 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 846.
  • the VL that specifically binds to BCMA comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 620; and the VH that specifically binds to BCMA comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 624.
  • the VL that specifically binds to cMet comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 636; and the VH that specifically binds to cMet comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 640.
  • the VL that specifically binds to cMet comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 672; and the VH that specifically binds to cMet comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 676.
  • the VL that specifically binds to cMet comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 708; and the VH that specifically binds to cMet comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 712.
  • the VL that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 870 and the VH that specifically binds to CD20 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 866.
  • the VL that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to DIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQQIPGQPPKLLIYDASNLVS GIPPRFSGSGSGTDFTLNIHPVEKVDAATYHCQQSTEDPWTFGGGTKLEIK (SEQ ID NO: 882) and the VH that specifically binds to CD 19 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to
  • the antigen binding polypeptide complex (e.g., antibody or antigen binding fragment thereof) of the invention specifically binds to CD3.
  • the antigen binding polypeptide complex specifically binds to CD3 and one or more TAAs, such as, e.g., A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80,
  • TAAs such as,
  • Antigen binding sequences for A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25,, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1
  • sequences for CD3, CD 19, CD28, and CD38 are well known and include, but are not limited to, GenBank Accession Nos. AAA39272.1, AAA39159.1, ABN79462.1, AVW80143.1, AVW80142.1, AVW80141.1, AAB34430.1, AAB34429.1, CAD45042.1, 4CMH C and 4CMH B.
  • a VL and a corresponding VH of the antigen binding polypeptide complex specifically bind to CD3. In some aspects, one VL and one corresponding VH of the antigen binding polypeptide complex specifically bind to CD3. In some aspects, VL3 and VH3 specifically bind to CD3.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:35, 44, 99, 446, 456, 466, 476, 520, 663, 699, 735, 763, 799, 835, 855 and 863; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:36, 45, 100, 447 (DT), 457 (DT), 467 (DT), 477 (DT), 521, 664, 700, 736, 764, 800, 836, 856 and 864; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:37, 46, 101, 448, 458, 468, 478, 522, 665, 701, 737, 765, 801, 837, 857 and 865; and
  • a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NO:33, 41, 97, 434, 525, 668, 704, 740, 768, 804, 840, 852 and 860; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:34, 42, 98, 435, 526, 669, 705, 741, 769, 805, 841, 853 and 861.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:35; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:36; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:37; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:32; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:33; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:34.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:44; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:45; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:46; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:40; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:41; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:42.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:446; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:447 (DT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:448; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:433; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:434; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:435.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:456; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:457 (DT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:458; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:433; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:434; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:435.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:466; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:467 (DT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:468; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:433; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:434; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:435.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:476; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:477 (DT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:478; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:433; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:434; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:435.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:520; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:521; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:522; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:524; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:525; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:526.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 663; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:664; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:665; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:667; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:668; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:669.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:699; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 700; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:701; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:703; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:704; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:705.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 735; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:736; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:737 and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:739; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:740; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:741.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:763; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:764; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:765; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:767; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:768; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:769.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:799; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:800; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:801; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:803; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:804; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:805.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:835; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:836 and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:837; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:839; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:840; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:841.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:855; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:856; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:857; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:851; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:852; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:853.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:863; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 864; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:865; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:859 a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:860; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:861.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 99; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 100; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 100; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:96 a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:97; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:98.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:35; a CDR2 comprising the amino acid sequence of SEQ ID NO:36; and a CDR3 comprising the amino acid sequence of SEQ ID NO:37; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:32; a CDR2 comprising the amino acid sequence of SEQ ID NO:33; and a CDR3 comprising the amino acid sequence of SEQ ID NO:34.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:44; a CDR2 comprising the amino acid sequence of SEQ ID NO:45; and a CDR3 comprising the amino acid sequence of SEQ ID NO:46; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:40; a CDR2 comprising the amino acid sequence of SEQ ID NO:41; and a CDR3 comprising the amino acid sequence of SEQ ID NO:42.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:446; a CDR2 comprising the amino acid sequence of SEQ ID NO:447 (DT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:448; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:433; a CDR2 comprising the amino acid sequence of SEQ ID NO:434; and a CDR3 comprising the amino acid sequence of SEQ ID NO:435.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:456; a CDR2 comprising the amino acid sequence of SEQ ID NO:457 (DT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:458; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:433; a CDR2 comprising the amino acid sequence of SEQ ID NO:434; and a CDR3 comprising the amino acid sequence of SEQ ID NO:435.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:466; a CDR2 comprising the amino acid sequence of SEQ ID NO:467 (DT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:468; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:433; a CDR2 comprising the amino acid sequence of SEQ ID NO:434; and a CDR3 comprising the amino acid sequence of SEQ ID NO:435.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:476; a CDR2 comprising the amino acid sequence of SEQ ID NO:477 (DT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:478; and VH3 comprises a CDR1 the amino acid sequence of SEQ ID NO:433; a CDR2 comprising the amino acid sequence of SEQ ID NO:434; and a CDR3 comprising the amino acid sequence of SEQ ID NO:435.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:520; a CDR2 comprising the amino acid sequence of SEQ ID NO:521; and a CDR3 comprising the amino acid sequence of SEQ ID NO:522; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 524; a CDR2 comprising the amino acid sequence of SEQ ID NO: 525; and a CDR3 comprising the amino acid sequence of SEQ ID NO:526.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:663; a CDR2 comprising the amino acid sequence of SEQ ID NO:664; and a CDR3 comprising the amino acid sequence of SEQ ID NO:665; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:667; a CDR2 comprising the amino acid sequence of SEQ ID NO:668; and a CDR3 comprising the amino acid sequence of SEQ ID NO:669.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:699; a CDR2 comprising the amino acid sequence of SEQ ID NO: 700; and a CDR3 comprising the amino acid sequence of SEQ ID NO:701; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:703; a CDR2 comprising the amino acid sequence of SEQ ID NO:704; and a CDR3 comprising the amino acid sequence of SEQ ID NO:705.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:735; a CDR2 comprising the amino acid sequence of SEQ ID NO: 736; and a CDR3 comprising the amino acid sequence of SEQ ID NO:737 and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:739; a CDR2 comprising the amino acid sequence of SEQ ID NO:740; and a CDR3 comprising the amino acid sequence of SEQ ID NO:741.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:763; a CDR2 comprising the amino acid sequence of SEQ ID NO:764; and a CDR3 comprising the amino acid sequence of SEQ ID NO:765; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:767; a CDR2 the amino acid sequence of SEQ ID NO:768; and a CDR3 comprising the amino acid sequence of SEQ ID NO:769.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:799; a CDR2 comprising the amino acid sequence of SEQ ID NO:800; and a CDR3 comprising the amino acid sequence of SEQ ID NO:801; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:803; a CDR2 comprising the amino acid sequence of SEQ ID NO:804; and a CDR3 comprising the amino acid sequence of SEQ ID NO:805.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:835; a CDR2 comprising the amino acid sequence of SEQ ID NO:836 and a CDR3 comprising the amino acid sequence of SEQ ID NO:837; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:839; a CDR2 comprising the amino acid sequence of SEQ ID NO:840; and a CDR3 comprising the amino acid sequence of SEQ ID NO:841.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:855; a CDR2 comprising the amino acid sequence of SEQ ID NO:856; and a CDR3 comprising the amino acid sequence of SEQ ID NO:857; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 851; a CDR2 comprising the amino acid sequence of SEQ ID NO:852; and a CDR3 comprising the amino acid sequence of SEQ ID NO:853.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:863; a CDR2 comprising the amino acid sequence of SEQ ID NO: 864; and a CDR3 comprising the amino acid sequence of SEQ ID NO:865; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:859 a CDR2 comprising the amino acid sequence of SEQ ID NO:860; and a CDR3 comprising the amino acid sequence of SEQ ID NO:861.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:99; a CDR2 comprising the amino acid sequence of SEQ ID NO: 100; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 101; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:96; a CDR2 comprising the amino acid sequence of SEQ ID NO:97; and a CDR3 comprising the amino acid sequence of SEQ ID NO:98.
  • "at least 90% identity” includes at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and 100% identity to the recited reference sequence.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:35; a CDR2 comprising the amino acid sequence of SEQ ID NO:36; and a CDR3 comprising the amino acid sequence of SEQ ID NO:37; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:32; a CDR2 comprising the amino acid sequence of SEQ ID NO:33; and a CDR3 comprising the amino acid sequence of SEQ ID NO:34.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:44; a CDR2 comprising the amino acid sequence of SEQ ID NO:45; and a CDR3 comprising the amino acid sequence of SEQ ID NO:46; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:40; a CDR2 comprising the amino acid sequence of SEQ ID NO:41; and a CDR3 comprising the amino acid sequence of SEQ ID NO:42.
  • VL3 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:39, 47, 103, 422, 445, 455, 465, 475, 519, 662, 698, 734, 762, 798, 834, 854 and 862; and/or VH3 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:38, 43, 102, 423, 432, 523, 666, 702, 738, 766, 802, 838, 850 and 858.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:39; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:38.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:47; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:43.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:39; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:43.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:47; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:38.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:422; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:423.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:445; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:432.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:455; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:432.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:465; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:432.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:475; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:432.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:519; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:523.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:662; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:666.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:698; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:702.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:734; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:738.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:762; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:766.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:798; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:802.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:834; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 838.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:854; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:850.
  • VL4 and VH4 specifically bind to CD3.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:35, 44, 99, 446, 456, 466, 476, 520, 663, 699, 735, 763, 799, 835, 855 and 863; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:36, 45, 100, 447 (DT), 457 (DT), 467 (DT), 477 (DT), 521, 664, 700, 736, 764, 800, 836, 856 and 864; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:37, 46, 101, 448, 458, 468, 478, 522, 665
  • a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:33, 41, 97, 434, 525, 668, 704, 740, 768, 804, 840, 852 and 860; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:34, 42, 98, 435, 526, 669, 705, 741, 769, 805, 841, 853 and 861.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:35; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:36; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:37; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:32; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:33; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:34.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:44; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:45; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:46; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:40; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:41; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:42.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:446; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:447 (DT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:448; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:433; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:434; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:435.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:456; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:457 (DT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:458; and VH4 comprises a CDR1 - I l l - comprising an amino acid sequence having at least 90% identity to SEQ ID NO:433; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:434; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:435.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:466; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:467 (DT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:468; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:433; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:434; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:435.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:476; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:477 (DT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:478; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:433; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:434; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:435.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 520; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:521; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:522; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:524; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:525; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:526.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:663; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:664; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:665; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:667; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:668; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:669.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 699; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 700; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:701; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:703; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:704; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:705.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:735; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:736; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:737 and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:739; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:740; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:741.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:763; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:764; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:765; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:767; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:768; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:769.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:799; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:800; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:801; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:803; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:804; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:805.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 835; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:836 and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:837; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:839; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:840; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:841.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:855; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:856; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:857; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:851; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:852; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:853.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 863; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 864; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:865; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:859 a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:860; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:861.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:99; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 100; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 101; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:96; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:97; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:98.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:35; a CDR2 comprising the amino acid sequence of SEQ ID NO:36; and a CDR3 comprising the amino acid sequence of SEQ ID NO:37; a"d VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:32; a CDR2 comprising the amino acid sequence of SEQ ID NO:33; and a CDR3 comprising the amino acid sequence of SEQ ID NO:34.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:44; a CDR2 comprising the amino acid sequence of SEQ ID NO:45; and a CDR3 comprising the amino acid sequence of SEQ ID NO:46; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:40; a CDR2 comprising the amino acid sequence of SEQ ID NO:41; and a CDR3 comprising the amino acid sequence of SEQ ID NO:42.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:446; a CDR2 comprising the amino acid sequence of SEQ ID NO:447 (DT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:448; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:433; a CDR2 comprising the amino acid sequence of SEQ ID NO:434; and a CDR3 comprising the amino acid sequence of SEQ ID NO:435.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:456; a CDR2 comprising the amino acid sequence of SEQ ID NO:457 (DT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:458; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:433; a CDR2 comprising the amino acid sequence of SEQ ID NO:434; and a CDR3 comprising the amino acid sequence of SEQ ID NO:435.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:466; a CDR2 comprising the amino acid sequence of SEQ ID NO:467 (DT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:468; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:433; a CDR2 comprising the amino acid sequence of SEQ ID NO:434; and a CDR3 comprising the amino acid sequence of SEQ ID NO:435.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:476; a CDR2 comprising the amino acid sequence of SEQ ID NO:477 (DT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:478; and VH4 comprises a CDR1 the amino acid sequence of SEQ ID NO:433; a CDR2 comprising the amino acid sequence of SEQ ID NO:434; and a CDR3 comprising the amino acid sequence of SEQ ID NO:435.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:520; a CDR2 comprising the amino acid sequence of SEQ ID NO:521; and a CDR3 comprising the amino acid sequence of SEQ ID NO:522; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:524; a CDR2 comprising the amino acid sequence of SEQ ID NO:525; and a CDR3 comprising the amino acid sequence of SEQ ID NO:526.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:663; a CDR2 comprising the amino acid sequence of SEQ ID NO:664; and a CDR3 comprising the amino acid sequence of SEQ ID NO:665; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:667; a CDR2 comprising the amino acid sequence of SEQ ID NO:668; and a CDR3 comprising the amino acid sequence of SEQ ID NO:669.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:699; a CDR2 comprising the amino acid sequence of SEQ ID NO: 700; and a CDR3 comprising the amino acid sequence of SEQ ID NO:701; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:703; a CDR2 comprising the amino acid sequence of SEQ ID NO:704; and a CDR3 comprising the amino acid sequence of SEQ ID NO:705.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:735; a CDR2 comprising the amino acid sequence of SEQ ID NO:736; and a CDR3 comprising the amino acid sequence of SEQ ID NO:737 and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:739; a CDR2 comprising the amino acid sequence of SEQ ID NO:740; and a CDR3 comprising the amino acid sequence of SEQ ID NO:741.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:763; a CDR2 comprising the amino acid sequence of SEQ ID NO:764; and a CDR3 comprising the amino acid sequence of SEQ ID NO:765; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:767; a CDR2 the amino acid sequence of SEQ ID NO:768; and a CDR3 comprising the amino acid sequence of SEQ ID NO:769.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:799; a CDR2 comprising the amino acid sequence of SEQ ID NO:800; and a CDR3 comprising the amino acid sequence of SEQ ID NO:801; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:803; a CDR2 comprising the amino acid sequence of SEQ ID NO:804; and a CDR3 comprising the amino acid sequence of SEQ ID NO:805.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:835; a CDR2 comprising the amino acid sequence of SEQ ID NO:836 and a CDR3 comprising the amino acid sequence of SEQ ID NO:837; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 839; a CDR2 comprising the amino acid sequence of SEQ ID NO: 840; and a CDR3 comprising the amino acid sequence of SEQ ID NO:841.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:855; a CDR2 comprising the amino acid sequence of SEQ ID NO:856; and a CDR3 comprising the amino acid sequence of SEQ ID NO:857; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:851; a CDR2 comprising the amino acid sequence of SEQ ID NO:852; and a CDR3 comprising the amino acid sequence of SEQ ID NO:853.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:863; a CDR2 comprising the amino acid sequence of SEQ ID NO: 864; and a CDR3 comprising the amino acid sequence of SEQ ID NO:865; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:859 a CDR2 comprising the amino acid sequence of SEQ ID NO:860; and a CDR3 comprising the amino acid sequence of SEQ ID NO:861.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:99; a CDR2 comprising the amino acid sequence of SEQ ID NO: 100; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 101; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:96; a CDR2 comprising the amino acid sequence of SEQ ID NO:97; and a CDR3 comprising the amino acid sequence of SEQ ID NO:98.
  • VL4 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:39, 47, 103, 422, 445, 455, 465, 475, 519, 662, 698, 734, 762, 798, 834, 854 and 862; and VH4 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:38, 43, 102, 423, 432, 523, 666, 702, 738, 766, 802, 838, 850 and 858.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:39; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:38.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:47; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:43.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:39; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:43.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:47; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:38.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:422; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:423.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:445; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:432.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:455; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:432.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:465; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:432.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:475; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:432.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:519; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 523.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:662; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:666.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:698; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:702.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:734; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:738.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:762; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:766.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:798; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:802.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:834; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:838.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:854; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:850.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:862; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:858.
  • VL2 and VH2 specifically bind to CD3.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:35, 44, 99, 446, 456, 466, 476, 520, 663, 699, 735, 763, 799, 835, 855 and 863; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:36, 45, 100, 447 (DT), 457 (DT), 467 (DT), 477 (DT), 521, 664, 700, 736, 764, 800, 836, 856 and 864; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:37, 46, 101, 448, 458, 468, 478, 522, 665
  • a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:33, 41, 97, 434, 525, 668, 704, 740, 768, 804, 840, 852 and 860; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:34, 42, 98, 435, 526, 669, 705, 741, 769, 805, 841, 853 and 861.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:35; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:36; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:37; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:32; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:33; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:34.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:44; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:45; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:46; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:40; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:41; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:42.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:446; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:447 (DT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:448; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:433; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:434; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:435.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:456; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:457 (DT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:458; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:433; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:434; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:435.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:466; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:467 (DT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:468; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:433; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:434; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:435.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:476; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:477 (DT); and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:478; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:433; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:434; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:435.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 520; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:521; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:522; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:524; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:525; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:526.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:663; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:664; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:665; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:667; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:668; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:669.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 699; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 700; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:701; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:703; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:704; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:705.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:735; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:736; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:737 and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:739; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:740; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:741.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:763; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:764; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:765; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:767; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:768; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:769.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:799; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:800; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:801; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:803; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:804; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:805.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 835; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:836 and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:837; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:839; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:840; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:841.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:855; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:856; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:857; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:851; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:852; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:853.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 863; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 864; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:865; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:859 a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:860; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:861.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:99; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 100; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 101; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:96; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:97; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:98.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:44; a CDR2 comprising the amino acid sequence of SEQ ID NO:45; and a CDR3 comprising the amino acid sequence of SEQ ID NO:46; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:40; a CDR2 comprising the amino acid sequence of SEQ ID NO:41; and a CDR3 comprising the amino acid sequence of SEQ ID NO:42.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:446; a CDR2 comprising the amino acid sequence of SEQ ID NO:447 (DT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:448; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:433; a CDR2 comprising the amino acid sequence of SEQ ID NO:434; and a CDR3 comprising the amino acid sequence of SEQ ID NO:435.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:456; a CDR2 comprising the amino acid sequence of SEQ ID NO:457 (DT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:458; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:433; a CDR2 comprising the amino acid sequence of SEQ ID NO:434; and a CDR3 comprising the amino acid sequence of SEQ ID NO:435.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:466; a CDR2 comprising the amino acid sequence of SEQ ID NO:467 (DT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:468; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:433; a CDR2 comprising the amino acid sequence of SEQ ID NO:434; and a CDR3 comprising the amino acid sequence of SEQ ID NO:435.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:476; a CDR2 comprising the amino acid sequence of SEQ ID NO:477 (DT); and a CDR3 comprising the amino acid sequence of SEQ ID NO:478; and VH2 comprises a CDR1 the amino acid sequence of SEQ ID NO:433; a CDR2 comprising the amino acid sequence of SEQ ID NO:434; and a CDR3 comprising the amino acid sequence of SEQ ID NO:435.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:520; a CDR2 comprising the amino acid sequence of SEQ ID NO:521; and a CDR3 comprising the amino acid sequence of SEQ ID NO:522; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:524; a CDR2 comprising the amino acid sequence of SEQ ID NO:525; and a CDR3 comprising the amino acid sequence of SEQ ID NO:526.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:663; a CDR2 comprising the amino acid sequence of SEQ ID NO:664; and a CDR3 comprising the amino acid sequence of SEQ ID NO:665; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:667; a CDR2 comprising the amino acid sequence of SEQ ID NO:668; and a CDR3 comprising the amino acid sequence of SEQ ID NO:669.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:699; a CDR2 comprising the amino acid sequence of SEQ ID NO: 700; and a CDR3 comprising the amino acid sequence of SEQ ID NO:701; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:703; a CDR2 comprising the amino acid sequence of SEQ ID NO:704; and a CDR3 comprising the amino acid sequence of SEQ ID NO:705.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:735; a CDR2 comprising the amino acid sequence of SEQ ID NO:736; and a CDR3 comprising the amino acid sequence of SEQ ID NO:737 and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:739; a CDR2 comprising the amino acid sequence of SEQ ID NO:740; and a CDR3 comprising the amino acid sequence of SEQ ID NO:741.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:763; a CDR2 comprising the amino acid sequence of SEQ ID NO:764; and a CDR3 comprising the amino acid sequence of SEQ ID NO:765; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:767; a CDR2 the amino acid sequence of SEQ ID NO:768; and a CDR3 comprising the amino acid sequence of SEQ ID NO:769.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:799; a CDR2 comprising the amino acid sequence of SEQ ID NO:800; and a CDR3 comprising the amino acid sequence of SEQ ID NO:801; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:803; a CDR2 comprising the amino acid sequence of SEQ ID NO:804; and a CDR3 comprising the amino acid sequence of SEQ ID NO:805.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:835; a CDR2 comprising the amino acid sequence of SEQ ID NO:836 and a CDR3 comprising the amino acid sequence of SEQ ID NO:837; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO: 839; a CDR2 comprising the amino acid sequence of SEQ ID NO: 840; and a CDR3 comprising the amino acid sequence of SEQ ID NO:841.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:855; a CDR2 comprising the amino acid sequence of SEQ ID NO:856; and a CDR3 comprising the amino acid sequence of SEQ ID NO:857; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:851; a CDR2 comprising the amino acid sequence of SEQ ID NO:852; and a CDR3 comprising the amino acid sequence of SEQ ID NO:853.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:863; a CDR2 comprising the amino acid sequence of SEQ ID NO: 864; and a CDR3 comprising the amino acid sequence of SEQ ID NO:865; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:859 a CDR2 comprising the amino acid sequence of SEQ ID NO:860; and a CDR3 comprising the amino acid sequence of SEQ ID NO:861.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:99; a CDR2 comprising the amino acid sequence of SEQ ID NO: 100; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 101; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:96; a CDR2 comprising the amino acid sequence of SEQ ID NO:97; and a CDR3 comprising the amino acid sequence of SEQ ID NO:98.
  • VL2 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:39, 47, 103, 422, 445, 455, 465, 475, 519, 662, 698, 734, 762, 798, 834, 854 and 862; and VH2 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:38, 43, 102. 423, 432, 523, 666, 702, 738, 766, 802, 838, 850 and 858.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:39; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:38.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:47; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:43.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:39; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:43.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:47; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:38.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:422; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:423.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:445; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:432.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:455; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:432.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:465; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:432.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:475; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:432.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:519; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO: 523.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:662; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:666.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:698; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:702.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:734; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:738.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:762; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:766.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:798; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:802.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:834; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:838.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:854; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:850.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:862; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:858.
  • the antigen binding polypeptide complex (e.g., antibody or antigen binding fragment thereof) of the invention specifically binds to an immune stimulating receptor. In some aspects, the antigen binding polypeptide complex specifically binds to CD3 and an immune stimulating receptor.
  • the antigen binding polypeptide complex specifically binds to CD3, an immune stimulating receptor, and one or more TAAs, such as, e.g., A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91,
  • the antigen binding polypeptide complex may specifically bind CD3, an immune stimulating receptor (such as CD28), CD19 and CD20.
  • the antigen binding polypeptide complex may specifically bind CD3, an immune stimulating receptor (such as CD28), cMet and Trop2.
  • a VL and a corresponding VH of the antigen binding polypeptide complex specifically bind to an immune stimulating receptor (such as CD28).
  • an immune stimulating receptor such as CD28
  • one VL and one corresponding VH of the antigen binding polypeptide complex specifically bind to an immune stimulating receptor.
  • VL1 and VH1 specifically bind to an immune stimulating receptor.
  • VL1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:51, 59, 645, 681, 771, 843, 717 and 807; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:52, 60, 646, 682, 772, 844, 718 and 808; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:53, 61, 647, 683, 773, 845, 719 and 809; and VH1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:48, 56, 649, 685, 775, 847, 721 and 811; a CDR2 comprising an amino acid sequence
  • VL1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:51; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 52; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:53; and VH1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:48; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:49; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:50.
  • VL1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:59; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:60; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:61; and VH1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:56; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:57; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:58.
  • VL1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:645; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:646; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:647; and VH1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:649; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:650; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:651.
  • VL1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:681; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:682; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:683; and VH1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:685; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:686; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:687.
  • VL1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:771; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:772; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:773; and VH1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:775; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:776; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:777.
  • VL1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 843; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:844; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:845; and VH1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:847; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:848; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:849.
  • VL1 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:51; a CDR2 comprising the amino acid sequence of SEQ ID NO:52; and a CDR3 comprising the amino acid sequence of SEQ ID NO:53; and VH1 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:48; a CDR2 comprising the amino acid sequence of SEQ ID NO:49; and a CDR3 comprising the amino acid sequence of SEQ ID NO:50.
  • VL1 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:59; a CDR2 comprising the amino acid sequence of SEQ ID NO:60; and a CDR3 comprising the amino acid sequence of SEQ ID NO:61; and VH1 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:56; a CDR2 comprising the amino acid sequence of SEQ ID NO:57; and a CDR3 comprising the amino acid sequence of SEQ ID NO:58.
  • VL1 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:645; a CDR2 comprising the amino acid sequence of SEQ ID NO:646; and a CDR3 comprising the amino acid sequence of SEQ ID NO:647; and VH1 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:649; a CDR2 comprising the amino acid sequence of SEQ ID NO:650; and a CDR3 comprising the amino acid sequence of SEQ ID NO:651.
  • VL1 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:681; a CDR2 comprising the amino acid sequence of SEQ ID NO:682; and a CDR3 comprising the amino acid sequence of SEQ ID NO:683; and VH1 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:685; a CDR2 comprising the amino acid sequence of SEQ ID NO:686; and a CDR3 comprising the amino acid sequence of SEQ ID NO:687.
  • VL1 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:771; a CDR2 comprising the amino acid sequence of SEQ ID NO:772; and a CDR3 comprising the amino acid sequence of SEQ ID NO:773; and VH1 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:775; a CDR2 comprising the amino acid sequence of SEQ ID NO:776; and a CDR3 comprising the amino acid sequence of SEQ ID NO:777.
  • VL1 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:843; a CDR2 comprising the amino acid sequence of SEQ ID NO:844; and a CDR3 comprising the amino acid sequence of SEQ ID NO:845; and VH1 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:847; a CDR2 comprising the amino acid sequence of SEQ ID NO:848; and a CDR3 comprising the amino acid sequence of SEQ ID NO:849.
  • VL1 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NO:55 or 63; and VH1 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NO:54 or 62.
  • VL1 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:55; and/or VH1 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:54.
  • VL1 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:63; and/or VH1 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:62.
  • VL1 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:55; and/or VH1 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:62.
  • VL1 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:63; and/or VH1 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:54.
  • VL2 and VH2 specifically bind to an immune stimulating receptor (such sa CD28).
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:51, 59, 645, 681, 771 and 843; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:52, 60, 646, 682, 772 and 844; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:53, 61, 647, 683, 773 and 845; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:48, 56, 649, 685, 775 and 847;
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:51; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:52; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:53; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:48; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:49; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:50.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:59; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 60; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:61; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:56; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:57; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:58.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:645; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:646; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:647; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:649; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:650; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:651.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:681; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:682; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:683; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:685; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:686; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:687.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:771; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:772; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:773; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:775; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:776; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:777.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:843; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:844; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:845; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:847; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:848; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:849.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:51; a CDR2 comprising the amino acid sequence of SEQ ID NO:52; and a CDR3 comprising the amino acid sequence of SEQ ID NO:53; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:48; a CDR2 comprising the amino acid sequence of SEQ ID NO:49; and a CDR3 comprising the amino acid sequence of SEQ ID NO: 50.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:59; a CDR2 comprising the amino acid sequence of SEQ ID NO:60; and a CDR3 comprising the amino acid sequence of SEQ ID NO:61; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:56; a CDR2 comprising the amino acid sequence of SEQ ID NO:57; and a CDR3 comprising the amino acid sequence of SEQ ID NO:58.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:645; a CDR2 comprising the amino acid sequence of SEQ ID NO:646; and a CDR3 comprising the amino acid sequence of SEQ ID NO:647; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:649; a CDR2 comprising the amino acid sequence of SEQ ID NO:650; and a CDR3 comprising the amino acid sequence of SEQ ID NO:651.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:681; a CDR2 comprising the amino acid sequence of SEQ ID NO: 682; and a CDR3 comprising the amino acid sequence of SEQ ID NO:683; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:685; a CDR2 comprising the amino acid sequence of SEQ ID NO:686; and a CDR3 comprising the amino acid sequence of SEQ ID NO:687.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:771; a CDR2 comprising the amino acid sequence of SEQ ID NO:772; and a CDR3 comprising the amino acid sequence of SEQ ID NO:773; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:775; a CDR2 comprising the amino acid sequence of SEQ ID NO:776; and a CDR3 comprising the amino acid sequence of SEQ ID NO:777.
  • VL2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:843; a CDR2 comprising the amino acid sequence of SEQ ID NO:844; and a CDR3 comprising the amino acid sequence of SEQ ID NO:845; and VH2 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:847; a CDR2 comprising the amino acid sequence of SEQ ID NO:848; and a CDR3 comprising the amino acid sequence of SEQ ID NO:849.
  • VL2 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NO:55 or 63; and VH2 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NO:54 or 62.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:55; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:54.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:63; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:62.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:55; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:62.
  • VL2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:63; and/or VH2 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:54.
  • VL3 and VH3 specifically bind to an immune stimulating receptor (such as CD28).
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:51, 59, 645, 681, 771 and 843; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:52, 60, 646, 682, 772 and 844; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:53, 61, 647, 683, 773 and 845; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:48, 56, 649, 685, 775 and 847; a CDR1 comprising an amino acid sequence having
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:51; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:52; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:53; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:48; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:49; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:50.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:59; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 60; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:61; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:56; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:57; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:58.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:645; a CDR2 comprising the amino acid sequence of SEQ ID NO:646; and a CDR3 comprising the amino acid sequence of SEQ ID NO:647; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:649; a CDR2 comprising the amino acid sequence of SEQ ID NO:650; and a CDR3 comprising the amino acid sequence of SEQ ID NO:651.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:681; a CDR2 comprising the amino acid sequence of SEQ ID NO: 682; and a CDR3 comprising the amino acid sequence of SEQ ID NO:683; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:685; a CDR2 comprising the amino acid sequence of SEQ ID NO:686; and a CDR3 comprising the amino acid sequence of SEQ ID NO:687.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:771; a CDR2 comprising the amino acid sequence of SEQ ID NO:772; and a CDR3 comprising the amino acid sequence of SEQ ID NO:773; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:775; a CDR2 comprising the amino acid sequence of SEQ ID NO:776; and a CDR3 comprising the amino acid sequence of SEQ ID NO:777.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:843; a CDR2 comprising the amino acid sequence of SEQ ID NO:844; and a CDR3 comprising the amino acid sequence of SEQ ID NO:845; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:847; a CDR2 comprising the amino acid sequence of SEQ ID NO:848; and a CDR3 comprising the amino acid sequence of SEQ ID NO:849.
  • "at least 90% identity” includes at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and 100% identity to the recited reference sequence.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:51; a CDR2 comprising the amino acid sequence of SEQ ID NO:52; and a CDR3 comprising the amino acid sequence"of SEQ ID NO:53; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:48; a CDR2 comprising the amino acid sequence of SEQ ID NO:49; and a CDR3 comprising the amino acid sequence of SEQ ID NO:50.
  • VL3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:59; a CDR2 comprising the amino acid sequence of SEQ ID NO:60; and a CDR3 comprising the amino acid sequence of SEQ ID NO:61; and VH3 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:56; a CDR2 comprising the amino acid sequence of SEQ ID NO:57; and a CDR3 comprising the amino acid sequence of SEQ ID NO:58.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:645; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:646; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:647; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:649; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:650; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:651.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:681; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:682; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:683; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:685; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:686; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:687.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:771; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:772; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:773; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:775; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:776; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:777.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:843; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:844; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:845; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:847; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:848; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 849.
  • VL3 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NO:55 or 63; and VH3 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NO:54 or 62.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:55; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:54.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:63; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:62.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:55; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:62.
  • VL3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:63; and/or VH3 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:54.
  • VL4 and VH4 specifically bind to an immune stimulating receptor (such as CD28).
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:51, 59, 645, 681, 771 and 843; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:52, 60, 646, 682, 772 and 844; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:53, 61, 647, 683, 773 and 845; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:48, 56, 649, 685, 775 and 847; a CDR1 comprising an amino acid sequence having
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:51; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:52; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:53; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:48; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:49; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:50.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:59; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:60; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:61; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:56; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:57; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:58.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:645; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:646; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:647; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:649; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:650; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:651.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:681; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:682; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:683; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:685; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:686; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:687.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:771; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:772; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:773; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:775; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:776; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:777.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:843; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:844; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:845; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:847; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:848; and a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:849.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:51; a CDR2 comprising the amino acid sequence of SEQ ID NO:52; and a CDR3 comprising the amino acid sequence of SEQ ID NO:53; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:48; a CDR2 comprising the amino acid sequence of SEQ ID NO:49; and a CDR3 comprising the amino acid sequence of SEQ ID NO:50
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:59; a CDR2 comprising the amino acid sequence of SEQ ID NO:60; and a CDR3 comprising the amino acid sequence of SEQ ID NO:61; and VH4 comprises a CDR1
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:645; a CDR2 comprising the amino acid sequence of SEQ ID NO:646; and a CDR3 comprising the amino acid sequence of SEQ ID NO:647; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:649; a CDR2 comprising the amino acid sequence of SEQ ID NO:650; and a CDR3 comprising the amino acid sequence of SEQ ID NO:651.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:681; a CDR2 comprising the amino acid sequence of SEQ ID NO: 682; and a CDR3 comprising the amino acid sequence of SEQ ID NO:683; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:685; a CDR2 comprising the amino acid sequence of SEQ ID NO:686; and a CDR3 comprising the amino acid sequence of SEQ ID NO:687.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:771; a CDR2 comprising the amino acid sequence of SEQ ID NO:772; and a CDR3 comprising the amino acid sequence of SEQ ID NO:773; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:775; a CDR2 comprising the amino acid sequence of SEQ ID NO:776; and a CDR3 comprising the amino acid sequence of SEQ ID NO:777.
  • VL4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:843; a CDR2 comprising the amino acid sequence of SEQ ID NO:844; and a CDR3 comprising the amino acid sequence of SEQ ID NO:845; and VH4 comprises a CDR1 comprising the amino acid sequence of SEQ ID NO:847; a CDR2 comprising the amino acid sequence of SEQ ID NO:848; and a CDR3 comprising the amino acid sequence of SEQ ID NO:849.
  • VL4 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NO:55 or 63; and VH4 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to SEQ ID NO:54 or 62.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:55; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:54.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:63; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:62.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:55; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:62.
  • VL4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:63; and/or VH4 comprises an amino acid sequence having at least 80% identity (such as at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity) to SEQ ID NO:54.
  • the antigen binding polypeptide complex (e.g., antibody or antigen binding fragment thereof) of the invention specifically binds to CD28.
  • the antigen binding polypeptide complex specifically binds to CD28 and CD3.
  • the antigen binding polypeptide complex specifically binds to CD28, CD3, and one or more TAAs, such as, e g., A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30,
  • TAAs such as, e
  • a VL and a corresponding VH of the antigen binding polypeptide complex specifically bind to CD28. In some aspects, one VL and one corresponding VH of the antigen binding polypeptide complex specifically bind to CD28. In some aspects, VL1 and VH1 specifically bind to CD28.
  • VL1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:51, 59, 645, 681, 771 and 843; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:52, 60, 646, 682, 772 and 844; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:53, 61, 647, 683, 773 and 845; and VH1 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:48, 56, 649, 685, 775 and 847; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs
  • VL1 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:55, 63, 527, 644, 680, 770 and 842; and VH1 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:54, 62, 528, 648, 684, 774 and 846.
  • VL2 and VH2 specifically bind to CD28.
  • VL2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:51, 59, 645, 681, 771 and 843; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:52, 60, 646, 682, 772 and 844; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:53, 61, 647, 683, 773 and 845; and VH2 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:48, 56, 649, 685, 775 and 847; a CDR2 comprising an amino acid
  • VL2 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:55, 63, 527, 644, 680, 770 and 842; and VH2 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:54, 62, 528, 648, 684, 774 and 846.
  • VL3 and VH3 specifically bind to CD28.
  • VL3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:51, 59, 645, 681, 771 and 843; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to ay one of SEQ ID NOs:52, 60, 646, 682, 772, 844; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:53, 61, 647, 683, 773 and 845; and VH3 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:48, 56, 649, 685, 775 and 847; a CDR2 comprising an
  • VL3 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:55, 63, 527, 644, 680, 770 and 842; and VH3 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:54, 62, 528, 648, 684, 774 and 846.
  • VL4 and VH4 specifically bind to CD28.
  • VL4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:51, 59, 645, 681, 771 and 843; a CDR2 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:52, 60, 646, 682, 772 and 844; and a CDR3 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:53, 61, 647, 683, 773 and 845; and VH4 comprises a CDR1 comprising an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:48, 56, 649, 685, 775 and 847; a CDR2 comprising an amino acid
  • VL4 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:55, 63, 527, 644, 680, 770 and 842; and VH4 comprises an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, or 100% identity to any one of SEQ ID NOs:54, 62, 528, 648, 684, 774 and 846.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VH1-L2-Fc; or VH1-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VH2-L5-VH3-L6-CH1-L7-Fc; wherein the third polypeptide has a structure represented by VL2-L8-VL3-L9-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to human CD3; VH1 is a first immunoglobulin heavy chain variable region that specifically binds to
  • the TAA bound by VL1 and VH1 is CD 19 and the TAA bound by VL2 and VH2 is CD20. In some aspects, the TAA bound by VL1 and VH1 is CD20 and the TAA bound by VL2 and VH2 is CD19. In some aspects, the TAA bound by VL1 and VH1 is cMet and the TAA bound by VL2 and VH2 is Trop2. In some aspects, the TAA bound by VL1 and VH1 is Trop2 and the TAA bound by VL2 and VH2 is cMet.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VH1-L2-Fc; or VH1-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VH2-L5-VH3-L6-CH1-L7-Fc; wherein the third polypeptide has a structure represented by VL2-L8-VL3-L9-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to an immune stimulating receptor; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to human CD3; VH1 is a first immunoglobulin heavy chain variable region that specifically binds to
  • the immune stimulating receptor bound by VL1 and VH1 is CD28 and/or the TAA bound by VL2 and VH2 is CD19. In some aspects, the immune stimulating receptor bound by VL1 and VH1 is CD28 and/or the TAA bound by VL2 and VH2 is CD20. In some aspects, the immune stimulating receptor bound by VL1 and VH1 is CD28 and/or the TAA bound by VL2 and VH2 is cMet. In some aspects, the immune stimulating receptor bound by VL1 and VH1 is CD28 and/or the TAA bound by VL2 and VH2 is Trop2.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VH1-L2-Fc; or VH1-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VH2-L5-VH3-L6-CH1-L7-Fc; wherein the third polypeptide has a structure represented by VL2-L8-VL3-L9-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to human CD3; VH1 is a first immunoglobulin heavy chain variable region that specifically binds to a
  • VL2 and VH2 specifically binds to CD 19. In some aspects, VL2 and VH2 specifically binds to CD20. In some aspects, VL2 and VH2 specifically binds to cMet. In some aspects, VL2 and VH2 specifically binds to Trop2.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VH1-L2-Fc; or VH1-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VH2-L5-VH3-L6-CH1-L7-Fc; wherein the third polypeptide has a structure represented by VL2-L8-VL3-L9-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to an immune stimulating receptor; VL3 is a third immunoglobulin light chain variable region that specifically binds to human CD3; VH1 is a first immunoglobulin heavy chain variable region that specifically binds to
  • the TAA bound by VL1 and VH1 is CD19 and/or the immune stimulating receptor bound by VL2 and VH2 is CD28. In some aspects, the TAA bound by VL1 and VH1 is CD20 and/or the immune stimulating receptor bound by VL2 and VH2 is CD28. In some aspects, the TAA bound by VL1 and VH1 is cMet and/or the immune stimulating receptor bound by VL2 and VH2 is CD28. In some aspects, the TAA bound by VL1 and VH1 is Trop2 and/or the immune stimulating receptor bound by VL2 and VH2 is CD28.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VH1-L2-Fc; or VH1-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VH2-L5-VH3-L6-CH1-L7-Fc; wherein the third polypeptide has a structure represented by VL2-L8-VL3-L9-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to CD28; VL3 is a third immunoglobulin light chain variable region that specifically binds to human CD3; VH1 is a first immunoglobulin heavy chain variable region that specifically binds to a
  • VL1 and VH1 specifically binds to CD19. In some aspects, VL1 and VH1 specifically binds to CD20. In some aspects, VL1 and VH1 specifically binds to cMet. In some aspects, VL1 and VH1 specifically binds to Trop2.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, a third polypeptide, and a fourth polypeptide; wherein the first polypeptide has a structure represented by VL1-L1-CL; wherein the second polypeptide has a structure represented by VH1-L2-CH1-L3-Fc; wherein the third polypeptide has a structure represented by VH2-L4-VH3-L5-CH1-L6-Fc; wherein the fourth polypeptide has a structure represented by VL2-L7-VL3-L8-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to human CD3; VH1 is a first immunoglobulin
  • the TAA bound by VL1 and VH1 is CD 19 and the TAA bound by VL2 and VH2 is CD20. In some aspects, the TAA bound by VL1 and VH1 is CD20 and the TAA bound by VL2 and VH2 is CD19. In some aspects, the TAA bound by VL1 and VH1 is cMet and the TAA bound by VL2 and VH2 is Trop2. In some aspects, the TAA bound by VL1 and VH1 is Trop2 and the TAA bound by VL2 and VH2 is cMet.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, a third polypeptide, and a fourth polypeptide; wherein the first polypeptide has a structure represented by VL1-L1-CL; wherein the second polypeptide has a structure represented by VH1-L2-CH1-L3-Fc; wherein the third polypeptide has a structure represented by VH2-L4-VH3-L5-CH1-L6-Fc; wherein the fourth polypeptide has a structure represented by VL2-L7-VL3-L8-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to an immune stimulating receptor; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to human CD3; VH1 is a first immunoglobulin
  • the immune stimulating receptor bound by VL1 and VH1 is CD28 and/or the TAA bound by VL2 and VH2 is CD 19. In some aspects, the immune stimulating receptor bound by VL1 and VH1 is CD28 and/or the TAA bound by VL2 and VH2 is CD20. In some aspects, the immune stimulating receptor bound by VL1 and VH1 is CD28 and/or the TAA bound by VL2 and VH2 is cMet. In some aspects, the immune stimulating receptor bound by VL1 and VH1 is CD28 and/or the TAA bound by VL2 and VH2 is Trop2.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, a third polypeptide, and a fourth polypeptide; wherein the first polypeptide has a structure represented by VL1-L1-CL; wherein the second polypeptide has a structure represented by VH1-L2-CH1-L3-Fc; wherein the third polypeptide has a structure represented by VH2-L4-VH3-L5-CH1-L6-Fc; wherein the fourth polypeptide has a structure represented by VL2-L7-VL3-L8-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to human CD3; VH1 is a first immunoglobulin heavy chain
  • VL2 and VH2 specifically binds to CD 19. In some aspects, VL2 and VH2 specifically binds to CD20. In some aspects, VL2 and VH2 specifically binds to cMet. In some aspects, VL2 and VH2 specifically binds to Trop2.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, a third polypeptide, and a fourth polypeptide; wherein the first polypeptide has a structure represented by VL1-L1-CL; wherein the second polypeptide has a structure represented by VH1-L2-CH1-L3-Fc; wherein the third polypeptide has a structure represented by VH2-L4-VH3-L5-CH1-L6-Fc; wherein the fourth polypeptide has a structure represented by VL2-L7-VL3-L8-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to an immune stimulating receptor; VL3 is a third immunoglobulin light chain variable region that specifically binds to human CD3; VH1 is a first immunoglobulin
  • the TAA bound by VL1 and VH1 is CD19 and/or the immune stimulating receptor bound by VL2 and VH2 is CD28. In some aspects, the TAA bound by VL1 and VH1 is CD20 and/or the immune stimulating receptor bound by VL2 and VH2 is CD28. In some aspects, the TAA bound by VL1 and VH1 is cMet and/or the immune stimulating receptor bound by VL2 and VH2 is CD28. In some aspects, the TAA bound by VL1 and VH1 is Trop2 and/or the immune stimulating receptor bound by VL2 and VH2 is CD28.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, a third polypeptide, and a fourth polypeptide; wherein the first polypeptide has a structure represented by VL1-L1-CL; wherein the second polypeptide has a structure represented by VH1-L2-CH1-L3-Fc; wherein the third polypeptide has a structure represented by VH2-L4-VH3-L5-CH1-L6-Fc; wherein the fourth polypeptide has a structure represented by VL2-L7-VL3-L8-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to CD28; VL3 is a third immunoglobulin light chain variable region that specifically binds to human CD3; VH1 is a first immunoglobulin heavy chain variable
  • VL1 and VH1 specifically binds to CD19. In some aspects, VL1 and VH1 specifically binds to CD20. In some aspects, VL1 and VH1 specifically binds to cMet. In some aspects, VL1 and VH1 specifically binds to Trop2.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5- VH2-L6-VL2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc; wherein the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically bind
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5-VL2-L6-VH2-L7- VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-L10- CHl-Ll l-Fc; wherein the third polypeptide has a structure represented by VL3-L12-VL4-L13- CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to CD
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc;
  • the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc;
  • the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL.
  • the first polypeptide has a structure represented by VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc; and the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL.
  • the TAA bound by VL1 and VH1 is CD 19 and the TAA bound by VL2 and VH2 is CD20.
  • the TAA bound by VL1 and VH1 is CD20 and the TAA bound by VL2 and VH2 is CD19.
  • the TAA bound by VL1 and VH1 is cMet and the TAA bound by VL2 and VH2 is Trop2. In some aspects, the TAA bound by VL1 and VH1 is Trop2 and the TAA bound by VL2 and VH2 is cMet.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5- VH2-L6-VL2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; wherein the third polypeptide has a structure represented by VL3-L10- VL4-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to CD28; VL4 is
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; wherein the third polypeptide has a structure represented by VL3-L10-VL4-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to CD28; VL4 is a fourth immunoglobulin light
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; and the third polypeptide has a structure represented by VL3-L10-VL4-CL.
  • the first polypeptide has a structure represented by VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; and the third polypeptide has a structure represented by VL3-L10-VL4-CL.
  • the TAA bound by VL1 and VH1 is CD 19 and the TAA bound by VL2 and VH2 is CD20.
  • the TAA bound by VL1 and VH1 is CD20 and the TAA bound by VL2 and VH2 is CD19.
  • the TAA bound by VL1 and VH1 is cMet and the TAA bound by VL2 and VH2 is Trop2. In some aspects, the TAA bound by VL1 and VH1 is Trop2 and the TAA bound by VL2 and VH2 is cMet.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5- VH2-L6-VL2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc; wherein the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to an immune stimulating receptor; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically bind
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1-L4-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc; wherein the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to an immune stimulating receptor; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc;
  • the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc;
  • the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL.
  • the first polypeptide has a structure represented by VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-L10-CH1-L11-Fc; and the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL.
  • the immune stimulating receptor bound by VL1 and VH1 is CD28
  • the TAA bound by VL2 and VH2 is CD19 and/or the TAA bound by VL3 and VH3 is CD20.
  • the immune stimulating receptor bound by VL1 and VH1 is CD28, the TAA bound by VL2 and VH2 is CD20 and/or the TAA bound by VL3 and VH3 is CD19.
  • the immune stimulating receptor bound by VL1 and VH1 is CD28, the TAA bound by VL2 and VH2 is cMet and/or the TAA bound by VL3 and VH3 is Trop2.
  • the immune stimulating receptor bound by VL1 and VH1 is CD28, the TAA bound by VL2 and VH2 is Trop2 and/or the TAA bound by VL3 and VH3 is cMet.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5-VL2-L6-VH2-L7- VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-CH1- Fc; wherein the third polypeptide has a structure represented by VL3-L10-VL4-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to an immune stimulating receptor; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to a TAA; VL4 is a fourth
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; and the third polypeptide has a structure represented by VL3-L10-VL4-CL.
  • the first polypeptide has a structure represented by VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; and the third polypeptide has a structure represented by VL3-L10-VL4-CL.
  • the immune stimulating receptor bound by VL1 and VH1 is CD28, the TAA bound by VL2 and VH2 is CD19 and/or the TAA bound by VL3 and VH3 is CD20.
  • the immune stimulating receptor bound by VL1 and VH1 is CD28, the TAA bound by VL2 and VH2 is CD20 and/or the TAA bound by VL3 and VH3 is CD 19.
  • the immune stimulating receptor bound by VL1 and VH1 is CD28, the TAA bound by VL2 and VH2 is cMet and/or the TAA bound by VL3 and VH3 is Trop2.
  • the immune stimulating receptor bound by VL1 and VH1 is CD28, the TAA bound by VL2 and VH2 is Trop2 and/or the TAA bound by VL3 and VH3 is cMet.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5- VH2-L6-VL2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc; wherein the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL 1 -L 1 - VL2-L2-VH2-L3 - VH1 -L4-Fc; or VH1 -L5- VL2-L6- VH2-L7- VL 1 -L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc; wherein the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc;
  • the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc;
  • the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL.
  • the first polypeptide has a structure represented by VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc; and the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL.
  • the TAA bound by VL2 and VH2 is CD 19 and the TAA bound by VL3 and VH3 is CD20.
  • the TAA bound by VL2 and VH2 is CD20 and the TAA bound by VL3 and VH3 is CD 19.
  • the TAA bound by VL2 and VH2 is cMet and the TAA bound by VL3 and VH3 is Trop2. In some aspects, the TAA bound by VL2 and VH2 is Trop2 and the TAA bound by VL3 and VH3 is cMet.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1- L5-VH2-L6-VL2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; wherein the third polypeptide has a structure represented by VL3-L10- VL4-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to a TAA; VL4 is
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1-L4-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; wherein the third polypeptide has a structure represented by VL3-L10-VL4-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to a TAA; VL3 is a third immunoglobulin light chain variable region that specifically binds to a TAA; VL4 is a fourth immunoglobulin light
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; and the third polypeptide has a structure represented by VL3-L10-VL4-CL.
  • the first polypeptide has a structure represented by VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; and the third polypeptide has a structure represented by VL3-L1-VL4-L13-CL.
  • the TAA bound by VL2 and VH2 is CD 19 and the TAA bound by VL3 and VH3 is CD20.
  • the TAA bound by VL2 and VH2 is CD20 and the TAA bound by VL3 and VH3 is CD 19.
  • the TAA bound by VL2 and VH2 is cMet and the TAA bound by VL3 and VH3 is Trop2. In some aspects, the TAA bound by VL2 and VH2 is Trop2 and the TAA bound by VL3 and VH3 is cMet.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5- VH2-L6-VL2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc; wherein the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to an immune stimulating receptor; VL3 is a third immunoglobulin light chain variable region that specifically bind
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1-L4-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc; wherein the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to an immune stimulating receptor; VL3 is a third immunoglobulin light chain variable region that specifically binds to
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc;
  • the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc;
  • the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL.
  • the first polypeptide has a structure represented by VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-L10-CH1-L11-Fc; and the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL.
  • the TAA bound by VL1 and VH1 is CD 19
  • the immune stimulating receptor bound by VL2 and VH2 is CD28 and/or the TAA bound by VL3 and VH3 is CD20.
  • the TAA bound by VL1 and VH1 is CD20
  • the immune stimulating receptor bound by VL2 and VH2 is CD28 and/or the TAA bound by VL3 and VH3 is CD19.
  • the TAA bound by VL1 and VH1 is cMet
  • the immune stimulating receptor bound by VL2 and VH2 is CD28 and/or the TAA bound by VL3 and VH3 is Trop2.
  • the TAA bound by VL1 and VH1 is Trop2
  • the immune stimulating receptor bound by VL2 and VH2 is CD28 and/or the TAA bound by VL3 and VH3 is cMet.
  • the immune stimulating receptor bound by VL2 and VH2 is CD28.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5- VH2-L6-VL2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; wherein the third polypeptide has a structure represented by VL3-L10- VL4-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to an immune stimulating receptor; VL3 is a third immunoglobulin light chain variable region that specifically binds to a TAA; VL4
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5-VL2-L6-VH2-L7- VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-CH1- Fc; wherein the third polypeptide has a structure represented by VL3-L10-VL4-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to an immune stimulating receptor; VL3 is a third immunoglobulin light chain variable region that specifically binds to a TAA; VL4 is a fourth
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; and the third polypeptide has a structure represented by VL3-L10-VL4-CL.
  • the first polypeptide has a structure represented by VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; and the third polypeptide has a structure represented by VL3-L10-VL4-CL.
  • the TAA bound by VL1 and VH1 is CD 19
  • the immune stimulating receptor bound by VL2 and VH2 is CD28 and/or the TAA bound by VL3 and VH3 is CD20.
  • the TAA bound by VL1 and VH1 is CD20
  • the immune stimulating receptor bound by VL2 and VH2 is CD28 and/or the TAA bound by VL3 and VH3 is CD 19.
  • the TAA bound by VL1 and VH1 is cMet
  • the immune stimulating receptor bound by VL2 and VH2 is CD28 and/or the TAA bound by VL3 and VH3 is Trop2.
  • the TAA bound by VL1 and VH1 is Trop2
  • the immune stimulating receptor bound by VL2 and VH2 is CD28 and/or the TAA bound by VL3 and VH3 is cMet.
  • the immune stimulating receptor bound by VL2 and VH2 is CD28.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5- VH2-L6-VL2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc; wherein the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to CD28; VL3 is a third immunoglobulin light chain variable region that specifically binds
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL 1 -L 1 - VL2-L2-VH2-L3 - VH1 -L4-Fc; or VH1 -L5- VL2-L6- VH2-L7- VL 1 -L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc; wherein the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to CD28; VL3 is a third immunoglobulin light chain variable region that specifically
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc;
  • the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc;
  • the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL.
  • the first polypeptide has a structure represented by VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-L10-CHl-Ll l-Fc; and the third polypeptide has a structure represented by VL3-L12-VL4-L13-CL.
  • the TAA bound by VL1 and VH1 is CD 19 and the TAA bound by VL3 and VH3 is CD20.
  • the TAA bound by VL1 and VH1 is CD20 and the TAA bound by VL3 and VH3 is CD19.
  • the TAA bound by VL1 and VH1 is cMet and the TAA bound by VL3 and VH3 is Trop2. In some aspects, the TAA bound by VL1 and VH1 is Trop2 and the TAA bound by VL3 and VH3 is cMet.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5- VH2-L6-VL2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; wherein the third polypeptide has a structure represented by VL3-L10- VL4-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to CD28; VL3 is a third immunoglobulin light chain variable region that specifically binds to a TAA; VL4 is
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1-L4-Fc; or VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; wherein the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; wherein the third polypeptide has a structure represented by VL3-L10-VL4-CL; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to a TAA; VL2 is a second immunoglobulin light chain variable region that specifically binds to CD28; VL3 is a third immunoglobulin light chain variable region that specifically binds to a TAA; VL4 is a fourth immunoglobulin light
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; and the third polypeptide has a structure represented by VL3-L10-VL4-CL.
  • the first polypeptide has a structure represented by VH1-L5-VL2-L6-VH2-L7-VL1-L8-Fc; the second polypeptide has a structure represented by VH3-L9-VH4-CH1-Fc; and the third polypeptide has a structure represented by VL3-L10-VL4-CL.
  • the TAA bound by VL1 and VH1 is CD 19 and the TAA bound by VL3 and VH3 is CD20.
  • the TAA bound by VL1 and VH1 is CD20 and the TAA bound by VL3 and VH3 is CD19.
  • the TAA bound by VL1 and VH1 is cMet and the TAA bound by VL3 and VH3 is Trop2. In some aspects, the TAA bound by VL1 and VH1 is Trop2 and the TAA bound by VL3 and VH3 is cMet.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5-VH2-L6-VL2-L7- VL1-L8-Fc; wherein the second polypeptide has a structure represented by VL3-L9-VL4-L10- VH4-L11-VH3-L12-Fc; or VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11- VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VH3-L13- VH4-L14-VL4-L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-Ll l-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • VL1 and VH1 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2,
  • VL2 and VH2 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • VL4 and VH4 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL1 and VH1 may specifically bind to CD28.
  • VL2 and VH2 may specifically bind to CD28.
  • VL4 and VH4 may specifically bind to CD28.
  • VL1 and VH1 may specifically bind to cMet.
  • VL2 and VH2 may specifically bind to cMet.
  • VL4 and VH4 may specifically bind to cMet.
  • VL1 and VH1 may specifically bind to Trop2.
  • VL2 and VH2 may specifically bind to Trop2.
  • VL4 and VH4 may specifically bind to Trop2.
  • VL1 and VH1 may specifically bind to CD19.
  • VL2 and VH2 may specifically bind to CD19.
  • VL4 and VH4 may specifically bind to CD19.
  • VL1 and VH1 may specifically bind to CD20.
  • VL2 and VH2 may specifically bind to CD20.
  • VL4 and VH4 may specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5-VH2-L6-VL2-L7- VL1-L8-Fc; wherein the second polypeptide has a structure represented by VL3-L9-VL4-L10- VH4-L11-VH3-L12-Fc; or VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, B
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11- VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VH3-L13- VH4-L14-VL4-L15-VL3-L16-FC.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-FC and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11-VH3-L12-FC.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • VL2 and VH2 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2,
  • VL4 and VH4 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL2 and VH2 may specifically bind to cMet.
  • VL4 and VH4 may specifically bind to cMet.
  • VL2 and VH2 may specifically bind to Trop2.
  • VL4 and VH4 may specifically bind to Trop2.
  • VL2 and VH2 may specifically bind to CD19.
  • VL4 and VH4 may specifically bind to CD19.
  • VL2 and VH2 may specifically bind to CD20.
  • VL4 and VH4 may specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5-VH2-L6-VL2-L7- VL1-L8-Fc; wherein the second polypeptide has a structure represented by VL3-L9-VL4-L10- VH4-L11-VH3-L12-Fc; or VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-Ll l-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3- L16-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6- VL2-L7-VL1-L8-FC and the second polypeptide has a structure represented by VL3-L9-VL4-L10- VH4-L11-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VH1- L5-VH2-L6-VL2-L7-VL1-L8-FC and the second polypeptide has a structure represented by VH3- L13-VH4-L14-VL4-L15-VL3-L16-FC.
  • VL1 and VH1 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • VL4 and VH4 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL1 and VH1 may specifically bind to cMet.
  • VL4 and VH4 may specifically bind to cMet.
  • VL1 and VH1 may specifically bind to Trop2.
  • VL4 and VH4 may specifically bind to Trop2.
  • VL1 and VH1 may specifically bind to CD19.
  • VL4 and VH4 may specifically bind to CD19.
  • VL1 and VH1 may specifically bind to CD20.
  • VL4 and VH4 may specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5-VH2-L6-VL2-L7- VL1-L8-Fc; wherein the second polypeptide has a structure represented by VL3-L9-VL4-L10- VH4-L11-VH3-L12-Fc; or VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-Ll l-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15- VL3-L16-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2- L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VL3-L9-VL4- L10-VH4-Ll l-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • VL1 and VH1 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • VL2 and VH2 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL1 and VH1 may specifically bind to cMet.
  • VL2 and VH2 may specifically bind to cMet.
  • VL1 and VH1 may specifically bind to Trop2.
  • VL2 and VH2 may specifically bind to Trop2.
  • VL1 and VH1 may specifically bind to CD19.
  • VL2 and VH2 may specifically bind to CD19.
  • VL1 and VH1 may specifically bind to CD20.
  • VL2 and VH2 may specifically bind to CD20.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD28, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to cMet.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD28, VL2 and VH2 specifically bind to cMet, and VL1 and VH1 specifically bind to Trop2.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to Trop2, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to cMet.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to Trop2, VL2 and VH2 specifically bind to cMet, and VL1 and VH1 specifically bind to CD28.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to cMet, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to CD28.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to cMet, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to Trop2.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD28, VL2 and VH2 specifically bind to CD20, and VL1 and VH1 specifically bind to CD19.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD28, VL2 and VH2 specifically bind to CD 19, and VL1 and VH1 specifically bind to CD20.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD20, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to CD19.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD20, VL2 and VH2 specifically bind to CD19, and VL1 and VH1 specifically bind to CD28.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD 19, VL2 and VH2 specifically bind to CD20, and VL1 and VH1 specifically bind to CD28.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD 19, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5-VH2-L6-VL2-L7- VL1-L8-Fc; wherein the second polypeptide has a structure represented by VL3-L9-VL4-L10- VH4-L11-VH3-L12-Fc; or VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11- VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VH3-L13- VH4-L14-VL4-L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-Ll l-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • VL1 and VH1 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2,
  • VL2 and VH2 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • VL3 and VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL1 and VH1 may specifically bind to CD28.
  • VL2 and VH2 may specifically bind to CD28.
  • VL3 and VH3 may specifically bind to CD28.
  • VL1 and VH1 may specifically bind to cMet.
  • VL2 and VH2 may specifically bind to cMet.
  • VL3 and VH3 may specifically bind to cMet.
  • VL1 and VH1 may specifically bind to Trop2.
  • VL2 and VH2 may specifically bind to Trop2.
  • VL3 and VH3 may specifically bind to Trop2.
  • VL1 and VH1 may specifically bind to CD19.
  • VL2 and VH2 may specifically bind to CD19.
  • VL3 and VH3 may specifically bind to CD19.
  • VL1 and VH1 may specifically bind to CD20.
  • VL2 and VH2 may specifically bind to CD20.
  • VL3 and VH3 may specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5-VH2-L6-VL2-L7- VL1-L8-Fc; wherein the second polypeptide has a structure represented by VL3-L9-VL4-L10- VH4-L11-VH3-L12-Fc; or VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to CD28; VL2 is a second immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, B
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11- VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VH3-L13- VH4-L14-VL4-L15-VL3-L16-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-Ll l-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • VL2 and VH2 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2,
  • VL3 and VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL2 and VH2 may specifically bind to cMet.
  • VL3 and VH3 may specifically bind to cMet.
  • VL2 and VH2 may specifically bind to Trop2.
  • VL3 and VH3 may specifically bind to Trop2.
  • VL2 and VH2 may specifically bind to CD19.
  • VL3 and VH3 may specifically bind to CD19.
  • VL2 and VH2 may specifically bind to CD20.
  • VL3 and VH3 may specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5-VH2-L6-VL2-L7- VL1-L8-Fc; wherein the second polypeptide has a structure represented by VL3-L9-VL4-L10- VH4-L11-VH3-L12-Fc; or VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11- VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VH3-L13- VH4-L14-VL4-L15-VL3-L16-FC.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-FC and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-Ll l-VH3-L12-Fc.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • VL1 and VH1 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2,
  • VL3 and VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL1 and VH1 may specifically bind to cMet.
  • VL3 and VH3 may specifically bind to cMet.
  • VL1 and VH1 may specifically bind to Trop2.
  • VL3 and VH3 may specifically bind to Trop2.
  • VL1 and VH1 may specifically bind to CD19.
  • VL3 and VH3 may specifically bind to CD19.
  • VL1 and VH1 may specifically bind to CD20.
  • VL3 and VH3 may specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L5-VH2-L6-VL2-L7- VL1-L8-Fc; wherein the second polypeptide has a structure represented by VL3-L9-VL4-L10- VH4-L11-VH3-L12-Fc; or VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-Fc and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11- VH3-L12-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VH3-L13- VH4-L14-VL4-L15-VL3-L16-FC.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-FC and the second polypeptide has a structure represented by VL3-L9-VL4-L10-VH4-L11-VH3-L12-FC.
  • the first polypeptide has a structure represented by VH1-L5-VH2-L6-VL2-L7-VL1-L8-Fc and the second polypeptide has a structure represented by VH3-L13-VH4-L14-VL4-L15-VL3-L16-Fc.
  • VL1 and VH1 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2,
  • VL2 and VH2 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL1 and VH1 may specifically bind to cMet.
  • VL2 and VH2 may specifically bind to cMet.
  • VL1 and VH1 may specifically bind to Trop2.
  • VL2 and VH2 may specifically bind to Trop2.
  • VL1 and VH1 may specifically bind to CD19.
  • VL2 and VH2 may specifically bind to CD19.
  • VL1 and VH1 may specifically bind to CD20.
  • VL2 and VH2 may specifically bind to CD20.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD28, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to cMet.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD28, VL2 and VH2 specifically bind to cMet, and VL1 and VH1 specifically bind to Trop2.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to Trop2, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to cMet. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to Trop2, VL2 and VH2 specifically bind to cMet, and VL1 and VH1 specifically bind to CD28. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to cMet, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to CD28.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to cMet, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to CD28.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD28, VL2 and VH2 specifically bind to CD20, and VL1 and VH1 specifically bind to CD19.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD28, VL2 and VH2 specifically bind to CD 19, and VL1 and VH1 specifically bind to CD20.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD20, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to CD19. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD20, VL2 and VH2 specifically bind to CD19, and VL1 and VH1 specifically bind to CD28. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD 19, VL2 and VH2 specifically bind to CD20, and VL1 and VH1 specifically bind to CD28. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD 19, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2- L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VH1-L16-VH2- L 17-VL2-L18-VL1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22-VH2-L23-VH1 -L24-CH1 -L25-CL- L26-Fc; VH I -L27-VH2-L28-VL2-L29-VLI
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • the first polypeptide has a structure represented by VL I -L I -VL2-L2-VH2-L3-VH I -L4-CH I -L5-Fc; VH1-L6-VH2-L7- VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH 1 -L24-CH 1 -L25- CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1-L31-CL-L32-Fc; VL1-L33-
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1-L10- Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 - L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27- VH2-L28-VL2-L29-VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2- L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30- CH1-L31-CL-L32-Fc; VL1-L33-VL2-L34-VH2-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- CH1-L5-Fc; VH I -L6-VH2-L7-VL2-L8-VLI -L9-CH I -L I O-Fc; VL1-L11-VL2-L12-VH2-L13- VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2- L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1- L31-CL-L32-Fc; VL1-L33-VL2-L34-V
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL I -L I I -VL2-LI 2-VH2-LI 3-VH I -LI4- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-
  • VLI and VHI specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4, CX
  • VL2 and VH2 specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4,
  • VL4 and VH4 specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4,
  • the VL1, VL2, VL4, VH1, VH2, and/or VH4 may specifically bind to CD28, cMet, Trop2, CD20, or CD 19; and VL3 and/or VH3 may specifically bind to CD3.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL1 and VH1 may specifically bind to CD28.
  • VL2 and VH2 may specifically bind to CD28.
  • VL4 and VH4 may specifically bind to CD28.
  • VL1 and VH1 may specifically bind to cMet.
  • VL2 and VH2 may specifically bind to cMet.
  • VL4 and VH4 may specifically bind to cMet.
  • VL1 and VH1 may specifically bind to Trop2.
  • VL2 and VH2 may specifically bind to Trop2.
  • VL4 and VH4 may specifically bind to Trop2.
  • VL1 and VH1 may specifically bind to CD19.
  • VL2 and VH2 may specifically bind to CD19.
  • VL4 and VH4 may specifically bind to CD19.
  • VL1 and VH1 may specifically bind to CD20.
  • VL2 and VH2 may specifically bind to CD20.
  • VL4 and VH4 may specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2- L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VH1-L16-VH2- L 17-VL2-L18-VL1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22-VH2-L23-VH1 -L24-CH1 -L25-CL- L26-Fc; VH I -L27-VH2-L28-VL2-L29-VLI
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to CD28
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7- VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH 1 -L24-CH 1 -L25- CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1-L31-CL-L32-Fc; VL1-L33-VL2-L
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1-L10- Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 - L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27- VH2-L28-VL2-L29-VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2- L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30- CH1-L31-CL-L32-Fc; VL1-L33-VL2-L34-VH2-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13- VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2- L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1- L31-CL-L32-Fc; VL1-L33-VL2-L34-VH2-L
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • VL2 and VH2 specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4,
  • VL4 and VH4 specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4,
  • the VL1 and/or VH1 may specifically bind to CD28; VL2, VL4, VH2, and/or VH4 may specifically bind to cMet, Trop2, CD20, or CD 19; and VL3 and/or VH3 may specifically bind to CD3.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL2 and VH2 may specifically bind to cMet.
  • VL4 and VH4 may specifically bind to cMet.
  • VL2 and VH2 may specifically bind to Trop2.
  • VL4 and VH4 may specifically bind to Trop2.
  • VL2 and VH2 may specifically bind to CD19.
  • VL4 and VH4 may specifically bind to CD19.
  • VL2 and VH2 may specifically bind to CD20.
  • VL4 and VH4 may specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2- L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VH1-L16-VH2- L 17-VL2-L18-VL1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22-VH2-L23-VH1 -L24-CH1 -L25-CL- L26-Fc; VH I -L27-VH2-L28-VL2-L29-VLI
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7- VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH 1 -L24-CH 1 -L25- CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1-L31-CL-L32-Fc; VL1-L33-VL2-L
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1-L10- Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 - L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27- VH2-L28-VL2-L29-VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1- L6- VH2-L7- VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 - Fc; VH1 -L 16- VH2-L 17- VL2-L 18-VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 - L24-CH1-L25-CL-L26-Fc; VHl-L27-VH2-L28-VL2-L29-VLl-L30-CHl-L31-CL-L32-Fc;
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1- L6- VH2-L7- VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 - Fc; VH1 -L 16- VH2-L 17- VL2-L 18-VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 - L24-CH1-L25-CL-L26-Fc; VHl-L27-VH2-L28-VL2-L29-VLl-L30-CHl-L31-CL-L32-Fc;
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1- L6- VH2-L7- VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 - Fc; VH1 -L 16- VH2-L 17- VL2-L 18-VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 - L24-CH1-L25-CL-L26-Fc; VHl-L27-VH2-L28-VL2-L29-VLl-L30-CHl-L31-CL-L32-Fc;
  • VL1 and VH1 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL
  • VL4 and VH4 maythat specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • VL1, VL4, VH1, and/or VH4 may specifically bind to cMet, Trop2, CD20, or CD 19; VL2 and/or VH2 may specifically bind to CD28; and VL3 and/or VH3 may specifically bind to CD3.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL1 and VH1 may specifically bind to cMet.
  • VL4 and VH4 may specifically bind to cMet.
  • VL1 and VH1 may specifically bind to Trop2.
  • VL4 and VH4 may specifically bind to Trop2.
  • VL1 and VH1 may specifically bind to CD19.
  • VL4 and VH4 may specifically bind to CD19.
  • VL1 and VH1 may specifically bind to CD20.
  • VL4 and VH4 may specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2- L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VH1-L16-VH2- L 17-VL2-L18-VL1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22-VH2-L23-VH1 -L24-CH1 -L25-CL- L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2- L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30- CH1-L31-CL-L32-Fc; VL1-L33-VL2-L34-VH2-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7- VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH 1 -L24-CH 1 -L25- CL-L26-Fc; VH I -L27-VH2-L28-VL2-L29-VLI -L30-CH I -L31-CL-L32-Fc; VL1-L33-VL
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1-L10- Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 - L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27- VH2-L28-VL2-L29-VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2- L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30- CH1-L31-CL-L32-Fc; VL1-L33-VL2-L34-VH2-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13- VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2- L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1- L31-CL-L32-Fc; VL1-L33-VL2-L34-VH2-L
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL I -L I I -VL2-LI 2-VH2-LI 3-VH I -LI4- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-
  • VLI and VH1 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, C
  • VL2 and VH2 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • VL1, VL2, VH1, and/or VH2 may specifically bind to cMet, Trop2, CD20, or CD 19; VL3 and/or VH3 may specifically bind to CD3; and VL4 and/or VH4 may specifically bind to CD28.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL1 and VH1 may specifically bind to cMet.
  • VL2 and VH2 may specifically bind to cMet.
  • VL1 and VH1 may specifically bind to Trop2.
  • VL2 and VH2 may specifically bind to Trop2.
  • VL1 and VH1 may specifically bind to CD19.
  • VL2 and VH2 may specifically bind to CD19.
  • VL1 and VH1 may specifically bind to CD20.
  • VL2 and VH2 may specifically bind to CD20.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD28, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to cMet.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD28, VL2 and VH2 specifically bind to cMet, and VL1 and VH1 specifically bind to Trop2.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to Trop2, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to cMet.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to Trop2, VL2 and VH2 specifically bind to cMet, and VL1 and VH1 specifically bind to CD28.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to cMet, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to CD28.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to cMet, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to Trop2.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD28, VL2 and VH2 specifically bind to CD20, and VL1 and VH1 specifically bind to CD19.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD28, VL2 and VH2 specifically bind to CD 19, and VL1 and VH1 specifically bind to CD20.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD20, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to CD19.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD20, VL2 and VH2 specifically bind to CD19, and VL1 and VH1 specifically bind to CD28.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD 19, VL2 and VH2 specifically bind to CD20, and VL1 and VH1 specifically bind to CD28.
  • VL3 and VH3 specifically bind to CD3, VL4 and VH4 specifically bind to CD 19, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2- L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VH1-L16-VH2- L 17-VL2-L18-VL1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22-VH2-L23-VH1 -L24-CH1 -L25-CL- L26-Fc; VH I -L27-VH2-L28-VL2-L29-VLI -
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7- VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH 1 -L24-CH 1 -L25- CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1-L31-CL-L32-Fc; VL1-L33-VL2-L
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1-L10- Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 - L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27- VH2-L28-VL2-L29-VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2- L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30- CH1-L31-CL-L32-Fc; VL1-L33-VL2-L34-VH2-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- CH1-L5-Fc; VH I -L6-VH2-L7-VL2-L8-VLI -L9-CH I -L I 0-Fc; VL1-L11-VL2-L12-VH2-L13- VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2- L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1- L31-CL-L32-Fc; VL1-L33-VL2-L34-V
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • VL1 and VHI may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD 123, CD 133, CD 137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, C
  • VL2 and VH2 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • VL3 and VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CX
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to CD28, cMet, Trop2, CD20, or CD 19; and VL4 and/or VH4 may specifically bind to CD3.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL1 and VH1 may specifically bind to CD28.
  • VL2 and VH2 may specifically bind to CD28.
  • VL3 and VH3 may specifically bind to CD28.
  • VL1 and VH1 may specifically bind to cMet.
  • VL2 and VH2 may specifically bind to cMet.
  • VL3 and VH3 may specifically bind to cMet.
  • VL1 and VH1 may specifically bind to Trop2.
  • VL2 and VH2 may specifically bind to Trop2.
  • VL3 and VH3 may specifically bind to Trop2.
  • VL1 and VH1 may specifically bind to CD19.
  • VL2 and VH2 may specifically bind to CD19.
  • VL3 and VH3 may specifically bind to CD19.
  • VL1 and VH1 may specifically bind to CD20.
  • VL2 and VH2 may specifically bind to CD20.
  • VL3 and VH3 may specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2- L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VH1-L16-VH2- L 17-VL2-L18-VL1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22-VH2-L23-VH1 -L24-CH1 -L25-CL- L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7- VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH 1 -L24-CH 1 -L25- CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1-L31-CL-L32-Fc; VL1-L33-VL2-L
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1-L10- Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15-Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 - L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27- VH2-L28-VL2-L29-VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2- L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30- CH1-L31-CL-L32-Fc; VL1-L33-VL2-L34-VH2-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13- VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2- L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1- L31-CL-L32-Fc; VL1-L33-VL2-L34-VH2-L
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • VL2 and VH2 specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4,
  • VL3 and VH3 specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4,
  • the VL2, VL3, VH2, and/or VH3 may specifically bind to CD28, cMet, Trop2, CD20, or CD19; VL1 and/or VH1 may specifically bind to CD28; and VL3 and/or VH3 may specifically bind to CD3.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL2 and VH2 may specifically bind to cMet.
  • VL3 and VH3 may specifically bind to cMet.
  • VL2 and VH2 may specifically bind to Trop2.
  • VL3 and VH3 may specifically bind to Trop2.
  • VL2 and VH2 may specifically bind to CD19.
  • VL3 and VH3 may specifically bind to CD19.
  • VL2 and VH2 may specifically bind to CD20.
  • VL3 and VH3 may specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2- L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VH1-L16-VH2- L 17-VL2-L18-VL1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22-VH2-L23-VH1 -L24-CH1 -L25-CL- L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7- VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH 1 -L24-CH 1 -L25- CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1-L31-CL-L32-Fc; VL1-L33-VL2-L
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1-L10- Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 - L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27- VH2-L28-VL2-L29-VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2- L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30- CH1-L31-CL-L32-Fc; VL1-L33-VL2-L34-VH2-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- CH1-L5-Fc; VH I -L6-VH2-L7-VL2-L8-VLI -L9-CH I -L I 0-Fc; VL1-L11-VL2-L12-VH2-L13- VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2- L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1- L31-CL-L32-Fc; VL1-L33-VL2-L34-V
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • VL1 and VHI specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4, C
  • VL3 and VH3 specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4,
  • VL1, VL3, VH1, and/or VH3 may specifically bind to CD28, cMet, Trop2, CD20, or CD 19; VL2 and/or VH2 may specifically bind to CD28; and VL4 and/or VH4 may specifically bind to CD3.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL1 and VH1 may specifically bind to cMet.
  • VL3 and VH3 may specifically bind to cMet.
  • VL1 and VH1 may specifically bind to Trop2.
  • VL3 and VH3 may specifically bind to Trop2.
  • VL1 and VH1 may specifically bind to CD19.
  • VL3 and VH3 may specifically bind to CD19.
  • VL1 and VH1 may specifically bind to CD20.
  • VL3 and VH3 may specifically bind to CD20.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2- L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14-CL-L15-Fc; VH1-L16-VH2- L 17-VL2-L18-VL1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22-VH2-L23-VH1 -L24-CH1 -L25-CL- L26-Fc; VH I -L27-VH2-L28-VL2-L29-VLI
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD16A, CD19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD
  • the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2-L13-VH1-L14- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-L34
  • the first polypeptide has a structure represented by VL I -L I -VL2-L2-VH2-L3-VH I -L4-CH I -L5-Fc; VH1-L6-VH2-L7- VL2-L8- VL 1 -L9-CH 1 -L 10-Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH 1 -L24-CH 1 -L25- CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1-L31-CL-L32-Fc; VL1-L33-
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-Fc; VH1-L6-VH2-L7-VL2-L8-VL1-L9-CH1-L10- Fc; VL 1 -L 11 - VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 - L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27- VH2-L28-VL2-L29-VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11- VL2-L 12- VH2-L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 -VL2-L22- VH2-L23 - VH1 -L24-CH1 -L25-CL-L26-Fc; VH 1 -L27-VH2-L28-VL2-L29- VLl-L30-CHl-L31-CL-L32-Fc; VL1-L33-VL2-L34-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CH1-L5-Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL1-L11-VL2-L12-VH2- L 13 - VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30- CH1-L31-CL-L32-Fc; VL1-L33-VL2-L34-VH2-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- CH1-L5-Fc; VH I -L6-VH2-L7-VL2-L8-VLI -L9-CH I -L I O-Fc; VL1-L11-VL2-L12-VH2-L13- VH 1 -L 14-CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2- L22-VH2-L23-VH1-L24-CH1-L25-CL-L26-Fc; VH1-L27-VH2-L28-VL2-L29-VL1-L30-CH1- L31-CL-L32-Fc; VL1-L33-VL2-L34-V
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- Fc; VHl-L6-VH2-L7-VL2-L8-VLl-L9-CHl-L10-Fc; VL I -L I I -VL2-LI 2-VH2-LI 3-VH I -LI4- CL-L 15 -Fc; VH 1 -L 16- VH2-L 17- VL2-L 18- VL 1 -L 19-CL-L20-Fc; VL 1 -L21 - VL2-L22- VH2- L23-VH1 -L24-CH1 -L25-CL-L26-Fc; VH1 -L27-VH2-L28-VL2-L29-VL1 -L30-CH1 -L31 -CL- L32-Fc; VL1-L33-VL2-
  • VLI and VHI specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4, CX
  • VL2 and VH2 specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25, CCR3, CCR4, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CXCL2, CXCL4,
  • the VL1, VL2, VH1, and/or VH2 may specifically bind to CD28, cMet, Trop2, CD20, or CD 19; VL3 and/or VH3 may specifically bind to CD28; and VL4 and/or VH4 may specifically bind to CD3.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, cMet, and Trop2.
  • the antigen binding polypeptide complex may specifically bind CD28, CD3, CD19, and CD20.
  • VL1 and VH1 may specifically bind to cMet.
  • VL2 and VH2 may specifically bind to cMet.
  • VL1 and VH1 may specifically bind to Trop2.
  • VL2 and VH2 may specifically bind to Trop2.
  • VL1 and VH1 may specifically bind to CD19.
  • VL2 and VH2 may specifically bind to CD19.
  • VL1 and VH1 may specifically bind to CD20.
  • VL2 and VH2 may specifically bind to CD20.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD28, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to cMet.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD28, VL2 and VH2 specifically bind to cMet, and VL1 and VH1 specifically bind to Trop2.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to Trop2, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to cMet. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to Trop2, VL2 and VH2 specifically bind to cMet, and VL1 and VH1 specifically bind to CD28. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to cMet, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to CD28.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to cMet, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to CD28.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD28, VL2 and VH2 specifically bind to CD20, and VL1 and VH1 specifically bind to CD19.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD28, VL2 and VH2 specifically bind to CD 19, and VL1 and VH1 specifically bind to CD20.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD20, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to CD19. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD20, VL2 and VH2 specifically bind to CD19, and VL1 and VH1 specifically bind to CD28. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD 19, VL2 and VH2 specifically bind to CD20, and VL1 and VH1 specifically bind to CD28. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD 19, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to CD20.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD28, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to cMet.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD28, VL2 and VH2 specifically bind to cMet, and VL1 and VH1 specifically bind to Trop2.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to Trop2, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to cMet. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to Trop2, VL2 and VH2 specifically bind to cMet, and VL1 and VH1 specifically bind to CD28. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to cMet, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to CD28.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to cMet, VL2 and VH2 specifically bind to Trop2, and VL1 and VH1 specifically bind to CD28.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD28, VL2 and VH2 specifically bind to CD20, and VL1 and VH1 specifically bind to CD19.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD28, VL2 and VH2 specifically bind to CD 19, and VL1 and VH1 specifically bind to CD20.
  • VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD20, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to CD19. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD20, VL2 and VH2 specifically bind to CD19, and VL1 and VH1 specifically bind to CD28. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD 19, VL2 and VH2 specifically bind to CD20, and VL1 and VH1 specifically bind to CD28. In some aspects, VL4 and VH4 specifically bind to CD3, VL3 and VH3 specifically bind to CD 19, VL2 and VH2 specifically bind to CD28, and VL1 and VH1 specifically bind to CD20.
  • an antigen binding polypeptide complex comprises a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-L1-CL; VL1-L1-CH1; VH1-L1-CL; or VH1-L1-CH1; wherein the second polypeptide has a structure represented by VH1-L2-CH1-L3-Fc; VH1-L2-CL-L3-Fc; VL1- L2-CH1-L3-Fc; or VL1-L2-CL-L3-Fc; wherein the third polypeptide has a structure represented by VL2-L4-VL3-L5-VH3-L6-VH2-L7-Fc; VL2-L4-VH3-L5-VL3-L6-VH2-L7-Fc; VH2-L4- VL3-L5-VH3-L6-VH2-L7-Fc
  • the antigen binding polypeptide complex may specifically bind one or more of CD20, CD3 and CD28.
  • the antigen binding polypeptide complex may specifically bind CD20 and CD3.
  • the antigen binding polypeptide complex may specifically bind to CD20, CD3 and CD28.
  • VH1 and VL1 may specifically bind to CD20.
  • VH2 and VL2 may specifically bind to CD3.
  • VH2 and VL2 may specifically bind to CD28.
  • VH3 and VL3 may specifically bind to CD28.
  • VH3 and VL3 may specifically bind to CD20.
  • VH3 and VL3 may specifically bind to CD3.
  • VH1 and VL1 may specificially bind to CD20, VH2 and VL2 may specifically bind to CD3, and VH3 and VL3 may specifically bind to CD20.
  • VH1 and VL1 may specificially bind to CD20, VH2 and VL2 may specifically bind to CD3, and VH3 and VL3 may specifically bind to CD28.
  • VH1 and VL1 may specifically bind to CD20, VH2 and VL2 may specifically bind to CD28, and VH3 and VL3 may specifically bind to CD3.
  • an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprises an immunoglobulin hinge.
  • the immunoglobulin hinge comprises an upper hinge region, a middle hinge region, a lower hinge region, or a combination thereof.
  • an antigen binding polypeptide complex e.g., an antibody or antigen binding fragment thereof, or region or domain thereof that "specifically binds” refers to its association with an epitope by its antigen binding domain, and that the binding entails some complementarity between the antigen binding domain and the epitope. Specific binding to an epitope occurs where there is binding to that epitope via its antigen binding domain more readily than there would be binding to a random, unrelated epitope.
  • an “epitope” refers to a localized region of an antigen to which an antigen binding polypeptide complex (e.g., antibody or antigen binding fragment thereof) can specifically bind.
  • An epitope can be, for example, contiguous amino acids of a polypeptide (linear or contiguous epitope) or an epitope can, for example, come together from two or more noncontiguous regions of a polypeptide or polypeptides (conformational, non-linear, discontinuous, or non-contiguous epitope).
  • the epitope to which an antibody or antigen-binding fragment thereof binds can be determined by, e.g., NMR spectroscopy, X-ray diffraction crystallography studies, ELISA assays, hydrogen/deuterium exchange coupled with mass spectrometry (e.g., liquid chromatography electrospray mass spectrometry), array-based oligopeptide scanning assays, and/or mutagenesis mapping (e.g., site-directed mutagenesis mapping).
  • Binding affinity refers to an intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., an antigen binding polypeptide complex and an antigen). Binding affinity can be measured and/or expressed in several ways known in the art, including, but not limited to, equilibrium dissociation constant (KD). KD is calculated from the quotient of koff/kon, where k on refers to the association rate constant of, e.g., an antigen binding polypeptide complex to an antigen, and k O ff refers to the dissociation of, e.g., an antigen binding polypeptide complex from an antigen. The kon and k O ff can be determined by techniques known to one of ordinary skill in the art, such as Octet BLI, BIAcore® or KinExA.
  • an antigen binding polypeptide complex of the invention is an antibody or antigen binding fragment thereof.
  • the antibody or antigen binding fragment thereof specifically binds to an antigen with an equilibrium dissociation constant (KD) of from about 10 pM to about 1 pM.
  • KD equilibrium dissociation constant
  • the antibody is IgG, IgM, IgE, IgA or IgD.
  • the antibody may be IgG.
  • the antibody may be IgM.
  • the antibody may be IgE.
  • the antibody may be IgA.
  • the antibody may be IgD.
  • the IgG is IgGl, IgG2, IgG3 or IgG4.
  • the antibody may be IgGl.
  • the antibody may be IgG2.
  • the antibody may be IgG3.
  • the antibody may be IgG4.
  • the antigen binding fragment is a Fab, scFab, Fab', F(ab')2, Fv or scFv.
  • the antigen binding fragment may be a Fab.
  • the antigen binding fragment may be a scFab.
  • the antigen binding fragment may be a Fab'.
  • the antigen binding fragment may be a F(ab')2.
  • the antigen binding fragment may be a Fv.
  • the antigen binding fragment may be a scFv.
  • the antibody is human or humanized.
  • the antibody may be human.
  • the antibody may be humanized.
  • an antigen binding polypeptide complex of the invention e.g., an antibody or antigen binding fragment thereof
  • an antigen binding polypeptide complex of the invention is bivalent, trivalent, tetravalent, pentavalent or hexavalent.
  • an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) of the invention comprises one or more amino acid linkers between one or more regions of the antigen binding polypeptide complex.
  • amino acid linker refers to a single amino acid or short amino acid sequence that is capable of joining two polypeptide regions of the invention described herein in a stable manner that maintains or promotes a function associated with the polypeptide regions.
  • an amino acid linker is represented herein in a structure of an antigen binding polypeptide complex by the abbreviation "1" or "L” and a number (e.g., LI to denote a first linker, L2 to denote a second linker, L3 to denote a third linker, L4 to denote a fourth linker, L5 to denote a fifth linker, L6 to denote a sixth linker, L7 to denote a seventh linker, L8 to denote an eighth linker, and so on).
  • such enumerated amino acid linkers e.g., LI

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Animal Behavior & Ethology (AREA)
  • Cell Biology (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2022/082131 2021-12-21 2022-12-21 Conditionally activated antigen binding polypeptide complexes and methods of use thereof Ceased WO2023122659A2 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
IL313770A IL313770A (en) 2021-12-21 2022-12-21 Conditionally active antigen-binding polypeptide complexes and methods of their use
KR1020247024380A KR20240134257A (ko) 2021-12-21 2022-12-21 조건부로 활성화된 항원 결합 폴리펩티드 복합체 및 이의 사용 방법
EP22912696.6A EP4452317A4 (en) 2021-12-21 2022-12-21 CONDITIONALLY ACTIVATED ANTIGEN-BINDING POLYPEPTIDE COMPLEXES AND THEIR METHODS OF USE
AU2022420594A AU2022420594A1 (en) 2021-12-21 2022-12-21 Conditionally activated antigen binding polypeptide complexes and methods of use thereof
JP2024537849A JP2025503480A (ja) 2021-12-21 2022-12-21 条件付きで活性化される抗原結合ポリペプチド複合体及びその使用方法
CA3240079A CA3240079A1 (en) 2021-12-21 2022-12-21 Conditionally activated antigen binding polypeptide complexes and methods of use thereof
MX2024007393A MX2024007393A (es) 2021-12-21 2022-12-21 Complejos polipeptidicos de union a antigeno activados condicionalmente y metodos de uso de los mismos.
CN202280089147.5A CN118715247A (zh) 2021-12-21 2022-12-21 条件性活化的抗原结合多肽复合物及其使用方法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202163292382P 2021-12-21 2021-12-21
US63/292,382 2021-12-21

Publications (2)

Publication Number Publication Date
WO2023122659A2 true WO2023122659A2 (en) 2023-06-29
WO2023122659A3 WO2023122659A3 (en) 2023-08-03

Family

ID=86903785

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/082131 Ceased WO2023122659A2 (en) 2021-12-21 2022-12-21 Conditionally activated antigen binding polypeptide complexes and methods of use thereof

Country Status (13)

Country Link
US (1) US20240059798A1 (https=)
EP (1) EP4452317A4 (https=)
JP (1) JP2025503480A (https=)
KR (1) KR20240134257A (https=)
CN (4) CN118251411A (https=)
AR (1) AR128060A1 (https=)
AU (1) AU2022420594A1 (https=)
CA (1) CA3240079A1 (https=)
CL (1) CL2024001850A1 (https=)
IL (1) IL313770A (https=)
MX (1) MX2024007393A (https=)
TW (1) TW202334204A (https=)
WO (1) WO2023122659A2 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025249301A1 (ja) * 2024-05-27 2025-12-04 国立大学法人東京農工大学 多重特異性抗体、がん増殖抑制剤、ポリヌクレオチド及び発現ベクター
WO2026002054A1 (zh) * 2024-06-25 2026-01-02 冕屹立生物技术(上海)有限公司 一种靶向cd3和cd19的结合分子

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111201030B (zh) 2017-07-25 2024-11-01 真和制药有限公司 通过阻断tim-3和其配体的相互作用治疗癌症
WO2020160156A2 (en) 2019-01-30 2020-08-06 Immutics, Inc. Anti-gal3 antibodies and uses thereof
EP4157338A4 (en) 2020-05-26 2024-11-13 TrueBinding, Inc. METHOD FOR TREATING INFLAMMATORY DISEASES BY GALECTIN-3 BLOCKING

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TWI743461B (zh) * 2011-03-28 2021-10-21 法商賽諾菲公司 具有交叉結合區定向之雙重可變區類抗體結合蛋白
US9458244B2 (en) * 2012-12-28 2016-10-04 Abbvie Inc. Single chain multivalent binding protein compositions and methods
RS62437B1 (sr) * 2015-10-25 2021-11-30 Sanofi Sa Trispecifični i/ili trivalentni vezujući proteini za prevenciju ili lečenje hiv infekcije
CA3020633A1 (en) * 2016-04-13 2017-10-19 Sanofi Trispecific and/or trivalent binding proteins
WO2018075564A1 (en) * 2016-10-17 2018-04-26 University Of Maryland, College Park Multispecific antibodies targeting human immunodeficiency virus and methods of using the same
BR112020016944A2 (pt) * 2018-02-20 2020-12-15 Dragonfly Therapeutics, Inc. Domínios variáveis de anticorpo que alvejam cd33 e uso dos mesmos
MX2021000307A (es) * 2018-07-11 2021-09-08 Momenta Pharmaceuticals Inc Composiciones y métodos relacionados con constructos de dominio de unión a antígeno-fc dirigidos a cd38 diseñados por ingeniería genética.
US12365722B2 (en) * 2018-10-19 2025-07-22 University Of Maryland, College Park Multispecific antibodies targeting multiple epitopes on the HIV-1 envelope
AU2019372673A1 (en) * 2018-11-01 2021-05-27 Gracell Biotechnologies (Shanghai) Co., Ltd. Compositions and methods for T cell engineering
US11613576B2 (en) * 2019-04-09 2023-03-28 Sanofi Trispecific binding proteins, methods, and uses thereof
TW202104274A (zh) * 2019-04-09 2021-02-01 法商賽諾菲公司 用於治療hiv感染之三特異性及/或三價結合蛋白
TW202330594A (zh) * 2021-09-29 2023-08-01 美商莫德斯醫療公司 抗原結合多肽、抗原結合多肽複合物及其使用方法
IL313617A (en) * 2021-12-17 2024-08-01 Modex Therapeutics Inc Antigen-binding polypeptide complexes containing extracellular regions of TNFSF ligands

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025249301A1 (ja) * 2024-05-27 2025-12-04 国立大学法人東京農工大学 多重特異性抗体、がん増殖抑制剤、ポリヌクレオチド及び発現ベクター
WO2026002054A1 (zh) * 2024-06-25 2026-01-02 冕屹立生物技术(上海)有限公司 一种靶向cd3和cd19的结合分子

Also Published As

Publication number Publication date
CL2024001850A1 (es) 2025-02-21
CN118251411A (zh) 2024-06-25
TW202334204A (zh) 2023-09-01
EP4452317A4 (en) 2025-12-10
US20240059798A1 (en) 2024-02-22
EP4452317A2 (en) 2024-10-30
CN118715247A (zh) 2024-09-27
WO2023122659A3 (en) 2023-08-03
CA3240079A1 (en) 2023-06-29
KR20240134257A (ko) 2024-09-06
JP2025503480A (ja) 2025-02-04
MX2024007393A (es) 2024-07-04
CN118591388A (zh) 2024-09-03
AU2022420594A1 (en) 2024-08-01
CN118317979A (zh) 2024-07-09
AR128060A1 (es) 2024-03-20
IL313770A (en) 2024-08-01

Similar Documents

Publication Publication Date Title
US20240059798A1 (en) Conditionally activated antigen binding polypeptide complexes and methods of use thereof
JP2023061969A (ja) Sirp-アルファドメインまたはそのバリアントを有する構築物
EP4225373A1 (en) Anti-dectin-1 antibodies and methods of use thereof
WO2023056312A1 (en) Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof
JP7822576B2 (ja) 抗cldn4-抗cd137二重特異性抗体
CN113490690A (zh) 异源二聚体融合蛋白
US20250230240A1 (en) Variant antibodies that bind gamma-delta t cell receptors
US20240034808A1 (en) Antigen binding polypeptide complexes containing extracellular domains of tnfsf ligands
US20180371089A1 (en) Asymmetric heterodimeric fc-scfv fusion anti-globo h and anti-cd3 bispecific antibody and uses thereof in caner therapy
EP4676972A1 (en) Isolated bispecific antibody that specifically binds to cd3 and tumor antigen, and use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22912696

Country of ref document: EP

Kind code of ref document: A2

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
WWE Wipo information: entry into national phase

Ref document number: 3240079

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2024/007393

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 313770

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2024537849

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 202417053972

Country of ref document: IN

Ref document number: AU2022420594

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 202280089147.5

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 20247024380

Country of ref document: KR

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22912696

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2022912696

Country of ref document: EP

Effective date: 20240722

ENP Entry into the national phase

Ref document number: 2022420594

Country of ref document: AU

Date of ref document: 20221221

Kind code of ref document: A